| Basic Information | |
|---|---|
| Family ID | F069133 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYG |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.35 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.581 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.742 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.710 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13458 | Peripla_BP_6 | 49.19 |
| PF00005 | ABC_tran | 2.42 |
| PF16870 | OxoGdeHyase_C | 1.61 |
| PF00106 | adh_short | 0.81 |
| PF02653 | BPD_transp_2 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.58 % |
| All Organisms | root | All Organisms | 27.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100556919 | Not Available | 1024 | Open in IMG/M |
| 3300004080|Ga0062385_10359295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 857 | Open in IMG/M |
| 3300004152|Ga0062386_100714269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300004152|Ga0062386_100972500 | Not Available | 703 | Open in IMG/M |
| 3300004633|Ga0066395_10320131 | Not Available | 853 | Open in IMG/M |
| 3300005332|Ga0066388_105833706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 623 | Open in IMG/M |
| 3300005363|Ga0008090_10054289 | Not Available | 919 | Open in IMG/M |
| 3300005437|Ga0070710_11208268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 559 | Open in IMG/M |
| 3300005467|Ga0070706_100938982 | Not Available | 798 | Open in IMG/M |
| 3300005602|Ga0070762_10045521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2404 | Open in IMG/M |
| 3300005610|Ga0070763_10258797 | Not Available | 945 | Open in IMG/M |
| 3300005610|Ga0070763_10423810 | Not Available | 751 | Open in IMG/M |
| 3300006028|Ga0070717_11338831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 651 | Open in IMG/M |
| 3300006050|Ga0075028_100299105 | Not Available | 897 | Open in IMG/M |
| 3300006059|Ga0075017_101086673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 625 | Open in IMG/M |
| 3300006162|Ga0075030_101057756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300006175|Ga0070712_101219943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300006354|Ga0075021_10678730 | Not Available | 661 | Open in IMG/M |
| 3300006854|Ga0075425_100169507 | Not Available | 2506 | Open in IMG/M |
| 3300006903|Ga0075426_10063700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2634 | Open in IMG/M |
| 3300009522|Ga0116218_1154187 | Not Available | 1043 | Open in IMG/M |
| 3300009545|Ga0105237_10441189 | Not Available | 1308 | Open in IMG/M |
| 3300009683|Ga0116224_10091184 | Not Available | 1479 | Open in IMG/M |
| 3300009824|Ga0116219_10625217 | Not Available | 591 | Open in IMG/M |
| 3300010154|Ga0127503_10346446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300010360|Ga0126372_12250021 | Not Available | 595 | Open in IMG/M |
| 3300010361|Ga0126378_11080900 | Not Available | 904 | Open in IMG/M |
| 3300010366|Ga0126379_13533104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300010376|Ga0126381_104347647 | Not Available | 548 | Open in IMG/M |
| 3300010376|Ga0126381_104953198 | Not Available | 511 | Open in IMG/M |
| 3300010876|Ga0126361_11228107 | Not Available | 967 | Open in IMG/M |
| 3300012207|Ga0137381_11115676 | Not Available | 679 | Open in IMG/M |
