NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F069162

Metagenome Family F069162

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069162
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 42 residues
Representative Sequence MFIKSIWIGFIGVMLFVASASAASSVLQGIVKDAKGHPIQGADI
Number of Associated Samples 109
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.97 %
% of genes near scaffold ends (potentially truncated) 95.16 %
% of genes from short scaffolds (< 2000 bps) 91.94 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.548 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.710 % of family members)
Environment Ontology (ENVO) Unclassified
(33.065 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.161 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.28%    β-sheet: 2.78%    Coil/Unstructured: 56.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00392GntR 36.29
PF12833HTH_18 15.32
PF13620CarboxypepD_reg 5.65
PF00781DAGK_cat 1.61
PF08450SGL 1.61
PF01451LMWPc 0.81
PF13360PQQ_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 3.23
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.61
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.55 %
UnclassifiedrootN/A6.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16979566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1425Open in IMG/M
3300000891|JGI10214J12806_11746596All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium509Open in IMG/M
3300001431|F14TB_102086297All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium736Open in IMG/M
3300004157|Ga0062590_102903739All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300005093|Ga0062594_101248997All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium741Open in IMG/M
3300005186|Ga0066676_10691142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella yeongjuensis694Open in IMG/M
3300005290|Ga0065712_10631440All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium576Open in IMG/M
3300005293|Ga0065715_10777072All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005294|Ga0065705_10250913All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1195Open in IMG/M
3300005332|Ga0066388_108173692Not Available522Open in IMG/M
3300005367|Ga0070667_101231785All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005435|Ga0070714_100409902All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300005446|Ga0066686_10169104All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300005559|Ga0066700_10099007All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300005564|Ga0070664_102316110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes509Open in IMG/M
3300005713|Ga0066905_100430958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1078Open in IMG/M
3300005764|Ga0066903_101000591All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1528Open in IMG/M
3300005764|Ga0066903_103244430All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300005834|Ga0068851_10842313All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium572Open in IMG/M
3300005937|Ga0081455_10870094All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006046|Ga0066652_100123722All Organisms → cellular organisms → Bacteria2128Open in IMG/M
3300006175|Ga0070712_100320456All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300006175|Ga0070712_100745586All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium838Open in IMG/M
3300006791|Ga0066653_10139884All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300006797|Ga0066659_10534854All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300006844|Ga0075428_100983600All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300006845|Ga0075421_100932397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium988Open in IMG/M
3300006845|Ga0075421_102081795All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium602Open in IMG/M
