Basic Information | |
---|---|
Family ID | F069185 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 44 residues |
Representative Sequence | PHELTPACKAAGVKLFPSWQFGADPPKEGVLSLEALRDKTGCSLP |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.81 % |
% of genes near scaffold ends (potentially truncated) | 99.19 % |
% of genes from short scaffolds (< 2000 bps) | 88.71 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (9.677 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.452 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF07884 | VKOR | 83.06 |
PF00756 | Esterase | 9.68 |
PF09594 | GT87 | 3.23 |
PF00781 | DAGK_cat | 0.81 |
PF01740 | STAS | 0.81 |
PF00365 | PFK | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 83.06 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.61 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100558887 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300000567|JGI12270J11330_10299095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100699721 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300004091|Ga0062387_101061096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300004092|Ga0062389_102441109 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300004152|Ga0062386_100931481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300004633|Ga0066395_10626684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300004635|Ga0062388_101289382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300005434|Ga0070709_10108485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1862 | Open in IMG/M |
3300005529|Ga0070741_10739246 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300005541|Ga0070733_10077005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2107 | Open in IMG/M |
3300005541|Ga0070733_10663941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300005541|Ga0070733_11187786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300005560|Ga0066670_10616493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
3300005591|Ga0070761_10150398 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300005598|Ga0066706_11060723 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005610|Ga0070763_10051100 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300005921|Ga0070766_10924329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300006052|Ga0075029_101310139 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006059|Ga0075017_101330860 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006086|Ga0075019_11008370 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300006162|Ga0075030_100121522 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300006162|Ga0075030_101549490 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006174|Ga0075014_100593279 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300006176|Ga0070765_101096668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria | 752 | Open in IMG/M |
3300006176|Ga0070765_101333434 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006800|Ga0066660_11671851 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300007982|Ga0102924_1253528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300009137|Ga0066709_100001285 | All Organisms → cellular organisms → Bacteria | 16237 | Open in IMG/M |
3300009137|Ga0066709_100869091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
