| Basic Information | |
|---|---|
| Family ID | F069181 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVETP |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 91.13 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.065 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.355 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00994 | MoCF_biosynth | 87.90 |
| PF08530 | PepX_C | 2.42 |
| PF00486 | Trans_reg_C | 0.81 |
| PF01638 | HxlR | 0.81 |
| PF03091 | CutA1 | 0.81 |
| PF03899 | ATP-synt_I | 0.81 |
| PF14748 | P5CR_dimer | 0.81 |
| PF03807 | F420_oxidored | 0.81 |
| PF09527 | ATPase_gene1 | 0.81 |
| PF00119 | ATP-synt_A | 0.81 |
| PF00507 | Oxidored_q4 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 2.42 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.81 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.81 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG3312 | FoF1-type ATP synthase accessory protein AtpI | Energy production and conversion [C] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.06 % |
| Unclassified | root | N/A | 16.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02QH1C8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 522 | Open in IMG/M |
| 2189573004|GZGWRS402JSTVD | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300000559|F14TC_103736883 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300002914|JGI25617J43924_10326098 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300004091|Ga0062387_101770147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005180|Ga0066685_10374309 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300005181|Ga0066678_10746321 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005332|Ga0066388_104578130 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005353|Ga0070669_101133192 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005446|Ga0066686_10406157 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005552|Ga0066701_10668996 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005559|Ga0066700_10623359 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005568|Ga0066703_10418604 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005575|Ga0066702_10707688 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005610|Ga0070763_10097315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1479 | Open in IMG/M |
| 3300005764|Ga0066903_106934087 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006174|Ga0075014_101004076 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006794|Ga0066658_10664838 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006796|Ga0066665_10687875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300006954|Ga0079219_11008560 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300007258|Ga0099793_10648561 | Not Available | 531 | Open in IMG/M |
