| Basic Information | |
|---|---|
| Family ID | F069129 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VRELERAVDAVVVGERERLVAKLGRSRRELLGQRGAVEERIG |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.13 % |
| % of genes near scaffold ends (potentially truncated) | 81.45 % |
| % of genes from short scaffolds (< 2000 bps) | 91.13 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.935 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.323 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.839 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.387 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 85.48 |
| PF02811 | PHP | 7.26 |
| PF00817 | IMS | 2.42 |
| PF07733 | DNA_pol3_alpha | 0.81 |
| PF01694 | Rhomboid | 0.81 |
| PF13411 | MerR_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 2.42 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.81 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.94 % |
| Unclassified | root | N/A | 8.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000041|ARcpr5oldR_c023516 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101637762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1248 | Open in IMG/M |
| 3300000858|JGI10213J12805_10002763 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300000956|JGI10216J12902_101673160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1267 | Open in IMG/M |
| 3300000956|JGI10216J12902_104059068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 685 | Open in IMG/M |
| 3300000956|JGI10216J12902_122900984 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300004081|Ga0063454_100152073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1227 | Open in IMG/M |
| 3300004114|Ga0062593_100461714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1162 | Open in IMG/M |
| 3300004479|Ga0062595_100367300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1012 | Open in IMG/M |
| 3300004479|Ga0062595_102283443 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005166|Ga0066674_10102033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300005172|Ga0066683_10224777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1161 | Open in IMG/M |
| 3300005180|Ga0066685_10240629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1247 | Open in IMG/M |
| 3300005186|Ga0066676_10056059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2260 | Open in IMG/M |
| 3300005328|Ga0070676_10468858 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005334|Ga0068869_100916657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 759 | Open in IMG/M |
| 3300005338|Ga0068868_100471960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1094 | Open in IMG/M |
| 3300005340|Ga0070689_100578099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300005340|Ga0070689_101183249 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005345|Ga0070692_10390553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300005345|Ga0070692_10825763 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005366|Ga0070659_100198116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1652 | Open in IMG/M |
| 3300005434|Ga0070709_10504461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 919 | Open in IMG/M |
| 3300005434|Ga0070709_11264211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 595 | Open in IMG/M |
| 3300005435|Ga0070714_100245991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1652 | Open in IMG/M |
| 3300005437|Ga0070710_10146100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1454 | Open in IMG/M |
| 3300005440|Ga0070705_100703504 | Not Available | 794 | Open in IMG/M |
| 3300005455|Ga0070663_100370489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1164 | Open in IMG/M |
| 3300005467|Ga0070706_101093897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 734 | Open in IMG/M |
| 3300005526|Ga0073909_10532714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300005526|Ga0073909_10631143 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005529|Ga0070741_10054189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4793 | Open in IMG/M |
| 3300005536|Ga0070697_100494689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1069 | Open in IMG/M |
| 3300005537|Ga0070730_10316124 | Not Available | 1021 | Open in IMG/M |