| 3300012209|Ga0137379_11512971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300012211|Ga0137377_11457409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300012350|Ga0137372_10048457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3769 | Open in IMG/M |
| 3300012922|Ga0137394_11391572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300012924|Ga0137413_10867865 | Not Available | 698 | Open in IMG/M |
| 3300012971|Ga0126369_11559882 | Not Available | 750 | Open in IMG/M |
| 3300012971|Ga0126369_13017439 | Not Available | 551 | Open in IMG/M |
| 3300012971|Ga0126369_13474766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300013102|Ga0157371_11389214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300013104|Ga0157370_10454346 | Not Available | 1178 | Open in IMG/M |
| 3300015245|Ga0137409_10668316 | Not Available | 872 | Open in IMG/M |
| 3300016270|Ga0182036_10493856 | Not Available | 968 | Open in IMG/M |
| 3300016404|Ga0182037_11346183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300016404|Ga0182037_11533914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300016445|Ga0182038_10777576 | Not Available | 838 | Open in IMG/M |
| 3300017822|Ga0187802_10002720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5070 | Open in IMG/M |
| 3300017926|Ga0187807_1119912 | Not Available | 833 | Open in IMG/M |
| 3300017933|Ga0187801_10166577 | Not Available | 863 | Open in IMG/M |
| 3300017942|Ga0187808_10284241 | Not Available | 744 | Open in IMG/M |
| 3300017942|Ga0187808_10524691 | Not Available | 550 | Open in IMG/M |
| 3300017994|Ga0187822_10180303 | Not Available | 694 | Open in IMG/M |
| 3300018012|Ga0187810_10000592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13614 | Open in IMG/M |
| 3300018046|Ga0187851_10028298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3842 | Open in IMG/M |
| 3300018060|Ga0187765_10611511 | Not Available | 705 | Open in IMG/M |
| 3300021388|Ga0213875_10557164 | Not Available | 552 | Open in IMG/M |
| 3300022557|Ga0212123_10317718 | Not Available | 1080 | Open in IMG/M |
| 3300024347|Ga0179591_1241943 | Not Available | 4579 | Open in IMG/M |
| 3300025134|Ga0207416_1088563 | Not Available | 1146 | Open in IMG/M |
| 3300025321|Ga0207656_10042205 | Not Available | 1940 | Open in IMG/M |
| 3300025910|Ga0207684_11556757 | Not Available | 536 | Open in IMG/M |
| 3300026023|Ga0207677_11103645 | Not Available | 723 | Open in IMG/M |
| 3300026304|Ga0209240_1233522 | Not Available | 559 | Open in IMG/M |
| 3300027568|Ga0208042_1059696 | Not Available | 972 | Open in IMG/M |
| 3300027857|Ga0209166_10653063 | Not Available | 532 | Open in IMG/M |
| 3300027867|Ga0209167_10687890 | Not Available | 559 | Open in IMG/M |
| 3300027889|Ga0209380_10027610 | Not Available | 3200 | Open in IMG/M |
| 3300027889|Ga0209380_10517849 | Not Available | 695 | Open in IMG/M |
| 3300028808|Ga0302228_10324283 | Not Available | 688 | Open in IMG/M |
| 3300030058|Ga0302179_10146092 | Not Available | 1044 | Open in IMG/M |
| 3300030602|Ga0210254_11281000 | Not Available | 577 | Open in IMG/M |
| 3300031573|Ga0310915_10388359 | Not Available | 991 | Open in IMG/M |
| 3300031640|Ga0318555_10230488 | Not Available | 1000 | Open in IMG/M |