| 3300009088|Ga0099830_11015518 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009089|Ga0099828_10486301 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300009089|Ga0099828_10794121 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300009700|Ga0116217_10587145 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300010343|Ga0074044_10305365 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300010358|Ga0126370_10087217 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300010359|Ga0126376_11892421 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010359|Ga0126376_12775746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300010362|Ga0126377_12663234 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010366|Ga0126379_12255214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300010398|Ga0126383_13014981 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300011269|Ga0137392_10442465 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300011271|Ga0137393_10151249 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300011271|Ga0137393_10794086 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012096|Ga0137389_11302176 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012189|Ga0137388_10020382 | All Organisms → cellular organisms → Bacteria | 4966 | Open in IMG/M |
| 3300012202|Ga0137363_11769299 | Not Available | 511 | Open in IMG/M |
| 3300012203|Ga0137399_11460421 | Not Available | 571 | Open in IMG/M |
| 3300012351|Ga0137386_10170428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300012357|Ga0137384_11564817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012361|Ga0137360_10743516 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012683|Ga0137398_10865498 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012922|Ga0137394_10881908 | Not Available | 747 | Open in IMG/M |
| 3300012925|Ga0137419_10593442 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012927|Ga0137416_10861330 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012929|Ga0137404_11305083 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012944|Ga0137410_10903050 | Not Available | 747 | Open in IMG/M |
| 3300014168|Ga0181534_10646717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300015054|Ga0137420_1494884 | Not Available | 4581 | Open in IMG/M |
| 3300015193|Ga0167668_1040977 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300015242|Ga0137412_10702915 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300015371|Ga0132258_10466784 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
| 3300015373|Ga0132257_103182183 | Not Available | 598 | Open in IMG/M |
| 3300016294|Ga0182041_11572651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 607 | Open in IMG/M |
| 3300017936|Ga0187821_10372050 | Not Available | 580 | Open in IMG/M |
| 3300017947|Ga0187785_10540407 | Not Available | 588 | Open in IMG/M |
| 3300017961|Ga0187778_10174040 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300017975|Ga0187782_10432248 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300018088|Ga0187771_10288399 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300018090|Ga0187770_11803704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 501 | Open in IMG/M |
| 3300018433|Ga0066667_12094026 | Not Available | 523 | Open in IMG/M |
| 3300019361|Ga0173482_10396560 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020581|Ga0210399_10570474 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300020583|Ga0210401_11082517 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021088|Ga0210404_10664966 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021171|Ga0210405_11107724 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021420|Ga0210394_10662689 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300021420|Ga0210394_10900363 | Not Available | 770 | Open in IMG/M |