3300006852|Ga0075433_10994349All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006871|Ga0075434_100583753All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300006871|Ga0075434_100681796All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1045Open in IMG/M
3300006881|Ga0068865_100538209All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300006904|Ga0075424_100845145All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium976Open in IMG/M
3300006904|Ga0075424_101133633All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300009098|Ga0105245_12786314All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium542Open in IMG/M
3300009101|Ga0105247_10930157All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium674Open in IMG/M
3300009156|Ga0111538_11056027All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1027Open in IMG/M
3300010043|Ga0126380_10460389All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300010043|Ga0126380_11228620All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium648Open in IMG/M
3300010301|Ga0134070_10471008Not Available506Open in IMG/M
3300010329|Ga0134111_10408416All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300010358|Ga0126370_11367050All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium667Open in IMG/M
3300010362|Ga0126377_12038658All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium650Open in IMG/M
3300010373|Ga0134128_10657090All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300010397|Ga0134124_10447298All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300012198|Ga0137364_10446502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium970Open in IMG/M
3300012198|Ga0137364_10518572All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium896Open in IMG/M
3300012200|Ga0137382_10261153All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300012202|Ga0137363_10010021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria6034Open in IMG/M
3300012208|Ga0137376_10834176All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012350|Ga0137372_10631099All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium783Open in IMG/M
3300012354|Ga0137366_10507582All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300012357|Ga0137384_11467124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium531Open in IMG/M
3300012359|Ga0137385_10853570All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium755Open in IMG/M
3300012469|Ga0150984_101974817All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300012519|Ga0157352_1044418All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium640Open in IMG/M
3300012917|Ga0137395_10835184All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium667Open in IMG/M
3300012918|Ga0137396_10195264All Organisms → cellular organisms → Bacteria1487Open in IMG/M
3300012923|Ga0137359_11201597All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012929|Ga0137404_10105906All Organisms → cellular organisms → Bacteria2277Open in IMG/M
3300012948|Ga0126375_10119337All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1604Open in IMG/M
3300012955|Ga0164298_10065370All Organisms → cellular organisms → Bacteria1807Open in IMG/M
3300012961|Ga0164302_10733644All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium736Open in IMG/M
3300012989|Ga0164305_11843325All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium547Open in IMG/M
3300013096|Ga0157307_1023042All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1040Open in IMG/M
3300013308|Ga0157375_11576221All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium776Open in IMG/M
3300014150|Ga0134081_10396983All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium516Open in IMG/M
3300014969|Ga0157376_11160956All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia799Open in IMG/M
3300015053|Ga0137405_1030550All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300015053|Ga0137405_1318325All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium753Open in IMG/M
