NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069136

Metagenome / Metatranscriptome Family F069136

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069136
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 39 residues
Representative Sequence SVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA
Number of Associated Samples 102
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.03 %
% of genes near scaffold ends (potentially truncated) 91.94 %
% of genes from short scaffolds (< 2000 bps) 95.97 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.742 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.613 % of family members)
Environment Ontology (ENVO) Unclassified
(33.871 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.839 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.54%    β-sheet: 0.00%    Coil/Unstructured: 58.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00528BPD_transp_1 16.94
PF13416SBP_bac_8 10.48
PF01547SBP_bac_1 2.42
PF01738DLH 1.61
PF16317Glyco_hydro_99 0.81
PF10518TAT_signal 0.81
PF00216Bac_DNA_binding 0.81
PF01545Cation_efflux 0.81
PF01728FtsJ 0.81
PF12697Abhydrolase_6 0.81
PF02738MoCoBD_1 0.81
PF12760Zn_Tnp_IS1595 0.81
PF04279IspA 0.81
PF01381HTH_3 0.81
PF01135PCMT 0.81
PF13714PEP_mutase 0.81
PF01609DDE_Tnp_1 0.81
PF01636APH 0.81
PF13610DDE_Tnp_IS240 0.81
PF00078RVT_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2917Intracellular septation protein ACell cycle control, cell division, chromosome partitioning [D] 0.81
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.81
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.81
COG5421TransposaseMobilome: prophages, transposons [X] 0.81
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.81
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.81
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.81
COG3293TransposaseMobilome: prophages, transposons [X] 0.81
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.81
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.81
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.81
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.81
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.81
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.81
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.81
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.81
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.74 %
UnclassifiedrootN/A7.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_101117301All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300004633|Ga0066395_10324039All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005332|Ga0066388_102716292All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005555|Ga0066692_10158515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1394Open in IMG/M
3300005559|Ga0066700_10166482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1504Open in IMG/M
3300005561|Ga0066699_10886442All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005575|Ga0066702_10657878All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005764|Ga0066903_102827878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria941Open in IMG/M
3300005921|Ga0070766_11033548All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006028|Ga0070717_10659973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium949Open in IMG/M
3300006175|Ga0070712_101126194All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006846|Ga0075430_101592660All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300009038|Ga0099829_11494585All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009090|Ga0099827_10110188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium2202Open in IMG/M
3300009143|Ga0099792_10378246All Organisms → cellular organisms → Bacteria → Proteobacteria861Open in IMG/M