| 3300021433|Ga0210391_10075438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2666 | Open in IMG/M |
| 3300021474|Ga0210390_11379822 | Not Available | 562 | Open in IMG/M |
| 3300021479|Ga0210410_10292286 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300022873|Ga0224550_1069694 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300024222|Ga0247691_1046460 | Not Available | 657 | Open in IMG/M |
| 3300024283|Ga0247670_1052501 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300025322|Ga0209641_10606561 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026281|Ga0209863_10254828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300026291|Ga0209890_10006475 | All Organisms → cellular organisms → Bacteria | 4926 | Open in IMG/M |
| 3300026355|Ga0257149_1052050 | Not Available | 592 | Open in IMG/M |
| 3300026496|Ga0257157_1069843 | Not Available | 601 | Open in IMG/M |
| 3300026538|Ga0209056_10023204 | All Organisms → cellular organisms → Bacteria | 6009 | Open in IMG/M |
| 3300026557|Ga0179587_10014520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4148 | Open in IMG/M |
| 3300027388|Ga0208995_1091082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300027528|Ga0208985_1114671 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027562|Ga0209735_1024624 | Not Available | 1244 | Open in IMG/M |
| 3300027565|Ga0209219_1132394 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027616|Ga0209106_1150680 | Not Available | 518 | Open in IMG/M |
| 3300027629|Ga0209422_1088272 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300027829|Ga0209773_10487895 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300027829|Ga0209773_10494140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027855|Ga0209693_10079555 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300027855|Ga0209693_10083512 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300027857|Ga0209166_10360900 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300027862|Ga0209701_10026109 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
| 3300030617|Ga0311356_10892981 | Not Available | 837 | Open in IMG/M |
| 3300030906|Ga0302314_10797839 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300031057|Ga0170834_108125322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1214 | Open in IMG/M |
| 3300031543|Ga0318516_10710038 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031668|Ga0318542_10497949 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031718|Ga0307474_10644476 | Not Available | 836 | Open in IMG/M |
| 3300031718|Ga0307474_11430320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300031720|Ga0307469_11773247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 596 | Open in IMG/M |
| 3300031744|Ga0306918_10794255 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031820|Ga0307473_10073376 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300031820|Ga0307473_10312148 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031820|Ga0307473_11403810 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031823|Ga0307478_10145521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1876 | Open in IMG/M |
| 3300031846|Ga0318512_10047040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1913 | Open in IMG/M |