| 3300031679|Ga0318561_10555112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300031681|Ga0318572_10436036 | Not Available | 779 | Open in IMG/M |
| 3300031708|Ga0310686_110703024 | Not Available | 643 | Open in IMG/M |
| 3300031713|Ga0318496_10053232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2099 | Open in IMG/M |
| 3300031713|Ga0318496_10295073 | Not Available | 895 | Open in IMG/M |
| 3300031713|Ga0318496_10321243 | Not Available | 855 | Open in IMG/M |
| 3300031715|Ga0307476_10126455 | Not Available | 1824 | Open in IMG/M |
| 3300031723|Ga0318493_10106650 | Not Available | 1412 | Open in IMG/M |
| 3300031751|Ga0318494_10121403 | Not Available | 1456 | Open in IMG/M |
| 3300031764|Ga0318535_10209289 | Not Available | 872 | Open in IMG/M |
| 3300031768|Ga0318509_10225301 | Not Available | 1045 | Open in IMG/M |
| 3300031768|Ga0318509_10668497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300031770|Ga0318521_10305597 | Not Available | 937 | Open in IMG/M |
| 3300031770|Ga0318521_10380310 | Not Available | 840 | Open in IMG/M |
| 3300031777|Ga0318543_10108642 | Not Available | 1197 | Open in IMG/M |
| 3300031777|Ga0318543_10506673 | Not Available | 541 | Open in IMG/M |
| 3300031779|Ga0318566_10157954 | Not Available | 1124 | Open in IMG/M |
| 3300031781|Ga0318547_10516598 | Not Available | 738 | Open in IMG/M |
| 3300031781|Ga0318547_10948225 | Not Available | 537 | Open in IMG/M |
| 3300031793|Ga0318548_10678619 | Not Available | 500 | Open in IMG/M |
| 3300031794|Ga0318503_10078498 | Not Available | 1034 | Open in IMG/M |
| 3300031798|Ga0318523_10397724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300031821|Ga0318567_10086821 | Not Available | 1676 | Open in IMG/M |
| 3300031821|Ga0318567_10591352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300031832|Ga0318499_10293860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031833|Ga0310917_10833559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300031835|Ga0318517_10052228 | Not Available | 1715 | Open in IMG/M |
| 3300031835|Ga0318517_10447010 | Not Available | 583 | Open in IMG/M |
| 3300031845|Ga0318511_10496291 | Not Available | 565 | Open in IMG/M |
| 3300031860|Ga0318495_10261529 | Not Available | 773 | Open in IMG/M |
| 3300031860|Ga0318495_10454795 | Not Available | 561 | Open in IMG/M |
| 3300031879|Ga0306919_10998924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300031910|Ga0306923_10624920 | Not Available | 1206 | Open in IMG/M |
| 3300031947|Ga0310909_10088324 | Not Available | 2471 | Open in IMG/M |
| 3300031981|Ga0318531_10259148 | Not Available | 785 | Open in IMG/M |
| 3300032001|Ga0306922_10869967 | Not Available | 938 | Open in IMG/M |
| 3300032010|Ga0318569_10145071 | Not Available | 1091 | Open in IMG/M |
| 3300032052|Ga0318506_10519789 | Not Available | 527 | Open in IMG/M |
| 3300032054|Ga0318570_10014505 | Not Available | 2855 | Open in IMG/M |
| 3300032054|Ga0318570_10363267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300032055|Ga0318575_10691885 | Not Available | 516 | Open in IMG/M |
| 3300032064|Ga0318510_10026491 | Not Available | 1902 | Open in IMG/M |
| 3300032067|Ga0318524_10247368 | Not Available | 917 | Open in IMG/M |
| 3300032068|Ga0318553_10592538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300032068|Ga0318553_10609274 | Not Available | 572 | Open in IMG/M |