3300009143|Ga0099792_10601597All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300010046|Ga0126384_11839142All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010047|Ga0126382_11003846All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010048|Ga0126373_11510415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium737Open in IMG/M
3300010125|Ga0127443_1098444All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300010140|Ga0127456_1022078All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300010358|Ga0126370_10485149All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300010358|Ga0126370_11602396All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010359|Ga0126376_12957519All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010361|Ga0126378_10400247All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300010361|Ga0126378_12604883All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300010366|Ga0126379_10907676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria983Open in IMG/M
3300010376|Ga0126381_102088523All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300010376|Ga0126381_102249617Not Available784Open in IMG/M
3300010376|Ga0126381_103639610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300010376|Ga0126381_104406832Not Available544Open in IMG/M
3300010376|Ga0126381_104512829All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300010376|Ga0126381_105140961All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300010398|Ga0126383_10079519All Organisms → cellular organisms → Bacteria2857Open in IMG/M
3300012096|Ga0137389_11460239All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012189|Ga0137388_11815811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300012199|Ga0137383_10330701All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300012212|Ga0150985_121017200All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300012361|Ga0137360_10483854All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300012362|Ga0137361_10750598All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300012362|Ga0137361_11090469All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300012400|Ga0134048_1303510All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300012410|Ga0134060_1474757All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300012582|Ga0137358_10891597All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300012582|Ga0137358_11045342Not Available525Open in IMG/M
3300012961|Ga0164302_11634161All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012971|Ga0126369_10213249All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300012971|Ga0126369_10664453All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300012971|Ga0126369_11649700All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300012971|Ga0126369_12142193All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012989|Ga0164305_11022019Not Available704Open in IMG/M
3300015374|Ga0132255_102580346All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300016270|Ga0182036_10988885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium693Open in IMG/M
3300016270|Ga0182036_11783625All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300016294|Ga0182041_11519154All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300016319|Ga0182033_10606985All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300016341|Ga0182035_11624037All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300016371|Ga0182034_10159851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1703Open in IMG/M
3300016371|Ga0182034_10993079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300016371|Ga0182034_11380668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300016422|Ga0182039_10831555All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300016445|Ga0182038_10067487All Organisms → cellular organisms → Bacteria2468Open in IMG/M