| 3300005540|Ga0066697_10815141 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005548|Ga0070665_101366725 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005549|Ga0070704_100231371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1508 | Open in IMG/M |
| 3300005549|Ga0070704_100854955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 816 | Open in IMG/M |
| 3300005553|Ga0066695_10870583 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005553|Ga0066695_10898843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300005561|Ga0066699_10378513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1012 | Open in IMG/M |
| 3300005576|Ga0066708_10046379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2414 | Open in IMG/M |
| 3300005577|Ga0068857_100611834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300005587|Ga0066654_10595747 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005614|Ga0068856_100619913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1103 | Open in IMG/M |
| 3300005718|Ga0068866_10758523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300006034|Ga0066656_10058130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2250 | Open in IMG/M |
| 3300006034|Ga0066656_10981148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300006058|Ga0075432_10006435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3997 | Open in IMG/M |
| 3300006175|Ga0070712_101612466 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006358|Ga0068871_100951743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 798 | Open in IMG/M |
| 3300006580|Ga0074049_12707471 | Not Available | 1048 | Open in IMG/M |
| 3300006606|Ga0074062_11918307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 847 | Open in IMG/M |
| 3300006796|Ga0066665_11110926 | Not Available | 602 | Open in IMG/M |
| 3300006847|Ga0075431_100067933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3679 | Open in IMG/M |
| 3300006847|Ga0075431_102170451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300006854|Ga0075425_103005318 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006876|Ga0079217_10059741 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300006914|Ga0075436_100154027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1618 | Open in IMG/M |
| 3300009012|Ga0066710_100637018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1620 | Open in IMG/M |
| 3300009137|Ga0066709_101570309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300009176|Ga0105242_11851749 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009553|Ga0105249_10815313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 998 | Open in IMG/M |
| 3300010036|Ga0126305_10926332 | Not Available | 596 | Open in IMG/M |
| 3300010323|Ga0134086_10367234 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010360|Ga0126372_10092355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2245 | Open in IMG/M |
| 3300010373|Ga0134128_10571120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1259 | Open in IMG/M |
| 3300010398|Ga0126383_11263380 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300011119|Ga0105246_12455072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 512 | Open in IMG/M |
| 3300012001|Ga0120167_1077363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 696 | Open in IMG/M |
| 3300012014|Ga0120159_1003552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7957 | Open in IMG/M |
| 3300012045|Ga0136623_10070565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300012353|Ga0137367_10276892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1204 | Open in IMG/M |
| 3300012505|Ga0157339_1050498 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012910|Ga0157308_10383580 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012960|Ga0164301_10264054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1138 | Open in IMG/M |
| 3300012984|Ga0164309_10788510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300012985|Ga0164308_10492097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300014745|Ga0157377_10763702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300017654|Ga0134069_1026526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
| 3300017695|Ga0180121_10377861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300017792|Ga0163161_10984993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 719 | Open in IMG/M |