3300009616|Ga0116111_1132486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300009672|Ga0116215_1462760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300009700|Ga0116217_10365124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
3300010343|Ga0074044_10371633 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300010376|Ga0126381_100084928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3997 | Open in IMG/M |
3300012203|Ga0137399_11310098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300012207|Ga0137381_10865333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
3300012961|Ga0164302_11701663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300012971|Ga0126369_11294961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300014501|Ga0182024_11712644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300014501|Ga0182024_12629892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300014501|Ga0182024_12629897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300015245|Ga0137409_10804596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300016270|Ga0182036_11067808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
3300017822|Ga0187802_10292462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300017927|Ga0187824_10255827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300017933|Ga0187801_10524279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300017972|Ga0187781_11360207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300018025|Ga0187885_10505985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300018086|Ga0187769_10773429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300018088|Ga0187771_10033822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3907 | Open in IMG/M |
3300018088|Ga0187771_11783286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300018088|Ga0187771_11837486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300020579|Ga0210407_10670596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300020579|Ga0210407_10869632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300020583|Ga0210401_11352223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300021401|Ga0210393_10726528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300021404|Ga0210389_10843820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300021406|Ga0210386_10484710 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300021420|Ga0210394_10567400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
3300021560|Ga0126371_13273657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300024225|Ga0224572_1080518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300025134|Ga0207416_1037170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2198 | Open in IMG/M |
3300025406|Ga0208035_1076614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300025898|Ga0207692_10804226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300026316|Ga0209155_1220629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300027334|Ga0209529_1087661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300027795|Ga0209139_10015029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2831 | Open in IMG/M |
3300027812|Ga0209656_10522315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300027821|Ga0209811_10376091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300027853|Ga0209274_10650174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300027855|Ga0209693_10253272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