3300015200|Ga0173480_10104159All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1383Open in IMG/M
3300015357|Ga0134072_10125426All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300015372|Ga0132256_100160030All Organisms → cellular organisms → Bacteria → Proteobacteria2269Open in IMG/M
3300015372|Ga0132256_102753174All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
3300015372|Ga0132256_103476212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300015373|Ga0132257_100018684All Organisms → cellular organisms → Bacteria7248Open in IMG/M
3300016319|Ga0182033_10368274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1206Open in IMG/M
3300016319|Ga0182033_10991118All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium747Open in IMG/M
3300016387|Ga0182040_10124765All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1793Open in IMG/M
3300017792|Ga0163161_10162253All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300017792|Ga0163161_11897631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium530Open in IMG/M
3300018051|Ga0184620_10032917All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1373Open in IMG/M
3300018051|Ga0184620_10136793All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium784Open in IMG/M
3300018071|Ga0184618_10231697All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium778Open in IMG/M
3300019879|Ga0193723_1032941All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300019881|Ga0193707_1114456All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium792Open in IMG/M
3300019882|Ga0193713_1028547All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300020001|Ga0193731_1017417All Organisms → cellular organisms → Bacteria1868Open in IMG/M
3300020006|Ga0193735_1091712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium856Open in IMG/M
3300021560|Ga0126371_10757928All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300023077|Ga0247802_1025711All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium850Open in IMG/M
3300024181|Ga0247693_1018048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia928Open in IMG/M
3300025315|Ga0207697_10106994All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300025906|Ga0207699_10771247All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300025932|Ga0207690_10149329All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300025938|Ga0207704_10142023All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300026301|Ga0209238_1235999All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300026308|Ga0209265_1035551All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300026324|Ga0209470_1168906All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300026334|Ga0209377_1182158All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium730Open in IMG/M
3300026523|Ga0209808_1263025Not Available551Open in IMG/M
3300027560|Ga0207981_1044282All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium812Open in IMG/M
3300027903|Ga0209488_10329108All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1138Open in IMG/M
3300028814|Ga0307302_10651058All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium524Open in IMG/M
3300028828|Ga0307312_10254321All Organisms → cellular organisms → Bacteria1137Open in IMG/M
3300028875|Ga0307289_10090925All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1242Open in IMG/M
3300028875|Ga0307289_10281940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium684Open in IMG/M
3300028884|Ga0307308_10611141All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031122|Ga0170822_14632827All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300031122|Ga0170822_16163830All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300031446|Ga0170820_17790589All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium759Open in IMG/M
3300031469|Ga0170819_11285618All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium630Open in IMG/M