| 3300018027|Ga0184605_10361975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300018056|Ga0184623_10204977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 906 | Open in IMG/M |
| 3300018431|Ga0066655_10105850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1586 | Open in IMG/M |
| 3300018476|Ga0190274_12332014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300021080|Ga0210382_10290336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300021445|Ga0182009_10259158 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021510|Ga0222621_1114709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300024286|Ga0247687_1055757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300025322|Ga0209641_10484221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300025917|Ga0207660_10183007 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300025926|Ga0207659_11855305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300025935|Ga0207709_10483339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300025937|Ga0207669_10524024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 952 | Open in IMG/M |
| 3300025944|Ga0207661_10648053 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300025945|Ga0207679_10549145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1036 | Open in IMG/M |
| 3300025986|Ga0207658_10865363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300026023|Ga0207677_11248731 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300026041|Ga0207639_10338789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300026078|Ga0207702_10015688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6272 | Open in IMG/M |
| 3300026078|Ga0207702_10108467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2464 | Open in IMG/M |
| 3300026078|Ga0207702_10247874 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300026118|Ga0207675_100215174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1850 | Open in IMG/M |
| 3300026310|Ga0209239_1113824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1131 | Open in IMG/M |
| 3300026330|Ga0209473_1234934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300028379|Ga0268266_10575462 | Not Available | 1081 | Open in IMG/M |
| 3300028596|Ga0247821_10310297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300028705|Ga0307276_10104213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 689 | Open in IMG/M |
| 3300028782|Ga0307306_10056979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_68_12 | 983 | Open in IMG/M |
| 3300028784|Ga0307282_10566860 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028796|Ga0307287_10056756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 1446 | Open in IMG/M |
| 3300028807|Ga0307305_10243068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 823 | Open in IMG/M |
| 3300028828|Ga0307312_10222985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1215 | Open in IMG/M |
| 3300028875|Ga0307289_10337359 | Not Available | 620 | Open in IMG/M |
| 3300028884|Ga0307308_10210371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300028884|Ga0307308_10234450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_10 | 879 | Open in IMG/M |
| 3300030336|Ga0247826_10331491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300030336|Ga0247826_10654269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 811 | Open in IMG/M |
| 3300031198|Ga0307500_10105733 | Not Available | 761 | Open in IMG/M |
| 3300032174|Ga0307470_10203236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
| 3300032179|Ga0310889_10568595 | Not Available | 582 | Open in IMG/M |
| 3300033551|Ga0247830_10229039 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.03% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5oldR_0235162 | 3300000041 | Arabidopsis Rhizosphere | RAVDAVVVGQRQGPIAQLGSAGGKLLRQRGAVQERIG* |
| INPhiseqgaiiFebDRAFT_1016377624 | 3300000364 | Soil | ADAVVVGEGERVVAEIGRPRCQLLGLRGAVQERVR* |
| JGI10213J12805_100027631 | 3300000858 | Soil | MRELERAVDAVVVGERERLVSELGGPRGQVLRVRGAVEERIG* |
| JGI10216J12902_1016731604 | 3300000956 | Soil | ERAADAVVVGERERLVTEVGGTGGELLGLRSSVEERVR* |
| JGI10216J12902_1040590681 | 3300000956 | Soil | ELERAVDPVVIGQRERFVAELRRARGELLGQRGAVEERIG* |
| JGI10216J12902_1229009841 | 3300000956 | Soil | HAERLGRVGELERAVDPIVVGQRQCLIAELRRPGRELLRQRGPVQKRIG* |
| Ga0063454_1001520731 | 3300004081 | Soil | LRRVRELERAVDAVVVGQRERRVAELGRARRELLGLGRTVEERIR* |