3300027867|Ga0209167_10392102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300027884|Ga0209275_10320280 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300027889|Ga0209380_10265763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300027898|Ga0209067_10086831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1616 | Open in IMG/M |
3300027911|Ga0209698_10955495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300028731|Ga0302301_1103595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300028789|Ga0302232_10129407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
3300028906|Ga0308309_10952861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300028906|Ga0308309_11795681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300029636|Ga0222749_10646826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300029911|Ga0311361_10797731 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300029913|Ga0311362_10145888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2905 | Open in IMG/M |
3300029952|Ga0311346_11212509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300029954|Ga0311331_11009899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300030007|Ga0311338_11273985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300030011|Ga0302270_10386768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300030020|Ga0311344_10085597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3657 | Open in IMG/M |
3300030043|Ga0302306_10104323 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300030045|Ga0302282_1204981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300030490|Ga0302184_10141382 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300030494|Ga0310037_10309326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300030524|Ga0311357_10229291 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300030580|Ga0311355_11759581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300030693|Ga0302313_10068437 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300031234|Ga0302325_11096261 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300031234|Ga0302325_12742918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300031249|Ga0265339_10500584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300031344|Ga0265316_10225085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1383 | Open in IMG/M |
3300031474|Ga0170818_105204582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300031525|Ga0302326_10041885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8912 | Open in IMG/M |
3300031525|Ga0302326_10775379 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
3300031708|Ga0310686_116999477 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
3300031715|Ga0307476_10265576 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300031715|Ga0307476_10595860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300031715|Ga0307476_10646910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300031718|Ga0307474_10628074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300031718|Ga0307474_11216424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300031753|Ga0307477_10388868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 956 | Open in IMG/M |