| 3300032261|Ga0306920_101498112 | Not Available | 963 | Open in IMG/M |
| 3300032261|Ga0306920_103709536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300032828|Ga0335080_11247708 | Not Available | 745 | Open in IMG/M |
| 3300033289|Ga0310914_10530208 | Not Available | 1064 | Open in IMG/M |
| 3300033290|Ga0318519_10518509 | Not Available | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005569191 | 3300002245 | Forest Soil | METTTIPPTLPTVPARPLAAVRRYAGQWGLIAALAALPIYFGVHDLVFGYQVGIVA |
| Ga0062385_103592951 | 3300004080 | Bog Forest Soil | METTTITPTQPRVPVRSLAAVRRYAGQWGLIAALAALPVYYGVHDL |
| Ga0062386_1007142692 | 3300004152 | Bog Forest Soil | METTTVSPPGLPAAPARQLAAVRRYAGQWGLIAALAALPVYYGI |
| Ga0062386_1009725001 | 3300004152 | Bog Forest Soil | METTTISPTLPTVPVRPLAAVRQHVGQWGLIAALAALPVYYGIH |
| Ga0066395_103201312 | 3300004633 | Tropical Forest Soil | VATRTISPTRPPAAPARPLAAVRRYAGRWGLIVALAALPV |
| Ga0066388_1058337062 | 3300005332 | Tropical Forest Soil | METTTISPTPLPTVPVRPLAAVRRYVGQWGLIAALAALPVYYGVHDLV |
| Ga0008090_100542892 | 3300005363 | Tropical Rainforest Soil | METTTVSPPSPPVAPVRSLAAVRRYAGQWGLIAALAALPVYYGV |
| Ga0070710_112082682 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTTTITPGPPATAARPVTAALAAVRRYAGRWGLIVALLALPVYYGV |
| Ga0070706_1009389822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | METTTISPTPLPTVPVRPLAAVRRYAGQWGLIAALAALPVYY |
| Ga0070762_100455211 | 3300005602 | Soil | METTTITPALPSVPMRRLAAVRRYAGQWGLIAALAAL |
| Ga0070763_102587972 | 3300005610 | Soil | METTTVTPTLPTVPVRPLAAVRRYAGQWGLIAALAALP |
| Ga0070763_104238101 | 3300005610 | Soil | METTTIPPTLPTVPVRSLAAVRRYAGQWGLIAALAALP |
| Ga0070717_113388311 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | METTTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYQV |
| Ga0075028_1002991051 | 3300006050 | Watersheds | MEPVETTTISPTPSPPAVGARPLAAIRRFAGRWGLIAALAALPVYY |
| Ga0075017_1010866732 | 3300006059 | Watersheds | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYG |
| Ga0075030_1010577562 | 3300006162 | Watersheds | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0070712_1012199431 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VETTTLSRSPLAATARPLAAVRRVAGRWGLIAALAALPVYYGIS |
| Ga0075021_106787302 | 3300006354 | Watersheds | METTTIPPSAPPAARARPLATVRRYAGRWGLIAAL |
| Ga0075425_1001695074 | 3300006854 | Populus Rhizosphere | VETTTLSRSPLAATARPLAAVRRVAGRWGLIAALAALP |
| Ga0075426_100637001 | 3300006903 | Populus Rhizosphere | VATRTVSPTRPPTAPARPLAAVRRFAGRWGLIVALAALPVYYG |
| Ga0116218_11541872 | 3300009522 | Peatlands Soil | METTTVSPPSLPAAPAHPLAAVRRYAGQWGLIAALVALPVYYGVHDLVYGYQVGIV |
| Ga0105237_104411891 | 3300009545 | Corn Rhizosphere | METTTIPPSAPPAARARPLAAVRRFAGRWGLIAALAA |
| Ga0116224_100911841 | 3300009683 | Peatlands Soil | METTTISPTLPAAPVRPLAAVRRHAGQWGLIAALAALPVYYGVH |
| Ga0116219_106252172 | 3300009824 | Peatlands Soil | METTTISPTLPTVPVRPLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0127503_103464461 | 3300010154 | Soil | MEPVETTTISPTPSPPAVTARSLAAVRRYAGRWGLIAALAALP |
| Ga0126372_122500212 | 3300010360 | Tropical Forest Soil | METTTISPTPLPTVPVRPLAAVRRYAGQWGLIAALAAL |
| Ga0126378_110809001 | 3300010361 | Tropical Forest Soil | METTTIPPSAPPAARARPLAAVRRYAGRWGLIAALAALPVYY |