| 3300031910|Ga0306923_10138905 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300031910|Ga0306923_10252406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2018 | Open in IMG/M |
| 3300031910|Ga0306923_11188109 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031912|Ga0306921_10937898 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300031912|Ga0306921_12144592 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031947|Ga0310909_11556143 | Not Available | 525 | Open in IMG/M |
| 3300031954|Ga0306926_10360942 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300031954|Ga0306926_10806177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300032180|Ga0307471_102320051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300032180|Ga0307471_102942318 | Not Available | 604 | Open in IMG/M |
| 3300032205|Ga0307472_100113741 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300032205|Ga0307472_100181037 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300032205|Ga0307472_100885342 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300032261|Ga0306920_104357299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300033289|Ga0310914_10508106 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300033561|Ga0371490_1123534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_04093210 | 2070309004 | Green-Waste Compost | FEIDFNAANASSATTTTRSTTGLLMEAMRLMDEANRDTVGTG |
| FG2_08252520 | 2189573004 | Grass Soil | ANASSRTTTTRGTTGLLMEAMRLMDEASRDAVETP |
| F14TC_1037368831 | 3300000559 | Soil | NAPSRTTTTRGTTGLLMEAMRLMDEASRDAVETP* |
| JGI25617J43924_103260981 | 3300002914 | Grasslands Soil | DFEIDFNGAKASERTTTTRSTTGLLMEAMRLMDEASRDVVKS* |
| Ga0062387_1017701471 | 3300004091 | Bog Forest Soil | EIDFNAANGSTRTTTTRNTTGLLMEAMRLLDEASHSADAVEAQ* |
| Ga0066685_103743093 | 3300005180 | Soil | EFEIDFNAANASTRTTTTKNTTGLLMEAMRLMDEASRDAVGTS* |
| Ga0066678_107463212 | 3300005181 | Soil | IDFNAANASTRTTTTRNTTGLLMEAMRLMDEASRDAVPAQ* |
| Ga0066388_1045781302 | 3300005332 | Tropical Forest Soil | EFEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDRDPVAT* |
| Ga0070669_1011331922 | 3300005353 | Switchgrass Rhizosphere | NAASASQRTTTTKTTTGLLMEAMRLMDEATRDGEAVETQ* |
| Ga0066686_104061573 | 3300005446 | Soil | EIDFNAASASSRTTTTKSTTGLLMEAMRLMDEASRDPVQAQ* |
| Ga0066701_106689961 | 3300005552 | Soil | AANGSTRTTTTRNTTGLLMEAMRLMDEANRDTVQTS* |
| Ga0066700_106233591 | 3300005559 | Soil | IDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVETP* |
| Ga0066703_104186043 | 3300005568 | Soil | EIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVETP* |
| Ga0066702_107076881 | 3300005575 | Soil | FEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVETP* |
| Ga0070763_100973153 | 3300005610 | Soil | EIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDPVETK* |
| Ga0066903_1069340872 | 3300005764 | Tropical Forest Soil | FEIDFNAANASNRTTTTRNTTGLLMEAMRLMDEANRDTVPAQ* |
| Ga0075014_1010040762 | 3300006174 | Watersheds | NASSKTTTTRNTTGLLMEAMRLMDESNRDTVPTP* |
| Ga0066658_106648381 | 3300006794 | Soil | FEIDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVETP* |
| Ga0066665_106878751 | 3300006796 | Soil | EFEIDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVETP* |
| Ga0079219_110085603 | 3300006954 | Agricultural Soil | FNAANASTRTTTTRNTTGLLMEAMRLMDESNRDAVPTQ* |
| Ga0099793_106485612 | 3300007258 | Vadose Zone Soil | ANESTRTTTTKNTTGLLMEAMRLMDESSRDAVETQ* |