3300031753|Ga0307477_10897191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300031823|Ga0307478_10070563 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
3300031823|Ga0307478_11408291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300031954|Ga0306926_11184638 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300032076|Ga0306924_10871002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
3300032829|Ga0335070_10219367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1883 | Open in IMG/M |
3300032892|Ga0335081_11451935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300032898|Ga0335072_11026870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300033134|Ga0335073_10879083 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300033158|Ga0335077_10468489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
3300034124|Ga0370483_0000417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12138 | Open in IMG/M |
3300034124|Ga0370483_0120068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
3300034163|Ga0370515_0195801 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300034282|Ga0370492_0160594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.26% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.45% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.23% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.42% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.61% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1005588874 | 3300000364 | Soil | EENPHDLTPTCKAAGVKLFPSWQFGADPPKEGVLSLEALSEKTGCRLP* |
JGI12270J11330_102990952 | 3300000567 | Peatlands Soil | APECKIAGTKLFPSWQFGTNPPKEGVLSLSELADKTGCRLP* |
JGIcombinedJ26739_1006997211 | 3300002245 | Forest Soil | CKAAGVKLFPSWQFGNNPPKEGVLSLEELRDKTGCSLQ* |
Ga0062387_1010610962 | 3300004091 | Bog Forest Soil | ECAAAKVKLFPSWQFGTNPPKEGVFPLDELSDKTGCALP* |
Ga0062389_1024411091 | 3300004092 | Bog Forest Soil | AECAIKGSKELAPECKAAGVKLFPSWQFGANPPVEGVFPMQELSDKTGCSLP* |
Ga0062386_1009314811 | 3300004152 | Bog Forest Soil | VKGSRELADECKIAGAKLFPSWQFGMEPPKEGVLSLEALSDKTGCSLP* |
Ga0066395_106266841 | 3300004633 | Tropical Forest Soil | QCKAAGVKLFPSWQFGQDPPKEGVLTLQDLSQKTGCGLP* |
Ga0062388_1012893821 | 3300004635 | Bog Forest Soil | TECAIKGSPEMAAECRVAGVKLFPSWQFGMDPPKEGVLSLEALSDKTGCKLP* |
Ga0070709_101084854 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PECKVAGAKLFPSWQFGMDPPKEGILSMETLSDKTGCSLP* |
Ga0070741_107392463 | 3300005529 | Surface Soil | QECALKEKPGEMAPQCKAAGVKLFPSWQFGSNAPTEGVFSLDELSDKTGCSLP* |
Ga0070733_100770051 | 3300005541 | Surface Soil | APVCKMADVKLFPSWQFGVEPPKEGILSLQALSDKTGCALP* |
Ga0070733_106639411 | 3300005541 | Surface Soil | ELTPECKAAGVKLFPSWQFGTNPPVEGIFPMQELSDKTGCSLP* |
Ga0070733_111877862 | 3300005541 | Surface Soil | AIKGSPGVLAPECRIAGVKLFPSWQFGTEPPKEGVLSLSALSDKTGCSLP* |
Ga0066670_106164932 | 3300005560 | Soil | DNPHEITPECKIAGVKLFPSWQFGTESPKEGVLSLDALSDKTGCSLP* |
Ga0070761_101503981 | 3300005591 | Soil | CAIKGSNQLRPACAAAGVKLFPSWQFGTAQPIAGVFPLEELSDKTGCSLP* |
Ga0066706_110607232 | 3300005598 | Soil | ECASENDPHELTPACKAVGVKLFPSWQFGADPPKEGVLTLQELSQKTGCSLP* |
Ga0070763_100511001 | 3300005610 | Soil | AATKDETPECKAGGLKLFPSWQFGTEPPKEGVLSLEALSDKTGCSLP* |
Ga0070766_109243291 | 3300005921 | Soil | AAGVKLFPSWQFGGNPPIEGVFPLQVLGSQTGCSLP* |
Ga0075029_1013101391 | 3300006052 | Watersheds | GSSELQPECKIAGVKLFPSWQFSDEPPKEGVLSLAALSDKTGCSLP* |
Ga0075017_1013308602 | 3300006059 | Watersheds | AGVKLFPSWQFGDESPKEGVLSMEALSDKTGCSLP* |