| Ga0126379_135331041 | 3300010366 | Tropical Forest Soil | METTTVSPPGQTAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHD |
| Ga0126381_1043476472 | 3300010376 | Tropical Forest Soil | METTTVSPPSLPTAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHD |
| Ga0126381_1049531982 | 3300010376 | Tropical Forest Soil | METTTISPTPLPTVPVRPLAAVRRYVGQWGLIAALAALPVYYGVHDLVYGY |
| Ga0126361_112281071 | 3300010876 | Boreal Forest Soil | METTTITPTLPSVPMRRLTAVRRYAGQWGLIAALAALP |
| Ga0137381_111156762 | 3300012207 | Vadose Zone Soil | VETTTISPSSPPAVAARPLAAVRRFFGRWGLIAALAALPVYYGI |
| Ga0137379_115129712 | 3300012209 | Vadose Zone Soil | VETTTISPSSPPAVAARPLAAVRRFFGRWGLIAALAALPV |
| Ga0137377_114574091 | 3300012211 | Vadose Zone Soil | VETRTISPSLPAAPVRPLAVARRYVGRWGLIVALAALPI |
| Ga0137372_100484571 | 3300012350 | Vadose Zone Soil | METTTISPSVPPEARVRPLAAVRRYVGRWGLIAALAALPVYYGI |
| Ga0137394_113915722 | 3300012922 | Vadose Zone Soil | MELVETTTISPTPSPPAVGARPLAAVRRFAGRWGLIAALAALPVYY |
| Ga0137413_108678652 | 3300012924 | Vadose Zone Soil | MEPVETTTTSPSPPAVAARRLAAVRRYVGRWALIAALA |
| Ga0126369_115598821 | 3300012971 | Tropical Forest Soil | METTTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALAALPV |
| Ga0126369_130174392 | 3300012971 | Tropical Forest Soil | METTTISPAPLPTVPVRPLAAVRRYAGQWGLIAALAALPVYY |
| Ga0126369_134747661 | 3300012971 | Tropical Forest Soil | VATRTVSPTSPPAAPARPLVAVRRYVGRWGLIVALA |
| Ga0157371_113892142 | 3300013102 | Corn Rhizosphere | VNTTTITPSPPATAARPAAAALAALRRYVGRWGLIAALLALPVYYA |
| Ga0157370_104543462 | 3300013104 | Corn Rhizosphere | VATRTISPTSPPAAPARPLAAVRRFVGRWGLIAALAALPVYYGIH |
| Ga0137409_106683161 | 3300015245 | Vadose Zone Soil | MEPVETTTISPTPSPPAVGARPLAAVRRFAGRWGLIAALAALPI |
| Ga0182036_104938562 | 3300016270 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGY |
| Ga0182037_113461832 | 3300016404 | Soil | METTTVSPPSLPAAPARPLAAVRRYAGQWGLIAALAALPVYYGVH |
| Ga0182037_115339141 | 3300016404 | Soil | VATRTVSPSPPAVRTHPLVAIRHYAGRWGLIVALAALPVYYGIQDLV |
| Ga0182038_107775762 | 3300016445 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALA |
| Ga0187802_100027201 | 3300017822 | Freshwater Sediment | METTTVPPPSLPAAPARSLGAVRRYVGQWGLIAALAALPVYYGVHDLVYGYQ |
| Ga0187807_11199122 | 3300017926 | Freshwater Sediment | METTTITPTLPAVPARPLAAVRRYAGQWGLIAALAALPVYYGI |
| Ga0187801_101665771 | 3300017933 | Freshwater Sediment | METTTITPTLPTVPVRPLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0187808_102842412 | 3300017942 | Freshwater Sediment | VETTTISPSPPPVVAARPLAAVRRFFGRWGLIAALAA |
| Ga0187808_105246912 | 3300017942 | Freshwater Sediment | METTTVSPPSLPAAPARQLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYQV |
| Ga0187822_101803032 | 3300017994 | Freshwater Sediment | METTTVSPPSLPAAPVRRLAAVRRHAGQWGLIAALAALPVYYGIHD |
| Ga0187810_100005921 | 3300018012 | Freshwater Sediment | METTIVSPPSLPAAPARSLAAVRRHAGQWGLIAALAALPVYYG |
| Ga0187851_100282981 | 3300018046 | Peatland | VETTTISPIPPAVAARPLAAVRRYFGRWGLIAALA |
| Ga0187765_106115111 | 3300018060 | Tropical Peatland | VATRTISPASPPKAPARPLVAVRKYAGRWGLIVAL |
| Ga0213875_105571641 | 3300021388 | Plant Roots | METTTVSPPSLPAAPARPLAAVRRYAGQWGLIAAL |
| Ga0212123_103177182 | 3300022557 | Iron-Sulfur Acid Spring | METTTVTPTLPTVPVRPLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0179591_12419432 | 3300024347 | Vadose Zone Soil | MEPVETTTISPTPSPPAVGARHSRRFAVLAGRWGLIAALAALADLLRHQVI |