| Ga0099830_110155181 | 3300009088 | Vadose Zone Soil | IDFNAANAPTRTTTTKNTTGLLMEAMRLMDEANRDAVGTK* |
| Ga0099828_104863011 | 3300009089 | Vadose Zone Soil | EIDFNAANASTRNTTTKNTTGLLMEAMRLMDEASHDAVETK* |
| Ga0099828_107941213 | 3300009089 | Vadose Zone Soil | EIDFNAANASTRNTTTKNTTGLLMEAMRLMDEASRDAVGTK* |
| Ga0116217_105871452 | 3300009700 | Peatlands Soil | EIDFNAAGASTATTTTRSTTGLLMEAMRLLDEANRDAVESK* |
| Ga0074044_103053653 | 3300010343 | Bog Forest Soil | EFEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDPVETK* |
| Ga0126370_100872171 | 3300010358 | Tropical Forest Soil | FEIDFNAANASKRTTTTKNTTGLLMEAMRLMDEANRDQDPVATQ* |
| Ga0126376_118924211 | 3300010359 | Tropical Forest Soil | SAKASNRTTTTKNTTGLLMEAMRLMDEANRDRDPVATP* |
| Ga0126376_127757461 | 3300010359 | Tropical Forest Soil | SKRTTTTKNTTGLLMEAMRLMDEANRDQDPVATQ* |
| Ga0126377_126632342 | 3300010362 | Tropical Forest Soil | FNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVQT* |
| Ga0126379_122552142 | 3300010366 | Tropical Forest Soil | FEIDFNAANAASNTTTTRTTTGLLMEAMRLMDEANRDAVPSN* |
| Ga0126383_130149811 | 3300010398 | Tropical Forest Soil | DFNAANASNRTTTTKNTTGLLMEAMRLMDEANRDRDPVAT* |
| Ga0137392_104424651 | 3300011269 | Vadose Zone Soil | EIDFNAANASSRTTTTRGTTGLLMEAMRIMDESSRDAVETP* |
| Ga0137393_101512495 | 3300011271 | Vadose Zone Soil | AANASTKTTTTRNTTGLLMEAMRLMDEANRDTVGTP* |
| Ga0137393_107940861 | 3300011271 | Vadose Zone Soil | ANASLTTTTTRNPTGLLMEARRVMDEASRDEVPSS* |
| Ga0137389_113021762 | 3300012096 | Vadose Zone Soil | EFEIDFNAANASLSTTTTRNTTGLLMEAMRLMDEASRDEVPSS* |
| Ga0137388_100203821 | 3300012189 | Vadose Zone Soil | GEFEIDFNAANASTRNTTTKNTTGLLMEAMRLMDEASRNAVEIK* |
| Ga0137363_117692991 | 3300012202 | Vadose Zone Soil | AANASSNTTTTRSTTGLLMEAMRLMDEASRDAVPSN* |
| Ga0137399_114604212 | 3300012203 | Vadose Zone Soil | FEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVQTQ* |
| Ga0137386_101704281 | 3300012351 | Vadose Zone Soil | AASGSARTTTTRGTTGLLMEAMRLMDEASRDAVETP* |
| Ga0137384_115648172 | 3300012357 | Vadose Zone Soil | GGFRIDKNTASASSRTTTTRGTTGLLMEAMRLMDESSRDAVETP* |
| Ga0137360_107435161 | 3300012361 | Vadose Zone Soil | AANESTRTTTTKNTTGLLMEAMRLMDESSRDAVETQ* |
| Ga0137398_108654981 | 3300012683 | Vadose Zone Soil | SASSRTTTTRGTTGLLMEAMRLMDESSRDAVETP* |
| Ga0137394_108819081 | 3300012922 | Vadose Zone Soil | ANASKRTTTTKNTTGLLMEAMRLMDEANRDAVGTK* |
| Ga0137419_105934423 | 3300012925 | Vadose Zone Soil | NAASASSRTTTTRGTTGLLMEAMRLMDESSRDAVETP* |
| Ga0137416_108613301 | 3300012927 | Vadose Zone Soil | IDFNAASASSRTTTTRGTTGLLMEAMRLMDESSRDAVETP* |
| Ga0137404_113050831 | 3300012929 | Vadose Zone Soil | DFNAANASTRNTTTKNTTGLLMEAMRLMDESSRDAVETP* |
| Ga0137410_109030501 | 3300012944 | Vadose Zone Soil | FEIDFNAANASKRTTTTKNTTGLLMEAMRLMDEANRDAVGTK* |
| Ga0181534_106467171 | 3300014168 | Bog | IDFNAANVSNRTTTTRNTTGLLMEAMRLMDESNRDTVGTG* |
| Ga0137420_14948841 | 3300015054 | Vadose Zone Soil | VDGGRIEIDFNAANASTKTTTTRNTTGLLMEAMRLMDEANPDTVVTP* |
| Ga0167668_10409771 | 3300015193 | Glacier Forefield Soil | FEIDFNAANASTRTTTTRNTTGLLMEAMRLMDESNRDTVETK* |
| Ga0137412_107029151 | 3300015242 | Vadose Zone Soil | FEIDFNAANGSTRTTTTRNTTGLLMEAMRLMDESSRDAVETQ* |
| Ga0132258_104667844 | 3300015371 | Arabidopsis Rhizosphere | ASASTRTTTTRGTTGLLMEAMRLMDESSRDAVETS* |
| Ga0132257_1031821831 | 3300015373 | Arabidopsis Rhizosphere | IDFNAASASTRTTTTRGTTGLLMEAMRLMDESSRDAVETS* |