Ga0075019_110083702 | 3300006086 | Watersheds | ECASENDPHELTPACKAAGVKLFPSWQFGADPPKEGVLTLQELSQKTGCGLP* |
Ga0075030_1001215224 | 3300006162 | Watersheds | AGVKLFPSWQFGMEAPKEGVLSLDALSDKTGCSLP* |
Ga0075030_1015494902 | 3300006162 | Watersheds | GSSELQPECKIAGVKLFPSWQFSDEPPKEGVLSLEALSDKTGCSLP* |
Ga0075014_1005932791 | 3300006174 | Watersheds | VKGSTEEAAECKIAGVKMFPSWQFGMESPKEGVLSLDALGDKTGCSLP* |
Ga0070765_1010966681 | 3300006176 | Soil | AAGVKLFPSWQFGANPPKEGVFPLEELSDKTGCALP* |
Ga0070765_1013334341 | 3300006176 | Soil | APECTAAKVKLFPSWQFGASPPKEGVFPLNELSDKTGCSLP* |
Ga0066660_116718511 | 3300006800 | Soil | SENDPHELTPACKAVGVKLFPSWQFGADPPKEGVLTLQELSQKTGCSLP* |
Ga0102924_12535281 | 3300007982 | Iron-Sulfur Acid Spring | REEATECKVAGVKLFPSWQFGMDPPREGVLSLEALSDKTGCSLP* |
Ga0066709_10000128515 | 3300009137 | Grasslands Soil | QECAIKGSREMAPECKAAGAKNFPSWQFEGAPIHEGVLPLEDLSQRTGCSLP* |
Ga0066709_1008690913 | 3300009137 | Grasslands Soil | EEAAVCKIAGVKLFPSWQFAGEQPKEGVLSLEALSDKTGCSLP* |
Ga0116111_11324862 | 3300009616 | Peatland | CKIAGVKLFPSWQFGMEPPKEGVLSLEALSDKTGCNLP* |
Ga0116215_14627601 | 3300009672 | Peatlands Soil | IKGSSEMAPECKIAGTKLFPSWQFGTNPPKEGVLSLSELADKTGCRLP* |
Ga0116217_103651241 | 3300009700 | Peatlands Soil | AGVKLFPSWQFGTNPPKEGVFPLQELSDKTGCSLP* |
Ga0074044_103716333 | 3300010343 | Bog Forest Soil | QAAGVKLFPSWQFGSNLPVEGVFPMQELSDKTGCSLP* |
Ga0126381_1000849286 | 3300010376 | Tropical Forest Soil | KDKPGELAPACKAAGVKLFPSWQFAGEQPREGVLSLEALSDKTGCSLP* |
Ga0137399_113100981 | 3300012203 | Vadose Zone Soil | LAPACTAAGVKLFPSWQFGANKPIEGVFPMEELRDKTGCVLP* |
Ga0137381_108653331 | 3300012207 | Vadose Zone Soil | SSSEEDSVCKIAGVKLFPSWQFGQEPPKEGVLSMEALSDKTGCALP* |
Ga0164302_117016631 | 3300012961 | Soil | ASENDPHELTAACKAAGAKLFPSWQFGSDPPKEGVLSMEELSQKTGCSLP* |
Ga0126369_112949611 | 3300012971 | Tropical Forest Soil | KDKPGELAPACKAAGVKLFPSWQFAGEAPREGVLSMEALSDKTGCSLP* |
Ga0182024_117126442 | 3300014501 | Permafrost | GVKLFPSWQFGANKPTEGVFPLEELSDKTGCSLP* |
Ga0182024_126298922 | 3300014501 | Permafrost | CAIKGSKELAAECKMAGVKLFPSWQFGMEPPKEGVLSLEALSDKTGCSLP* |
Ga0182024_126298972 | 3300014501 | Permafrost | CAIKGSKELAAECKMAGVKLFPSWQFGMEPPKEGVLSLEALGDKTGCSLP* |
Ga0137409_108045961 | 3300015245 | Vadose Zone Soil | HELTAACKAAGVKLFPSWQFGSDPPKEGVLSLQELSQKTGCSLP* |
Ga0182036_110678081 | 3300016270 | Soil | PHELTPACKAAGVKLFPSWQFGADPPKEGVLSLEALRDKTGCSLP |
Ga0187802_102924621 | 3300017822 | Freshwater Sediment | IKGSTEMAPECKLAGTKLFPSWQFGTDRPKEGVLSLSELADKTGCHLP |
Ga0187824_102558272 | 3300017927 | Freshwater Sediment | AIRGSRELAPECKTAGVKLFPSWQFGSDPPKEGVLSLEELSHKSGCSLP |
Ga0187801_105242792 | 3300017933 | Freshwater Sediment | PGSGQMQPVCQAAGVKLFPSWQFGAAPPKEGVLSLEELSARTGCSLP |
Ga0187781_113602071 | 3300017972 | Tropical Peatland | KAAGVKLFPSWQFGSDPPKEGVLSLRALSDKTGCSLP |
Ga0187885_105059852 | 3300018025 | Peatland | AIKGSSEMAPECKAAGLKLFPSWQFGTEPPKEGVLPLEELSEKTGCSLP |
Ga0187769_107734291 | 3300018086 | Tropical Peatland | RELTPACQAAGVKHFPTWQFGANAQPVEGVFPIEELSDKTGCSLQ |
Ga0187771_100338225 | 3300018088 | Tropical Peatland | LAPECKIAGAKLFPSWQFGMEPPKEGVLSLEALSDKTGCSLP |
Ga0187771_117832862 | 3300018088 | Tropical Peatland | ELAPTCKIAGAKLFPSWQLGTDPPKEGVLSLEALSDKTGCSLP |
Ga0187771_118374861 | 3300018088 | Tropical Peatland | IKGSKELAPECKVAGVKLFPSWQFGMDPPKEGVLSLEALSDKTGCSLP |