3300017942|Ga0187808_10123977All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300017974|Ga0187777_11477341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300021406|Ga0210386_10467257All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300021444|Ga0213878_10182859All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300021479|Ga0210410_11783045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300021560|Ga0126371_11036442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria961Open in IMG/M
3300022511|Ga0242651_1053872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300022531|Ga0242660_1040007All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300022532|Ga0242655_10127552All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300022533|Ga0242662_10038511All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300025906|Ga0207699_11273736Not Available544Open in IMG/M
3300026317|Ga0209154_1044685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1990Open in IMG/M
3300026507|Ga0257165_1102445All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300026547|Ga0209156_10021710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila3828Open in IMG/M
3300027047|Ga0208730_1034454All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300027655|Ga0209388_1111381All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300027817|Ga0209112_10072670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1079Open in IMG/M
3300027911|Ga0209698_10969926All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300029636|Ga0222749_10288104All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300029701|Ga0222748_1088342All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031057|Ga0170834_107946555All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300031094|Ga0308199_1126158All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031421|Ga0308194_10063988All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300031545|Ga0318541_10712571All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031546|Ga0318538_10681320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300031572|Ga0318515_10567140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300031680|Ga0318574_10056478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2080Open in IMG/M
3300031713|Ga0318496_10296104All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031719|Ga0306917_11170313Not Available597Open in IMG/M
3300031720|Ga0307469_10804366All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300031736|Ga0318501_10344561All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031736|Ga0318501_10435445All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300031753|Ga0307477_10853576All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300031771|Ga0318546_11003404All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300031781|Ga0318547_10674475All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031793|Ga0318548_10532691All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031798|Ga0318523_10464173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300031846|Ga0318512_10394313All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300031890|Ga0306925_11875373All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031941|Ga0310912_11015207All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031942|Ga0310916_10209067All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300031942|Ga0310916_11589511All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031945|Ga0310913_10479282All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031947|Ga0310909_10740104All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300031947|Ga0310909_10950901All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300031947|Ga0310909_11430152All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031954|Ga0306926_10421302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1646Open in IMG/M
3300031954|Ga0306926_12052878All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031962|Ga0307479_11404507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6657Open in IMG/M