3300031538|Ga0310888_10514199All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300031716|Ga0310813_11745199All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium584Open in IMG/M
3300031943|Ga0310885_10259328All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium884Open in IMG/M
3300032013|Ga0310906_10454611All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032180|Ga0307471_100388270All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300032261|Ga0306920_103647885All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia566Open in IMG/M
3300032421|Ga0310812_10066005All Organisms → cellular organisms → Bacteria1429Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.23%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.23%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_013239902088090014SoilMFIKLIGIAFVGVMLFVESAAAANSVLEGVVKDXXXXXXX
JGI10214J12806_1174659623300000891SoilMFMKSTWIALIGVMLSVASASAANSVLQGTVKDAKGHPIQGADIRI
F14TB_10208629713300001431SoilMFIKSIWIGFIGVMLFVASASAASSVLQGIVKDAKGHPIQGADIR
Ga0062590_10290373913300004157SoilMFIKSIWIGFTGVMLYAATASAAGPALAGMVKDAKGHPIQ
Ga0062594_10124899723300005093SoilMFIKSIWIGFVGVTLLVASASAAGPGLRGIVKDVKGHPIQ
Ga0066676_1069114213300005186SoilMLTKSFRISFIGLILLVASASGANSVLEGIVKDAKGHPIEGANIRI
Ga0065712_1063144013300005290Miscanthus RhizosphereMKNHMSNFMKSIWTAFIGAMLFVASASAASSVLQGIVKDAKGNPIES
Ga0065715_1077707213300005293Miscanthus RhizosphereMFMKSIWIVLIGVTLFVASASAASSVMQGIVKDANGHPIQGANIRIE
Ga0065705_1025091313300005294Switchgrass RhizosphereVKGILFMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAK
Ga0066388_10817369223300005332Tropical Forest SoilMFMKSIWIGFVGVMLFAVSASAANSELQGIVRDDNGRPIQGAD
Ga0070667_10123178523300005367Switchgrass RhizosphereMFIKSSWISFIGVMLFVASASAASSVLQGIVKDAKGHPIQGADI
Ga0070714_10040990223300005435Agricultural SoilMLLLKSLRISFVGLMLFVASAWAASSVLEGIVKDAKGHPIEGADIRI
Ga0070710_1042823023300005437Corn, Switchgrass And Miscanthus RhizosphereMFIKSIGIGFVGVMLFAASAAGENSVLEGVVKDGKGHPIQGVDVRIE
Ga0066686_1016910423300005446SoilMSIKSIWIGFIGVMLFVASASAASSVLQGIVRDAKGHPIQGADIRIEAT
Ga0066700_1009900733300005559SoilMFIKSTGIGFLGVMLFIASALGASSVRQGIVKDANG
Ga0070664_10231611023300005564Corn RhizosphereMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHPIEGADIRIE
Ga0066905_10043095823300005713Tropical Forest SoilMLMKSIWIGFIGVMLFVACASAASSVLQGIVKDAKGH
Ga0066903_10100059123300005764Tropical Forest SoilMFMKSIWIGFIALVLFVAGAWAASSVLQGIVKDANGHPI
Ga0066903_10324443013300005764Tropical Forest SoilMFIKSIGIGFIGAVLFAASAAAADNSVLEGVVKDAK
Ga0068851_1084231323300005834Corn RhizosphereMFIKSIWIGFIGVMLFVGGASAASSVLQGIVKDARGHPIQGADIRIE
Ga0081455_1087009423300005937Tabebuia Heterophylla RhizosphereMKSIWISFIGVMLFVASASAASSVLQGIVRDSRGRPIAGADIRIEA
Ga0066652_10012372233300006046SoilMFIKSIWIGFVGLVLFVSSALGAGSVLQGIVKDANGHPIEGADIRI
Ga0070712_10032045633300006175Corn, Switchgrass And Miscanthus RhizosphereMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHPIEGADIRIET
Ga0070712_10074558613300006175Corn, Switchgrass And Miscanthus RhizosphereMFIKSIWIGFLGVTLFVASASAASSVLQGIVKDAKGHPIQGAD
Ga0066653_1013988423300006791SoilMFIKSIWIGFVGVMLFVASASAASSLLQGIVKDAKGHPIQGADIRIEAT
Ga0066659_1053485413300006797SoilMLLLTSLRIGFIGLVLFTASAWAASSVLEGIVKDA
Ga0075428_10098360013300006844Populus RhizosphereMKSIWIGFVGVMLFVASASAASSELQGIVKDAKGHPIKGADIRIEA
Ga0075421_10093239713300006845Populus RhizosphereMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHPI
Ga0075421_10208179523300006845Populus RhizosphereMKSIWIGFVGVMLFVASASAASSELQGIVKDAKGHPI
Ga0075433_1099434913300006852Populus RhizosphereMFIKSIGIGFVGAMLFVASGAAENSVLEGVVKDAKGH
Ga0075434_10058375323300006871Populus RhizosphereMCIKVIAIGFVGVMLFAASAAAAENSLLEGIVKDAKGHPIQGADVQIEAK
Ga0075434_10068179613300006871Populus RhizosphereMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDA
Ga0068865_10053820933300006881Miscanthus RhizosphereMFIKSIGIGLVGVVLFVASAAAANSVLEGVVKDARG
Ga0075424_10084514513300006904Populus RhizosphereMFIKSIWIGFIGVMLFVASASAASSELQGIVKDAKGHPIKGADIR