Ga0210407_106705963 | 3300020579 | Soil | KAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0210407_108696321 | 3300020579 | Soil | VPACKIAGIKLFPSWQFGMETPKEGVLSLEALSDKTGCSLP |
Ga0210401_113522232 | 3300020583 | Soil | HGETAECKAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0210393_107265283 | 3300021401 | Soil | PELVPACKVAGIKLFPSWQFGMDPPKEGVLSLDALSDKTGCSLP |
Ga0210389_108438201 | 3300021404 | Soil | CASENDPHELTPACKAAGVKLFPSWQFGADPPKEGVLTLQELSQKTGCSLP |
Ga0210386_104847101 | 3300021406 | Soil | NDPHELTPACKAAGVKLFPSWQFGAEPPKEGVLTLQELSQKTGCSLP |
Ga0210394_105674001 | 3300021420 | Soil | AGPHGETAECKAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0126371_132736571 | 3300021560 | Tropical Forest Soil | KDKPGELAPACKAAGVKLFPSWQFAGEQPREGVLSLEALSDKTGCSLP |
Ga0224572_10805181 | 3300024225 | Rhizosphere | CAIKGSREMTAACKAAGVQHYPTWQFGASPLVEGKFPLQELSDKTGCSLP |
Ga0207416_10371704 | 3300025134 | Iron-Sulfur Acid Spring | VKGVNGITSECKAAGVKLFPSWQFGTNPPKEGVFPLEELSDKTGCTLP |
Ga0208035_10766142 | 3300025406 | Peatland | DECKAAGVKLFPSWQFGNNPPKEGVLSLDELRDKTGCSLP |
Ga0207692_108042262 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ALKEIPGEMAPQCKAAGVKLFPSWQFGSNAPIEGVFSLDELSDKTACSLP |
Ga0209155_12206292 | 3300026316 | Soil | ECALKEKPGEMAPQCKAAGVKLFPSWQFGSNPPTEGVFSLDELSDKTGCSLP |
Ga0209529_10876611 | 3300027334 | Forest Soil | KEEAAECKVAGVKLFPSWQFGMEPPKEGVLSLEALSDKTGCSLP |
Ga0209139_100150291 | 3300027795 | Bog Forest Soil | YTECAIKGSHDITAECKAAGIKLFPSWQFGANPPVPSVFPLEVLSAQTGCSLP |
Ga0209656_105223152 | 3300027812 | Bog Forest Soil | NSREMAPACKAAGVQHFPTWQFGAGPLVEGKFPMQELSDKTGCSLP |
Ga0209811_103760911 | 3300027821 | Surface Soil | ELTAACKAAGAKLFPSWQFGSDPPKEGVLSMEELSQKTGCSLP |
Ga0209274_106501742 | 3300027853 | Soil | REMAPACKAAGVQHYPTWQFGASPLVEGKFPLQELSDKTGCSLP |
Ga0209693_102532721 | 3300027855 | Soil | AATKDETPECKAGGLKLFPSWQFGTEPPKEGVLSLEALSDKTGCSLP |
Ga0209167_103921021 | 3300027867 | Surface Soil | VECAIKGSRELTPECKAAGVKLFPSWQFGTNPPVEGIFPMQELSDKTGCSLP |
Ga0209275_103202801 | 3300027884 | Soil | QAAGVKLFPSWQFGANPPKEGVFPLEELSDKTGCALP |
Ga0209380_102657633 | 3300027889 | Soil | VAGIKLFPSWQFGFDPPKEGVLSLEALSDKTGCSLP |
Ga0209067_100868313 | 3300027898 | Watersheds | ELTPDCKAAGVKLFPSWQFGSDPPKEGVLSLQDLSQKTGCSLP |
Ga0209698_109554951 | 3300027911 | Watersheds | ELTPACKAAGVKLFPSWQFGADPPKEGVLTLQELSQKTGCGLP |
Ga0302301_11035951 | 3300028731 | Palsa | AAGVKLFPSWQFGANPPKEGVFPLEELADKTGCSLQ |
Ga0302232_101294071 | 3300028789 | Palsa | KAAGVKLFPSWQFGANPPKEGVFPLEELADKTGCSLQ |
Ga0308309_109528613 | 3300028906 | Soil | AAGVKLFPSWQFGANPPKEGVFPLEELSDKTGCALP |
Ga0308309_117956812 | 3300028906 | Soil | ECAAGVHGETAECKAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0222749_106468262 | 3300029636 | Soil | VHYVECAIKGSKELAPECKAAGVKLFPAWQFGANPPVEGVFPMEELSDKTGCALP |
Ga0311361_107977311 | 3300029911 | Bog | CKAAGVKLFPSWQFGSNRPTEGVFPLNELSDKTGCSLP |
Ga0311362_101458884 | 3300029913 | Bog | KAAGVKLFPSWQFGSNKPIEGVFPLEELRDKTGCSLP |
Ga0311346_112125091 | 3300029952 | Bog | SRQLAPVCAAAGVKLFPSWQFGANPPKEGVFELEELSDKTGCTLP |
Ga0311331_110098991 | 3300029954 | Bog | CAAAGVKLFPSWQFGANPPKEGVFELEELSDKTGCTLP |
Ga0311338_112739851 | 3300030007 | Palsa | SPHQLTDECKAAGVKLFPSWQFGNNPPKEGVLSLEELRDKTGCSLP |
Ga0302270_103867681 | 3300030011 | Bog | KGSREMTPACKAANVEHFPTWQFGAGPLVEGKFPLQELSDKTGCSLP |
Ga0311344_100855971 | 3300030020 | Bog | AANVQHFPSWQFGDGPLVENVFPLEELSDKTGCSLP |
Ga0302306_101043231 | 3300030043 | Palsa | KDETPECKAGGLKLFPSWQFGTAPPKEGVLSLEALSDKTGCSLP |