3300031981|Ga0318531_10275699All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300032001|Ga0306922_10802898All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300032054|Ga0318570_10178174All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300032067|Ga0318524_10436177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium685Open in IMG/M
3300032068|Ga0318553_10439272Not Available683Open in IMG/M
3300032076|Ga0306924_11974514Not Available602Open in IMG/M
3300032174|Ga0307470_11111139All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300032180|Ga0307471_100843566All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300032205|Ga0307472_100447199All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300032261|Ga0306920_102635680All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300032261|Ga0306920_102700825All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300033134|Ga0335073_11249287Not Available740Open in IMG/M
3300033289|Ga0310914_11642231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil16.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010125Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010140Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10111730113300004091Bog Forest SoilAEHVFSIAMLDVMNNGMAPEQAVDKAFKRAEAIFVKYPITQA*
Ga0066395_1032403913300004633Tropical Forest SoilIFSVAEFDVINSGMAPEQAIDKAFERAEAIFAKYPITQS*
Ga0066388_10271629223300005332Tropical Forest SoilVFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA*
Ga0066692_1015851533300005555SoilAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA*
Ga0066700_1016648213300005559SoilEFDVMNDGMTPEKAIDKALKRAEEIFAKYPIQNA*
Ga0066699_1088644213300005561SoilMFDVMNNGMAPEQAIDKAFKRAEAIFAKYPVEQA*
Ga0066702_1065787823300005575SoilFSVAMFDAMNNGMSPEQAIDKAFKRAEEIFAKYPIQQA*
Ga0066903_10282787823300005764Tropical Forest SoilVFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFVKYPITQA*
Ga0070766_1103354823300005921SoilMSAAFSVMNSGAAPEQEIDKAFSRIEEIFAKYPIASS*
Ga0070717_1065997323300006028Corn, Switchgrass And Miscanthus RhizosphereEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA*
Ga0070712_10112619413300006175Corn, Switchgrass And Miscanthus RhizosphereEFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQA*
Ga0075430_10159266013300006846Populus RhizosphereNPAISEVDNEHVWSVAMFDVINNGMPPAQAIDKAFKRVEALFAKYQIAQG*
Ga0099829_1149458523300009038Vadose Zone SoilVAEFDVMNDGMAPEKAIDKALKRAEEIFAKYPHQQA*
Ga0099827_1011018813300009090Vadose Zone SoilNPAISEVDNEHVWSVAMFDVINNGMTPAQAIDKAFKRVEALFAKYQIAQG*
Ga0099792_1037824623300009143Vadose Zone SoilDSEHVFSIAMLDVMNNGMILEQAVGKAFKRAEEIFAKYPITEA*
Ga0099792_1060159713300009143Vadose Zone SoilNGEHLFSVAMFDVMNDGMAPEKAVDKVFKRAEEIFLKYPIVAS*
Ga0126384_1183914223300010046Tropical Forest SoilAIAEVDAEHVWSVAMFDVINNGMTPAQAIDKAFKRVEALFAKYQIAQG*
Ga0126382_1100384623300010047Tropical Forest SoilIDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIV*
Ga0126373_1151041513300010048Tropical Forest SoilMSDVINNGMTPEATIDKAFKRGEAIFAKYPIEQA*
Ga0127443_109844413300010125Grasslands SoilEHVWSVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQIAQG*
Ga0127456_102207823300010140Grasslands SoilDAEHVWSVAMFDVINNGMTPAQAIDKAFKRVETLFAKYQIAQG*
Ga0126370_1048514913300010358Tropical Forest SoilEFDVLKNEMAPEAAIDKAFKRADEIFARYPIAQS*
Ga0126370_1160239623300010358Tropical Forest SoilVFDFLNNGMAPEPAIDKAFKRAEEIFAKYPIQQA*
Ga0126376_1295751923300010359Tropical Forest SoilAMFDVMKEGMAPEQAIDKAFKRAEEIFAKYPIQQA*
Ga0126378_1040024713300010361Tropical Forest SoilEVNTEHVFSIAMLDVMNNGMAPEQAIDKAFKRAEEIFVKYPITQA*
Ga0126378_1260488313300010361Tropical Forest SoilVNAEHVFMVAEFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQA*
Ga0126379_1090767633300010366Tropical Forest SoilWSVAMFDVLNNGLQPAQAIEKAFKRVEALFAKYQIAQG*
Ga0126381_10208852323300010376Tropical Forest SoilSVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQVA*