Ga0075424_10113363323300006904Populus RhizosphereMKSNWVGLVGVMLFITSASAASSLLEGIVKDANGHPIGGADIR
Ga0105245_1278631413300009098Miscanthus RhizosphereMFIKSIWIGFVGVMLFIASASAATSLLQGIVKDAKGHP
Ga0105247_1093015723300009101Switchgrass RhizosphereMFIKSIWIGFIGVMLFVASTSAVRPLLQGIVKDAKGHPIQGADI
Ga0111538_1105602723300009156Populus RhizosphereMFMKSIWIGFVGVMLFVASASAASSELQGIVKDAKGHPIKGADIRIEA
Ga0126380_1046038913300010043Tropical Forest SoilMFIKSIGITFVGVMLFVASVAAANSVLEGIVKDAK
Ga0126380_1122862023300010043Tropical Forest SoilMFIKVIGIGFVGVMLFIASAAADNPVLGGVVKDAKGHP
Ga0134070_1047100813300010301Grasslands SoilMIIKSLRIGCIGLILSVASAWAAGSVLQGIVKNAKGH
Ga0134111_1040841613300010329Grasslands SoilMFIKSFWIGFVGAMLFVAGASAANSVLQGIVRDANGHPIQG
Ga0126370_1136705023300010358Tropical Forest SoilMLLLKSLRIGFVALMLFVASAWAASSVLEGIVKDAKGHPIEGA
Ga0126372_1195307823300010360Tropical Forest SoilMFIKSIGIGFVGVVLFVASAAAENSVLEGVVKDSKGHPI
Ga0126377_1203865823300010362Tropical Forest SoilMKNNISNFIESIWMGFIGVLLFVASASAANSELQGIVRDANGRPIQGA
Ga0134128_1065709013300010373Terrestrial SoilMFIKSIWIAFVGVMLFVVSASAANSVLQGIVKDAKGHPIQGADIRIEE
Ga0134124_1044729823300010397Terrestrial SoilMFMKSIWIGFIGVMLFVASASATSSVLQGIVKDAKGHPIQGAD
Ga0137364_1044650223300012198Vadose Zone SoilMFIKSIWVGFIGVMLFVASASAANSVLQGIVKDAKGHPIQGADIR
Ga0137364_1051857223300012198Vadose Zone SoilMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAK
Ga0137382_1026115323300012200Vadose Zone SoilMFIKSIWIGFIGVMLFVASASAASSLLQGIVKDAKGHPIQGADIRIE
Ga0137363_1001002113300012202Vadose Zone SoilMKSIWIGFIGVMLFVASASAASSVLQGIVKDAKGH
Ga0137376_1083417623300012208Vadose Zone SoilMFMKSIWIGFVGVMLFVASASAASSVLQGIVKDAKGHPIQG
Ga0137372_1063109923300012350Vadose Zone SoilMFIKSIWIGFMGVMLFVASASAASSVLQGIVKDAKGHPIQGAD
Ga0137366_1050758223300012354Vadose Zone SoilMFIKSFWIGFVGAMLFVAGASAANSVLQGIVRDANGHPIQGADIRIE
Ga0137384_1146712413300012357Vadose Zone SoilMLLLKSLRIGFVGLMLVVASAWAASSVLEGIVKDAKG
Ga0137385_1085357023300012359Vadose Zone SoilMFIKSIWIGFTGIMLFVASASAASSVLQGIVKDAKGHPV
Ga0150984_10197481713300012469Avena Fatua RhizosphereMFIKSIWIAFIGVVLFVASASAASSVLQGIVKDVKGHPVQGADIR
Ga0157352_104441823300012519Unplanted SoilMFMKTIWIGFIGVMLFVASASAASSVLQGIVKDPNGHPIQGADIRIE
Ga0137395_1083518413300012917Vadose Zone SoilMLLLKSLRIGFIGLMLFVASAWAAGSVLQGIVKDAKGHTVEGADI
Ga0137396_1019526433300012918Vadose Zone SoilMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHP
Ga0137394_1030370423300012922Vadose Zone SoilMFIKSIGIAFVGVMLLVASAAAANSVLEGVVKNAKGHP
Ga0137359_1120159713300012923Vadose Zone SoilMFIKSIGIGFIGVMLFAASAAAANSVLEGVVRDAKGYPVQGVDVRIE
Ga0137404_1010590633300012929Vadose Zone SoilMFIKSIWIGFTGVMLFVASASAASSVLQGIVKDANGHS
Ga0126375_1011933733300012948Tropical Forest SoilMKSIWIGFIGVMLFVACASAASSLLQGIVKDAKGHSI
Ga0164298_1006537023300012955SoilMFIKSIGISFVGVMLFVASAAAANSVLEGVVRDAKGHPIQGVDVR
Ga0164302_1073364423300012961SoilMFIKSIWIGFIGVTLFVASSSAASSVLQGIVKDARGHPIQGADIRIE
Ga0164305_1184332513300012989SoilMFIKSIWIGFIGVTLFVASASAASSVLQGIVKDAKGHPI
Ga0157307_102304213300013096SoilMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHPIEGADIRI
Ga0157375_1157622123300013308Miscanthus RhizosphereMFIKSIWIGFVGVTLLVASASAAGPGLRGIVKDVKGHP
Ga0134081_1039698313300014150Grasslands SoilMFIKPIWISFIGVMLFVASAWATSSVLQGIVKDAKGHPIQ
Ga0157376_1116095613300014969Miscanthus RhizosphereMMFMKTIWIALIGTMLVVASVSAANSALQGIVKDANGRPV
Ga0137405_103055013300015053Vadose Zone SoilMFIKSIWVGFIGVMLFVASASAANSVLQGIVKDAKGHPI
Ga0137405_131832523300015053Vadose Zone SoilMFIKSIWIGFTGVMLFVASASAASSELQGIVKDAKGHPIQGA
Ga0173480_1010415913300015200SoilMFIKSSWISFIGVMLFVASASAASSVLQGIVKDARGHPIQ
Ga0134072_1012542623300015357Grasslands SoilMIIKSLRIGCIGLILSVASAWAAGSVLQGIVKNAKGHPIEG
Ga0132256_10016003013300015372Arabidopsis RhizosphereMFMKSISIGLIWVMLFVASASAASSVLQGIVRDARGRPIQGADIRI
Ga0132256_10275317413300015372Arabidopsis RhizosphereMFIKSIWIGFIGATLFVASASAAGPGLHGIVKDVRGNPIQGADI
Ga0132256_10347621213300015372Arabidopsis RhizosphereMFIKSVWIGFIGIMLFVASASAASSVLQGIVKDAKGHP