| Ga0207416_10885631 | 3300025134 | Iron-Sulfur Acid Spring | METTTITPTLPSVPMRRLAAVRRYAGQWGLIAALAALPVYYGVHDLV |
| Ga0207656_100422053 | 3300025321 | Corn Rhizosphere | METTTIPPSAPPAARARPLAAVRRFAGRWGLIAALAALPVYY |
| Ga0207684_115567571 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | METTTISPTPLPTVPVRPLAAVRRYAGQWGLIAALAALPVY |
| Ga0207677_111036451 | 3300026023 | Miscanthus Rhizosphere | MEPVETTTISPTPSPPSVAARPLAAVRHYAGRWGL |
| Ga0209240_12335221 | 3300026304 | Grasslands Soil | METTTISPTPLPTVPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVY |
| Ga0208042_10596961 | 3300027568 | Peatlands Soil | VETTTISPSPPPALAARPLAAVRRFFGRWGLIAALAALPVY |
| Ga0209166_106530632 | 3300027857 | Surface Soil | METTTISPTLPAVPTRPLAAVRRYAGQWGLIAALAALPVYYGVHDLV |
| Ga0209167_106878901 | 3300027867 | Surface Soil | METTTVSPPGLPAAPARQLAAVRRYAGQWGLIAALAALPVYYGVHDLV |
| Ga0209380_100276104 | 3300027889 | Soil | METTTITPTLPTVPLRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYG |
| Ga0209380_105178492 | 3300027889 | Soil | METTTITPTLPKVPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYG |
| Ga0302228_103242832 | 3300028808 | Palsa | METTTITPTQPTVPVRSLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0302179_101460922 | 3300030058 | Palsa | VETTTISPIPPPVAAHPLAAVRRYFGRWGLIAALAALP |
| Ga0210254_112810001 | 3300030602 | Soil | METTTITPTLPSVPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYQVTV |
| Ga0310915_103883591 | 3300031573 | Soil | METTTIPPSAPPAARARPLAAVRRYAGRWGLIAALAALPVYYGI |
| Ga0318555_102304882 | 3300031640 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVY |
| Ga0318561_105551121 | 3300031679 | Soil | METTTVSPPSLPAAPVRQLAAVRRYAGQWGLIAALAALPVY |
| Ga0318572_104360361 | 3300031681 | Soil | METTTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALA |
| Ga0310686_1107030242 | 3300031708 | Soil | VNTTITPSPPALAARPAATVLAALRRYGGRWGLIVALAALPVYY |
| Ga0318496_100532321 | 3300031713 | Soil | METTTLSPSAPPAARARPLAAVRRYAGRWGLIAALAALPVYY |
| Ga0318496_102950732 | 3300031713 | Soil | METTTVSPPSLPAAPVSPLAAVRRHAGQWGLIAALAALPVYY |
| Ga0318496_103212432 | 3300031713 | Soil | MEATTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYG |
| Ga0307476_101264552 | 3300031715 | Hardwood Forest Soil | METTTVSPPSLPAAPARQLAAVRRYAGQWGLIAALA |
| Ga0318493_101066502 | 3300031723 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYT |
| Ga0318494_101214033 | 3300031751 | Soil | MEATTVSPPSPPVAPVRQLAAVRRHAGQWGLIAALAALPVYYGVHDLVYGYT |
| Ga0318535_102092892 | 3300031764 | Soil | METTTVSPPSPPVAPVHPLAAVRRYAGQWGLIAALAALPVYYG |
| Ga0318509_102253012 | 3300031768 | Soil | METTTVSPPSLPAAPARPLAAVRRYAGEWGLIAALAALPVYYGVHDLVYGYTV |
| Ga0318509_106684971 | 3300031768 | Soil | METTTLSPSAPPAARARPLAAVRRYAGRWGLIAALAAI |
| Ga0318521_103055972 | 3300031770 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGY |
| Ga0318521_103803101 | 3300031770 | Soil | METTTVSPPSLPATPVRPLAAVRRYAGQWGLIAALAALPVYYGVHD |
| Ga0318543_101086422 | 3300031777 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSVAG |
| Ga0318543_105066732 | 3300031777 | Soil | METTTVSPPSPPVAPVHPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSVAG |
| Ga0318566_101579542 | 3300031779 | Soil | METTTVSPPSLPAAPARPLAAVRRYAGQWGLIAALAALPVYYGVHDLV |