Ga0126381_10224961723300010376Tropical Forest SoilSVAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIA*
Ga0126381_10363961023300010376Tropical Forest SoilAEFDVLKNGMAPEAAIDKAFGRADEIFTKYPITQA*
Ga0126381_10440683213300010376Tropical Forest SoilLAINDAMNNGMTPQAAIDKAFRRCEAIFAKYPIVQA*
Ga0126381_10451282923300010376Tropical Forest SoilAMFDVMKEGMAPEQAVDKAFKRAEEIFAKYPIVAS*
Ga0126381_10514096113300010376Tropical Forest SoilVAMLDVMNSGMTPEQAIERAFKRAEAIFAKYPIQEA*
Ga0126383_1007951953300010398Tropical Forest SoilWSVAMFDVINNGMTPAQAIDKAFKRVETLFAKYPVAQG*
Ga0137389_1146023923300012096Vadose Zone SoilAMFDVMNNGMAPEQAIDKAFTRAEAIFAKYPIISS*
Ga0137388_1181581123300012189Vadose Zone SoilFSVAMFDVMKEKMKPEAAIDKAFKRCEEIFAKYPIQNA*
Ga0137383_1033070113300012199Vadose Zone SoilDNEHVWSVAMFDVINNGMAPAQAIDKAFKRVEALFAKYQIAQG*
Ga0150985_12101720013300012212Avena Fatua RhizosphereMFDVMNNGMASEQAVDKAFKRAEEIFAKYPIQQA*
Ga0137360_1048385423300012361Vadose Zone SoilAEHVWSVAMFDVINNGMAPAAAIDKAFKRAETIFAKYQVV*
Ga0137361_1075059833300012362Vadose Zone SoilVAEFDVINNGMAPQTAIDKAFKRVEEIFAKYPIAQG*
Ga0137361_1109046923300012362Vadose Zone SoilEIDAEHVWSVAMFDVINNGMAPAAAIDKAFKRAETIFAKYQVV*
Ga0134048_130351013300012400Grasslands SoilEHVWSVAMFDVINNGMKPAQAIDKAFKRVEALFAKYQIAQG*
Ga0134060_147475713300012410Grasslands SoilISEVDAEHVWSVAMFDVMNNGMKPAQAIDKAFKRVEALFAKYQIAQG*
Ga0137358_1089159723300012582Vadose Zone SoilMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA*
Ga0137358_1104534213300012582Vadose Zone SoilVAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA*
Ga0164302_1163416113300012961SoilAIFDYLNNGIAPEPAIDKAFKRAEEIFAKYPIQQA*
Ga0126369_1021324913300012971Tropical Forest SoilVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA*
Ga0126369_1066445313300012971Tropical Forest SoilEVDAAHVWSVAMFDVINNGMSPAQAIDKAFKRVETLFAKYQVA*
Ga0126369_1164970023300012971Tropical Forest SoilAIAEVNGEHLFSVAMFDAMNNGMTPAQAIDKAFKRAEEIFGKYPIQQA*
Ga0126369_1214219323300012971Tropical Forest SoilVFMVAEFDVMKEGMAPEKAIDKAFRRVEEIFAKYPISQA*
Ga0164305_1102201913300012989SoilSVAEFDVINSGVAPEQAIDKAFKRAEAIFAKYPIEQA*
Ga0132255_10258034623300015374Arabidopsis RhizosphereAWFAITRDGLKAEAAVDKAFKRCEEIFAKYPMQQS*
Ga0182036_1098888523300016270SoilAAFDVMNNGMAPEQAIDKAFKRAEEIFAKYPITQA
Ga0182036_1178362513300016270SoilNADHAFSIAEYDVMKEGMSPEQAIDKAFKRAEAIFPKYPIEQA
Ga0182041_1151915413300016294SoilEVDAEHVFSVAEFDVLKNGMAPEAAIDKAFKRADEMFAKYQIVQG
Ga0182033_1060698523300016319SoilSVAEFDVLKNGMAPEAAIDKAFKRAEEIFAKYQIT
Ga0182035_1162403723300016341SoilFSVAMFDVMNNGMASEQAVDKAFKRAEEIFAKYPIQQA
Ga0182034_1015985113300016371SoilAMIDVINKRVTPQAAVDKAFKRAEEIFAQYPIEEG
Ga0182034_1099307913300016371SoilAMFDAMNNGMTPEQAIDKAFKRAEEIFAKYPIVAS
Ga0182034_1138066813300016371SoilIAINNVINNGMTPEAAIDKAFRRCEEIFAKYPIEQA
Ga0182039_1083155513300016422SoilIAMLDVMNNGMAPEAAIDKAFKRADEIFAKYPITQA
Ga0182038_1006748743300016445SoilAMLDVMNNGMTPEQAIDKAFKRAEEIFAKYPIVAS
Ga0187808_1012397723300017942Freshwater SedimentFPLAILDVINNGVAPEAAVDKAFKRTEEIFAKYPIAQS
Ga0187777_1147734123300017974Tropical PeatlandHVIMNAAFAVMNSGAAAEPEIDKAFKRIEEIFAKYPIVSS
Ga0210386_1046725713300021406SoilSVAEFDVMNNGMAPEQAVDKAFKRAETIFAKYPIQQA
Ga0213878_1018285933300021444Bulk SoilAEFDVMKNGMAPEAAIDQAFKRAEEIFAKFPITQA
Ga0210410_1178304523300021479SoilLFSVAMFDVMNNGMASEQAIGKAFKRAEEIFAKYPIQQA
Ga0126371_1103644233300021560Tropical Forest SoilVFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFVKYPITQA
Ga0242651_105387213300022511SoilSVAMFDVMNNGMASEQAVDKAFKRGEEIFAKYPIQQA
Ga0242660_104000713300022531SoilAEHVIMTAAFAVMNSGAVPEQQIDKAFSRIEEIFAKYPIASS
Ga0242655_1012755223300022532SoilSVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQT
Ga0242662_1003851113300022533SoilMNAAFAVMNSGAAAEPEIDKAFRRIEEIFAKYPIVSS
Ga0207699_1127373623300025906Corn, Switchgrass And Miscanthus RhizosphereSVAEFDVINSGMAPEQAIDKAFKRAEAIFAKYPIEQA
Ga0209154_104468513300026317SoilEHVFMTAIFDFLNNGVAAEPAIDKAFKRAEEIFAKYPIQQA
Ga0257165_110244523300026507SoilAMFDVMNNGMAPEQAIDKAFKRAEAIFAKYPIISS
Ga0209156_1002171043300026547SoilLRDQHDSIGYMTAIFDYLNNGIAPEPAIDKAFKRAEEIFAKYPIQQA