| Ga0182041_115726512 | 3300016294 | Soil | EIDFNAANASSANTTTRSTTGLLMEAMRLMDESNRDTVGTN |
| Ga0187821_103720502 | 3300017936 | Freshwater Sediment | EIDFNAANESTRTTTTRNTTGLLMEAMRLMDESNRDAVETQ |
| Ga0187785_105404072 | 3300017947 | Tropical Peatland | EIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVPSN |
| Ga0187778_101740403 | 3300017961 | Tropical Peatland | FEIDFNAANASSANTTTRSTTGLLMEAMRLMDEASRDAVGTN |
| Ga0187782_104322481 | 3300017975 | Tropical Peatland | ASASNRTTTTKNTTGLLMEAMRLMDEANRDAVTTQ |
| Ga0187771_102883991 | 3300018088 | Tropical Peatland | IDFNAANASTATTTTRSTTGLLMEAMRLMDEANRDTVGTG |
| Ga0187770_118037042 | 3300018090 | Tropical Peatland | EIDFNEAGGPGRTTTTRSTTGLLMEAMRLLDEATRDAVETK |
| Ga0066667_120940262 | 3300018433 | Grasslands Soil | FNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVQTS |
| Ga0173482_103965601 | 3300019361 | Soil | IDFNAANASTRTTTTRGTTGLLMEAMRLMDEANNQAVETS |
| Ga0210399_105704743 | 3300020581 | Soil | DFNAASASTRTTTTRNTTGLLMEAMRLMDEANRDPVETK |
| Ga0210401_110825171 | 3300020583 | Soil | IDFNAANASSRTTTTKNTTGLLMEAMRLMDEANRDPVETK |
| Ga0210404_106649662 | 3300021088 | Soil | IDFNAANASTRTTTTKNTTGLLMEAMRLMDESSRDAVETQ |
| Ga0210405_111077242 | 3300021171 | Soil | DFNAANASTRTTTTRNTTGLLMEAMRLMDEASRENTTVETQ |
| Ga0210394_106626893 | 3300021420 | Soil | FNAANASTRTTTTRNTTGLLMEAMRLMDEANRDTVETK |
| Ga0210394_109003632 | 3300021420 | Soil | EFEIDFNAANASTRTTTTKNTTGLLMEAMRLMDESSRDAVETQ |
| Ga0210391_100754381 | 3300021433 | Soil | NAANASTRTTTTRNTTGLLMEAMRLMDEASRENTTVETQ |
| Ga0210390_113798221 | 3300021474 | Soil | EIDFNAANASSNTTTTRNTTGLLMEAMRLMDEASRDAVPSN |
| Ga0210410_102922864 | 3300021479 | Soil | EIDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVQTP |
| Ga0224550_10696941 | 3300022873 | Soil | AGAFEIDFNAANGSTRTTTTRNTTGLLMEAMRLLDEASHSADAVGAQ |
| Ga0247691_10464601 | 3300024222 | Soil | EIDFNAANASSNTTTTRSTTGLLMEAMRLMDEASRDAVPSN |
| Ga0247670_10525012 | 3300024283 | Soil | FNAASASTRTTTTRGTTGLLMEAMRLMDEASRDAVETP |
| Ga0209641_106065611 | 3300025322 | Soil | EIDFAGTSDRTTTTRSTTGLLMEAMRLLDEANANRVES |
| Ga0209863_102548282 | 3300026281 | Prmafrost Soil | FNAGNASTRTSTTRTTTGLLMEAMRLMDEASRDEVPATKS |
| Ga0209890_100064751 | 3300026291 | Soil | GEFEIDFNAGNASTRTSTTRTTTGLLMEAMRLMDEASRDEVTTTKS |
| Ga0257149_10520501 | 3300026355 | Soil | EFEIDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVGAP |
| Ga0257157_10698431 | 3300026496 | Soil | IDFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVGAP |
| Ga0209056_100232041 | 3300026538 | Soil | IDFNAASASSRTTTTKSTTGLLMEAMRLMDEASRDPVQAQ |
| Ga0179587_100145208 | 3300026557 | Vadose Zone Soil | NAANASTKTTTTRNTTGLLMEAMRLMDESNRDTVETP |
| Ga0208995_10910821 | 3300027388 | Forest Soil | DFGAANASNRTTTTRNTTGLLMEAMRLMDEASRDEVGTNQS |
| Ga0208985_11146711 | 3300027528 | Forest Soil | EFEIDFNAANASTRTTTTRNTTGLLMEAMRLMDESSRDAVETQ |
| Ga0209735_10246241 | 3300027562 | Forest Soil | FGAANASNRTTTTRNTTGLLMEAMRLMDEASRDEVSTNQS |
| Ga0209219_11323942 | 3300027565 | Forest Soil | ANASNRTTTTRNTTGLLMEAMRLMDEASRDEVSTNQS |
| Ga0209106_11506801 | 3300027616 | Forest Soil | ANATTRTTTTRNTTGLLMEAMRLMDEANRDAVETK |
| Ga0209422_10882721 | 3300027629 | Forest Soil | ASNRTTTTRNTTGLLMEAMRLMDEASRDEVSTNQS |
| Ga0209773_104878952 | 3300027829 | Bog Forest Soil | DFEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEASRENTAVETQ |
| Ga0209773_104941401 | 3300027829 | Bog Forest Soil | EIDFNAANGSTRTTTTRNTTGLLMEAMRLLDEASHSADAVEAQ |
| Ga0209693_100795551 | 3300027855 | Soil | FEIDFNAANASTRTTTTRNTTGLLMEAMRLMDEANRDPVETK |
| Ga0209693_100835121 | 3300027855 | Soil | GSANASTKTTTTRNTTGLLMEAMRLMDEANRDTVETK |
| Ga0209166_103609001 | 3300027857 | Surface Soil | DFNAANASTRTTTTRGTTGLLMEAMRLMDEANNQAVETQ |
| Ga0209701_100261094 | 3300027862 | Vadose Zone Soil | EIDFNAANASTRTTTTKNTTGLLMEAMRLMDEASRDAVGTS |
| Ga0311356_108929812 | 3300030617 | Palsa | FEIDFNAANGSTRTTTTRNTTGLLMEAMRLMDEASRDAVNAP |
| Ga0302314_107978393 | 3300030906 | Palsa | AFEIDFSAGNASDRTTTTRNTTGLLMEAMRLLDEASQHSADTVGAQ |
| Ga0170834_1081253223 | 3300031057 | Forest Soil | NASTRTTTTRNTTGLLMEAMRLMDEASREDSPVETQ |
| Ga0318516_107100382 | 3300031543 | Soil | IDFNSAKASNRTTTTKNTTGLLMEAMRLMDEANRDRDPVATP |
| Ga0318542_104979492 | 3300031668 | Soil | NGANASKRTTTTKNTTGLLMEAMRLMDEANRDQAPVATP |
| Ga0307474_106444763 | 3300031718 | Hardwood Forest Soil | FEIDFNAANESTRTTTTRNTTGLLMEAMRLMDEASREDSPVETQ |
| Ga0307474_114303202 | 3300031718 | Hardwood Forest Soil | EIDFNAANGSSKTTTTRNTTGLLMEAMRLMDEASHNADTVETP |
| Ga0307469_117732471 | 3300031720 | Hardwood Forest Soil | EIDFNAANASKRTTTTKNTTGLLMEAMRLMDEANRDAVETK |
| Ga0306918_107942551 | 3300031744 | Soil | EIDFNAANASSNTTTTRTTTGLLMEAMRLMDEANRDAVPSN |
| Ga0307473_100733761 | 3300031820 | Hardwood Forest Soil | NAANASDRTTTTRSTTGLLMEAMRLMDESNRDAVSTN |
| Ga0307473_103121481 | 3300031820 | Hardwood Forest Soil | ANASDRTTTTRSTTGLLMEAMRLMDESNRDAVSTN |
| Ga0307473_114038102 | 3300031820 | Hardwood Forest Soil | EIDFNAANASKRTTTTKNTTGLLMEAMRLMDEANRDQDPVATQ |
| Ga0307478_101455214 | 3300031823 | Hardwood Forest Soil | EIDFNAANASEKTTTTKNTTGLLMEAMRLMDEANRDEDPVTTQ |
| Ga0318512_100470404 | 3300031846 | Soil | EFEIDFNGANASKRTTTTKNTTGLLMEAMRLMDEANRDRDPVATP |
| Ga0306923_101389051 | 3300031910 | Soil | EIDFNAANASTATTTTRSTTGLLMEAMRLMDEANRDTVGTG |
| Ga0306923_102524064 | 3300031910 | Soil | GANASKRTTTTKNTTGLLMEAMRLMDEANRDQAPVATP |
| Ga0306923_111881093 | 3300031910 | Soil | FNAANKSSRTTTTRNTTGLLMEAMRLMDEANRDTVDAPQAAS |
| Ga0306921_109378981 | 3300031912 | Soil | NAANASTRTTTTRGTTGLLMEAMRLMDESSRDAVETPNA |
| Ga0306921_121445922 | 3300031912 | Soil | ANASNRTTTTRNTTGLLMEAMRLMDEANRDTVPAQ |
| Ga0310909_115561431 | 3300031947 | Soil | ANASSATTTTRSTTGLLMEAMRLMDEASRDTVGTG |
| Ga0306926_103609423 | 3300031954 | Soil | GDFEIDFNAANASSATTTTRSTTGLLMEAMRLMDEASRDTVGTG |
| Ga0306926_108061773 | 3300031954 | Soil | EIDFNAANASSANTTTRSTTGLLMEAMRLMDEANRDTVETN |
| Ga0307471_1023200511 | 3300032180 | Hardwood Forest Soil | EIDLNAANASSNTTTTRNTTGLLMEAMRLMDEASRDAVPSN |
| Ga0307471_1029423181 | 3300032180 | Hardwood Forest Soil | DFNAANASTKTTTTRNTTGLLMEAMRLMDEANRDTVPTP |
| Ga0307472_1001137413 | 3300032205 | Hardwood Forest Soil | AANESTRTTTTRNTTGLLMEAMRLMDESNRDAVETQ |
| Ga0307472_1001810373 | 3300032205 | Hardwood Forest Soil | EFEIDFNAANATSNTTTTRSTTGLLMEAMRLMDEASRDAVPSN |
| Ga0307472_1008853422 | 3300032205 | Hardwood Forest Soil | EFEIEFNGAIASSRTTTTRVTTGLLMEAMRMMDEASRDAVETP |
| Ga0306920_1043572991 | 3300032261 | Soil | EFEIDFNAANASNNTTTTRNTTGLLMEAMRLMDEANRDAVPSN |
| Ga0310914_105081063 | 3300033289 | Soil | IDFNAANASSNTTTTRTTTGLLMEAMRLMDEANRDAVPSN |
| Ga0371490_11235342 | 3300033561 | Peat Soil | FNAANASTATTTTRNTTGLLMEAMRLLDEANRDAVGTG |
| ⦗Top⦘ |