Ga0302282_12049813 | 3300030045 | Fen | KAANVEHFPTWQFGAGPLVEGKFPLQELSDKTGCSLP |
Ga0302184_101413821 | 3300030490 | Palsa | KGSHELAPACKAAGVKLFPSWQFGANPPKEGVFPLEELADKTGCSLQ |
Ga0310037_103093261 | 3300030494 | Peatlands Soil | SSEMAPECKIAGTKLFPSWQFGTNPPKEGALSLGELADKTGCRLP |
Ga0311357_102292911 | 3300030524 | Palsa | AGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0311355_117595812 | 3300030580 | Palsa | ECAIKGSHELAPACQAAGVKFFPSWQFGTNPPIEGVFPMQELSDKTGCSLP |
Ga0302313_100684373 | 3300030693 | Palsa | IKGASGITAECKAAGVKLFPSWQFGANPPKEGVFPMEELSDKTGCPLP |
Ga0302325_110962613 | 3300031234 | Palsa | HGEAAECKAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0302325_127429181 | 3300031234 | Palsa | YQECAIKGSPHQLTDECKAAGVKLFPSWQFGNNPPKEGVLSLEELRDKTGCSLP |
Ga0265339_105005842 | 3300031249 | Rhizosphere | ELAPACKAAGVKLFPSWQFGNEAPKEGVLSLEALSDKTGCALP |
Ga0265316_102250853 | 3300031344 | Rhizosphere | HYEECGIVETHEETPACKIQGIKLFPSWQFGTDPPREGVLSMESLSERTGCSLP |
Ga0170818_1052045822 | 3300031474 | Forest Soil | VECAIKGSSELAPECKVAGAKLFPSWQFGMDPPKEGILSMEALSDKTGCSLP |
Ga0302326_100418858 | 3300031525 | Palsa | HDEAPECKAAGAKLFPSWQFGSDPPKEGVLRLEQLSEKTGCGLP |
Ga0302326_107753793 | 3300031525 | Palsa | EGLHGETAECKAAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0310686_1169994774 | 3300031708 | Soil | MTAACKAAGVQHYPTWQFGAGPLVEGKFPLQELSDKTGCSLP |
Ga0307476_102655763 | 3300031715 | Hardwood Forest Soil | ECAIKGTSELATACKIAGVKLFPSWQFGAEPPKEGVLSLDALSDKTGCALP |
Ga0307476_105958601 | 3300031715 | Hardwood Forest Soil | EEATECKVAGVKLFPSWQFGMEPPKEGVLSLEALSDKTGCSLP |
Ga0307476_106469101 | 3300031715 | Hardwood Forest Soil | PHELTPACKAAGVKLFPSWQFGADPPKEGVLTLQELSQKTGCSLP |
Ga0307474_106280741 | 3300031718 | Hardwood Forest Soil | KAAGLKLFPSWQFGVQPPKEGVLPLEELSEKTGCSLP |
Ga0307474_112164241 | 3300031718 | Hardwood Forest Soil | HELAAACTAAGVKLFPSWQFGSNKPIEGVFPMQELSDKTGCSLP |
Ga0307477_103888683 | 3300031753 | Hardwood Forest Soil | HELTPACKAAGVKLFPSWQFGADPPKEGVLTLQELSQKTGCSLP |
Ga0307477_108971911 | 3300031753 | Hardwood Forest Soil | VECAIKGSREMSAACTAAGVHNFPSWQFGNGPLVEAVFPLQELSDKTGCSLP |
Ga0307478_100705634 | 3300031823 | Hardwood Forest Soil | KAAGVKLFPSWQFGPNPPIEGVFPLQELSDKTGCSLP |
Ga0307478_114082912 | 3300031823 | Hardwood Forest Soil | AGVKLFPSWQFGANPPIEGVFPLQELSDKTGCSLP |
Ga0306926_111846383 | 3300031954 | Soil | DKPGELAPECKAAGVKLFPSWQFGSDPPKEGVLELQSLSDKTGCSLP |
Ga0306924_108710021 | 3300032076 | Soil | PHELGPVCKAAGVKLFPSWQFGTDPPKEGVLTLEALSQKTGCSLP |
Ga0335070_102193674 | 3300032829 | Soil | AGVKLFPSWQFGTDPPKEGVLSLHDLSAKTGCTLP |
Ga0335081_114519353 | 3300032892 | Soil | KGSSELQPQCKIAGAKLFPAWQFGMDPPKEGVLSLEALSDKTGCSLP |
Ga0335072_110268701 | 3300032898 | Soil | CALSHTEETPECKAAGVEHFPSWQFGSEPPKEGVLSLDALSDKTGCSLP |
Ga0335073_108790833 | 3300033134 | Soil | TPCKIAGVKLFPTWQFGNEPPKEGVLSLDAISDKTGCKLP |
Ga0335077_104684891 | 3300033158 | Soil | APVCQAAGIKLFPSWQFGTEQPKEGVLSLEELSAKTGCRLP |
Ga0370483_0000417_12004_12138 | 3300034124 | Untreated Peat Soil | SGITAECKAAGVKLFPSWQFGANPPKEGVFPLEELSDKTGCPLP |
Ga0370483_0120068_2_148 | 3300034124 | Untreated Peat Soil | VKGVSGITAECKAAGVKLFPSWQFGTNPPTPGVFPMQELSDKTGCSLP |
Ga0370515_0195801_1_111 | 3300034163 | Untreated Peat Soil | AAGVKLFPSWQFGNNPPKEGVLSLEELGDKTGCSLP |
Ga0370492_0160594_2_160 | 3300034282 | Untreated Peat Soil | QECAIKGSSEVAPPCKIAGVKLFPSWQFGVEPPKEGVLSLDALSDKTGCSLP |
⦗Top⦘ |