Ga0208730_103445423300027047Forest SoilVDAEHVFSVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS
Ga0209388_111138113300027655Vadose Zone SoilEIDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIT
Ga0209112_1007267033300027817Forest SoilLAILDVINNGVAPEAAVDKAFKRTEEIFAKYPIAQS
Ga0209698_1096992613300027911WatershedsVGQENVFMSAVVEVMKNGAKVAEAADKALKRAETIFAKYPIQQA
Ga0222749_1028810413300029636SoilSVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS
Ga0222748_108834213300029701SoilVAMFDVMNNGMASEQAVDKAFKRGEEIFAKYPIQQA
Ga0170834_10794655523300031057Forest SoilAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPISQS
Ga0308199_112615813300031094SoilIDAEHVWSVAMFDVINNGMAPAQAIDKAFKRAETIFAKYQIT
Ga0308194_1006398813300031421SoilMPSMCGVAMFDVINNGMAPAQAIDKAFKRAEAIFAKYPIQQA
Ga0318541_1071257123300031545SoilVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA
Ga0318538_1068132013300031546SoilHVFSVAEFDVLKNGMAPEAAIDKAFKRADEIFTKYPITQA
Ga0318515_1056714023300031572SoilVNAEHFFSIAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG
Ga0318574_1005647813300031680SoilLFSVAMFDVMKEGMKPEQAVDKAFKRAEEIFAKYPIQQA
Ga0318496_1029610423300031713SoilVFSVAMFDVMKEGMAPEAAVDKAFKRAEEIFAKYQIVQG
Ga0306917_1117031323300031719SoilFSIAEFDVMNNGMAPEQAIDHAFKRAEAIFAKYQIVQG
Ga0307469_1080436613300031720Hardwood Forest SoilFSVAMFDAMNNGMTAEQAIDKAFKRAEEIFAKYPIISS
Ga0318501_1034456123300031736SoilFSVAMFDVMKEGMAPEAAVDKAFKRAEEIFAKYQIVQG
Ga0318501_1043544513300031736SoilLFSVAMFDAMNNGMTSEQAIDKAFKRAEEIFTKYPIQQA
Ga0307477_1085357633300031753Hardwood Forest SoilVAMFDVMNNGMAPEQAIDKAFTRAEEIFAKYPIQQA
Ga0318546_1100340413300031771SoilAFSVAMFDVMNNGMTAEQAIDKAFKRADEIFAKYPIQQA
Ga0318547_1067447513300031781SoilFSVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA
Ga0318548_1053269113300031793SoilVFSVAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS
Ga0318523_1046417313300031798SoilSSIAEFDVMNNGMAPEQAIDKAFKRAEAIFAKYQIVQG
Ga0318512_1039431313300031846SoilVAMFDVMNNGMAPEQAVDKAFKRAEEIFAKYPIVSS
Ga0306925_1187537313300031890SoilAEHVWSVAMFDVINNGMTPAQAIDKAFKRVETLLAKYQITQG
Ga0310912_1101520713300031941SoilVGAEHVFMVAVFDVLNNGMAPVAAIDKAFKRAEEIFAKYPIQQV
Ga0310916_1020906713300031942SoilDHAFSIAEYDVMKEGMSPEQAIDKAFKRAEAIFPKYPIEQA
Ga0310916_1158951123300031942SoilAEFDVLKNGMTPEAAIDKAFKRAEEIFTKYQIVQG
Ga0310913_1047928213300031945SoilVAMFYVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA
Ga0310909_1074010413300031947SoilIAEYDVMKEGMTPEAAIDKAFKRADEIFAKYPITQA
Ga0310909_1095090123300031947SoilSVAEFDVLKNGMAPEAAIDKAFKRAEEIFSKYPIQQA
Ga0310909_1143015213300031947SoilFSVAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS
Ga0306926_1042130223300031954SoilSVAMFDVMNNGMAPEQAIDKAFKRAEEIFAKYPIQQA
Ga0306926_1205287813300031954SoilSIAAYEVMTEGMTPEAAIDKAFKRADEIFAKYPITQA
Ga0307479_1140450713300031962Hardwood Forest SoilSVAEFDVLKNGMAPEAAIDKAFKRADEIFTRYPIAQS
Ga0318531_1027569913300031981SoilVNAEHLFSVAMFDAIKEGMAAKQAIDKAFKRAEEIFAKYPIAQA
Ga0306922_1080289813300032001SoilEHVIMNGVFDVLNNGMAPEVAIDKAFKRAEAIFAKYPIVSS
Ga0318570_1017817413300032054SoilAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS
Ga0318524_1043617723300032067SoilVFSIAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG
Ga0318553_1043927223300032068SoilAINDVISNGMTPEAAIDKAFSRCEAIFAKFPIAQA
Ga0306924_1197451413300032076SoilNAEHVFSVAEFDVMNNGIAPEQAIDNAFKRAEAIFAKYQIVQG
Ga0307470_1111113913300032174Hardwood Forest SoilNGERLFSVAMLDVMNNGMTPEQAIDKSFKRVEPIFAKCPIQQAWEES
Ga0307471_10084356613300032180Hardwood Forest SoilNAEHVFMVAEFDVMNGGMAPEAAIDKAFKRVEEIVAKYPITQS
Ga0307472_10044719913300032205Hardwood Forest SoilAEFDVLKNGMAPEAAIDKAFKRAEEIFAKYPITQT
Ga0306920_10263568023300032261SoilVAEFDVLKNGMAAEAAIDKAFKRADEIFTKYPIAQS
Ga0306920_10270082513300032261SoilIAEFDVMNNGMAPEQAIDKAFKRAEAIFAKYQIVQG
Ga0335073_1124928713300033134SoilFAVAMADVMNDGMTPQAAIDKAFKRCETIFAEYPIQQA
Ga0310914_1164223113300033289SoilGVFDVMKNGMAPEVAIDKAFKRAETIFTKYPILSS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.