| Ga0318547_105165982 | 3300031781 | Soil | METTTISPTLPTVPVRPLAAVRRYAGQWGLIAALA |
| Ga0318547_109482252 | 3300031781 | Soil | MEATTVSPPSPPVAPVRQLAAVRRHAGQWGLIAALAALPVYYG |
| Ga0318548_106786191 | 3300031793 | Soil | METTTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHD |
| Ga0318503_100784981 | 3300031794 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYT |
| Ga0318523_103977242 | 3300031798 | Soil | METTTVSPPSQPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSVA |
| Ga0318567_100868213 | 3300031821 | Soil | METTTLSPSAPPAARARPLAAVRRYAGRWGLIAALAALPV |
| Ga0318567_105913522 | 3300031821 | Soil | METTTVSPPSPPVAPVHPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYG |
| Ga0318499_102938602 | 3300031832 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAAQPV |
| Ga0310917_108335592 | 3300031833 | Soil | METTTIPPSAPPAARARPLAAVRRYAGRWGLIAALAA |
| Ga0318517_100522281 | 3300031835 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDL |
| Ga0318517_104470101 | 3300031835 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHD |
| Ga0318511_104962912 | 3300031845 | Soil | METTTVSPPSLPTAPVRPLAAVRRYAGQWGLIGALAALPVYYGVHDLVYGYQV |
| Ga0318495_102615292 | 3300031860 | Soil | METTTISPTLPTVPVRPLAAVRRYAGQWGLIAALAALPVY |
| Ga0318495_104547952 | 3300031860 | Soil | METTTVSPPSLPAAPARPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSV |
| Ga0306919_109989242 | 3300031879 | Soil | METTTVSPPSLPAAPARSLATVRRHAGQWGLIAALAALPVYY |
| Ga0306923_106249202 | 3300031910 | Soil | METTTVSPPSQPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYT |
| Ga0310909_100883244 | 3300031947 | Soil | METTTVSPPSPPVAPVHPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSV |
| Ga0318531_102591482 | 3300031981 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYY |
| Ga0306922_108699672 | 3300032001 | Soil | METTTVSPPSPPVAPVHPLAAVRRYAGQWGLIAALAALPV |
| Ga0318569_101450712 | 3300032010 | Soil | MPYDTPHGAMETTTISPSAPPAARARPLAAVRRYAGRWGLIAALAALPVY |
| Ga0318506_105197892 | 3300032052 | Soil | METTTVSPPSLPAAPARPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTV |
| Ga0318570_100145054 | 3300032054 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVSVA |
| Ga0318570_103632671 | 3300032054 | Soil | MEATTVSPPSPPVAPVRQLAAVRRHAGQWGLIAALAALPVYYGVHDLVY |
| Ga0318575_106918851 | 3300032055 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYY |
| Ga0318510_100264911 | 3300032064 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALP |
| Ga0318524_102473681 | 3300032067 | Soil | MPYDTPHGAMETTTISPSAPPAARARPLAAVRRYAGRWGLIAALAALPVYY |
| Ga0318553_105925382 | 3300032068 | Soil | METTTLSPSAPPAARARPLAAVRRYAGRWGLIAALAA |
| Ga0318553_106092742 | 3300032068 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVFGY |
| Ga0306920_1014981122 | 3300032261 | Soil | METTTVSPPSPPVAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVY |
| Ga0306920_1037095362 | 3300032261 | Soil | METTTLSPSAPPAARARPLAAVRRYAGRWGLIAALAALPVYYG |
| Ga0335080_112477082 | 3300032828 | Soil | METTTASPPSLPAAPVRQLAAVRRHAGQWGLIAALAALPVYYGV |
| Ga0310914_105302081 | 3300033289 | Soil | METTTVSPPSLPAAPVRRLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTVS |
| Ga0318519_105185091 | 3300033290 | Soil | METTTVSPPSLPAAPVRPLAAVRRYAGQWGLIAALAALPVYYGVHDLVYGYTV |
| ⦗Top⦘ |