Ga0132257_10001868413300015373Arabidopsis RhizosphereMFIKSIAIAFAGVMLFVTGASAANSVLEGIVKDAKGRPIQGADVRI
Ga0132255_10581842213300015374Arabidopsis RhizosphereMFIKSIGIGLVRVVLFVASAAAANSVLEGVVKDARGHPIQG
Ga0182033_1036827423300016319SoilMFMKSSWIGFIGVMLFVASASAASSELQRIVRDAKQHPIK
Ga0182033_1099111823300016319SoilMLLLKSLRIGFVGLMLVVATAWAAGSVLQGIVKDAKGHPIEG
Ga0182040_1012476533300016387SoilMFMKSIWIGCIGVMLFVASASAASSVLQGLVKDAKG
Ga0163161_1016225343300017792Switchgrass RhizosphereMFMKSIWIGFIGVMLFVASASATSSVLQGIVKDAKGHPIQGADIRI
Ga0163161_1189763123300017792Switchgrass RhizosphereMFIKSSWISFIGVTLFVASASAAGPALQGIVKDAKGHPIQGADIRIE
Ga0184620_1003291713300018051Groundwater SedimentMFIKSIWIGFIRVMLFVASASAARPLLQGIVKDAKGHPIQGV
Ga0184620_1013679323300018051Groundwater SedimentMFIKLIGIGFIGVMLLVASASAANSVLEGVVKDARGHPVQG
Ga0184618_1023169723300018071Groundwater SedimentMFIKSIWLGFIGVMLFVLSAWAASSVLQGIVKDAKGHPIQGADIRIEAT
Ga0193723_103294123300019879SoilMFIKSIWIGSIGVMLFVASASAASSVLQGIVKDAKGHPIQGA
Ga0193707_111445613300019881SoilMFIKSLQMGFIGLVLCVATAWAATSVLQGIVKDPKGHPIKG
Ga0193713_102854713300019882SoilMFIKSIWIGFIGVMLFVASASAASSVLQGIVKDAKG
Ga0193731_101741723300020001SoilMFIKSTGIGFLGVMLFIASALGASSVLQGIVKDANGHPLEGADIRIEPK
Ga0193735_109171213300020006SoilMFIKSIWIGFIGVMLFVASASAASSVLQGIVKDAKGHPIQGADI
Ga0126371_1075792823300021560Tropical Forest SoilMFIKSIWIGFLGIMLLIASASGAGSVLQGIVKDANGHP
Ga0247802_102571113300023077SoilMFIKSSWISFIGVMLFVASASAASSVLQGIVKDAKGHP
Ga0247693_101804823300024181SoilMLLLKSLRIGFVGLMLFVASAWAASSVLEGIVKDAKGHPIEGADIRIDTK
Ga0207697_1010699413300025315Corn, Switchgrass And Miscanthus RhizosphereMFIKSIGIGFVGVMLFVASAAAENSVLKGVVKDAKGHPIQGV
Ga0207692_1097385313300025898Corn, Switchgrass And Miscanthus RhizosphereMFIKSIGIGFVGVMLFAASAAGENSVLEGVVKDGKGHPIQGVDVRIEAKNGG
Ga0207699_1077124713300025906Corn, Switchgrass And Miscanthus RhizosphereMFMKSIWIGFIGVTLFVASASAASSVLQGIVKDAKGHPIQGAD
Ga0207690_1014932913300025932Corn RhizosphereMFIKSIWIGFIGVMLFVASASAVSSVLQGIVKDPKGHPIQGADIRIEAT
Ga0207704_1014202313300025938Miscanthus RhizosphereMKSLWIGFIGVMLFVASASAASSVLQGIVKDDKGHPIQGADIRIE
Ga0209238_123599923300026301Grasslands SoilMFIKSIWIGFTGIMLFVASASAASSVLQGIVKDAKGHPVEGA
Ga0209265_103555113300026308SoilMIIKSLRIGCIGLILSVASAWAAGSVLQGIVKNAKGHPIE
Ga0209470_116890613300026324SoilMLIKSIWIGFIGVMLFVASASAASSLLQGIVEDAKG
Ga0209377_118215823300026334SoilMLLLKSLRIGFIGLVLFTAGAWAAGSVLQGIVKDAKGHP
Ga0209808_126302513300026523SoilMIIKSLRIGCIGLILSVASAWAAGSVLQGIVKNAKGHPIEGAD
Ga0207981_104428223300027560SoilMFIKSIWIGFIGVTLFVASASAASSVLQGIVKDARGHPIQGADI
Ga0209488_1032910813300027903Vadose Zone SoilMFIKSIWIGFIGVMLFVASASAASSLLQGIVRDAKGHPIQGADIR
Ga0307302_1065105813300028814SoilMFIKSIWIGFIGVMLFVASASAANSVLQGTVKDAKGHPIQGADIRIE
Ga0307312_1025432123300028828SoilMLLLKSLRIGFVGLMLVAASAWAAGSVLQGIVKDAKGHPIE
Ga0307289_1009092523300028875SoilMFIKSIWLGFTGVMLFVASASAAGPALQGIVKDARGHPIQGADIR
Ga0307289_1028194023300028875SoilMFIKSIGIGFVGVMLFVASAAAANSVLEGVVKDAKGHP
Ga0307308_1061114123300028884SoilMFMKSIWIAFIGVIVFVASASAASSVLQGIVKDAKGHPIQ
Ga0170822_1463282713300031122Forest SoilMLMKSIWIGFIGVTLLVASATAAGPLLQGIVKDAKGR
Ga0170822_1616383023300031122Forest SoilMFIKSIGIGLVGVMLFAASAAAANSVLEGVVKDGKGHPIQGVDVR
Ga0170820_1779058913300031446Forest SoilMSNFVKSIWVRFIGVMLFVASASAANSVLQGIVKDAKGHPI
Ga0170819_1128561823300031469Forest SoilMFIKSIWIGFIGVTLFVASASAASSVLQGIVKDAKGHPIQGADI
Ga0310888_1051419913300031538SoilMFMKSIWIGFIGVMLFVASASAASSVLQGIVKDPNGHPIQGADIRI
Ga0310813_1174519913300031716SoilMFIKSIWIGFIGVMLFVASASAASSVLQGIVKDANGHSIQGADIRIE
Ga0310885_1025932823300031943SoilMFIKSTWIAFIGVMLSVASASAANSVLQGIVKDAKGHPIQG
Ga0310906_1045461123300032013SoilMFMKSIWIGVIGVMLFVASASAASSVLQGIVKDVNGHPIKGADI
Ga0307471_10038827033300032180Hardwood Forest SoilMFIKSIWIGFIGVTLFVASASAASSVLQGIVKDAKGHSI
Ga0306920_10364788523300032261SoilMFIKSIGIGFVGVMLLVASAAAADSALEGIVKDTTGHPVQGADVRVEAKN
Ga0310812_1006600513300032421SoilMKSIWIGFIGVMLFVASASAASSELQGIVKDAKGHPIKGA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.