| Ga0062593_1004617143 | 3300004114 | Soil | RELERAVDAVVVGERERLVAKLGRSRRELLGQRGAVEERIG* |
| Ga0062595_1003673002 | 3300004479 | Soil | RPHAERLRSVRELERAVDAVMVGQRERLVTELGRARCQLLRQRGTVQKGIR* |
| Ga0062595_1022834431 | 3300004479 | Soil | LERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0066674_101020331 | 3300005166 | Soil | LRRVRELERPVDAVVVGERQRLVAELRGAGGELLRMRSAVEEGIG* |
| Ga0066683_102247773 | 3300005172 | Soil | ELERAVDPVVVGQRERAVAELGRADRELLRQRSAVEERIG* |
| Ga0066685_102406293 | 3300005180 | Soil | RLRRMGELERAVDPVVIGQRQRLVAELRCLGRELLRERGSVQERIG* |
| Ga0066676_100560591 | 3300005186 | Soil | RRVRELERAVDAVVIGQRQRLVAELRGAGGQLLGQRSAVEERIG* |
| Ga0070676_104688582 | 3300005328 | Miscanthus Rhizosphere | VRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0068869_1009166571 | 3300005334 | Miscanthus Rhizosphere | ELERAVDPVVVGQRQRLVPELRRPRRQLLGQRRAVEERIG* |
| Ga0068868_1004719601 | 3300005338 | Miscanthus Rhizosphere | VLRGVRELERAVEPVVVGERECLVAELDRLGGELFGQRGAVQERIG* |
| Ga0070689_1005780992 | 3300005340 | Switchgrass Rhizosphere | MRELERAVDPLVVGQRQRLVTELGRPRRQFLRQRGAVEEGIG* |
| Ga0070689_1011832491 | 3300005340 | Switchgrass Rhizosphere | RVRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0070692_103905532 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VRELERAVDAVVVGQRERLVPELRRARRQLLRQRGAVQERIR* |
| Ga0070692_108257631 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RMRELERAVDAVVISERERVVAELRRVRRELLRQRRAVEERIG* |
| Ga0070659_1001981161 | 3300005366 | Corn Rhizosphere | ERLRSVRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0070709_105044612 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VRELQRAVDAVVVGERERRVTELGGPCGKLLGQRGAVEERIG* |
| Ga0070709_112642111 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVRELERAVDPVVVGQRKRAVVELGRLNRQLLRQRSAVEERIG* |
| Ga0070714_1002459912 | 3300005435 | Agricultural Soil | VRELERAVDAVVVGERERRVTELGGPCGKLLGQRGAVEERIG* |
| Ga0070710_101461002 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VRELQRAVDAVVVGERERLVTELGGPCGKLLGQRGAVEERIG* |
| Ga0070705_1007035042 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AERLGRVGELERAADAVVVGERQCRIPEIGGPRTELVGRRGTVEERIR* |
| Ga0070663_1003704891 | 3300005455 | Corn Rhizosphere | ELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0070706_1010938972 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RVRELERAVDPVVVGQRKRAVVELGRLNRQLLRQRSAVEERIG* |
| Ga0073909_105327142 | 3300005526 | Surface Soil | RLGRVGELERAADGVVVGERERLVAEVGGARGELVGQRGAVEERVR* |
| Ga0073909_106311431 | 3300005526 | Surface Soil | RVRELERAVDAVVVGERERRVTELGGPCGKLLGQRGAVEERIG* |
| Ga0070741_100541896 | 3300005529 | Surface Soil | DAERLRRLGELERPVDAVVVGERERLVAELRRACGQLLGLRGAVEERIG* |
| Ga0070697_1004946892 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LRELERAVDAVVVGQRQRAVAELRGPNRELLRQRSAVQERIG* |
| Ga0070730_103161241 | 3300005537 | Surface Soil | DAVVVGERERLVAELRGSDRELLRLRSSVEERIG* |
| Ga0066697_108151412 | 3300005540 | Soil | LRRVRELERAVDAVVVGERERLVAELRRPRGQLLGQRRPVEE* |
| Ga0070665_1013667251 | 3300005548 | Switchgrass Rhizosphere | LRRVRELERAVDAVVVGQRERLVPELRRARRQLLRQRGAVQERIR* |
| Ga0070704_1002313711 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGELERAADGVVVGERKRLVAEVGGAGGELVGQRGAVEERVR* |
| Ga0070704_1008549552 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RELERAVDAVVVGERERLVAELGAARGQFLRPRGAVEKRIG* |
| Ga0066695_108705832 | 3300005553 | Soil | RELERAVDAVVVGERERLVAELCRPRGQLLGQRRPVEE* |
| Ga0066695_108988431 | 3300005553 | Soil | KLERAVDPVVVGQRERAVAELGRADRELLRQRSAVEERIG* |
| Ga0066699_103785131 | 3300005561 | Soil | HAERLRRVRELERAVDAVVVGERKRFVPELRRPRGELLRLRRAVEERIR* |
| Ga0066708_100463794 | 3300005576 | Soil | LRRMRELERAVEPVVVGEGERLIAELCRPRGQLLGERGAVQERIR* |
| Ga0068857_1006118342 | 3300005577 | Corn Rhizosphere | LERAADGVVVGERERLVAEVGGARGELVGQRGAVEERVR* |
| Ga0066654_105957472 | 3300005587 | Soil | RELERAVEPVVVGEGERLIAELCRPRGQLLGERGAVQERIR* |
| Ga0068856_1006199133 | 3300005614 | Corn Rhizosphere | VRELERAVEPVVVGERERLVPQLGRLGRELFGQRGAVQERIG* |
| Ga0068866_107585231 | 3300005718 | Miscanthus Rhizosphere | GELERAADGVVVGERERLVAEVGGARGELVGQRGAVEERVR* |
| Ga0066656_100581306 | 3300006034 | Soil | RELERAVDPVVVGQRERAVAELGRPERELFGQRGAVQERIG* |
| Ga0066656_109811482 | 3300006034 | Soil | LRRMRELERAVDAVVVRERESLVPELRSPRGELLRLRRSVEERIG* |
| Ga0075432_100064354 | 3300006058 | Populus Rhizosphere | MRELERAVDAVVISERERVVAELRRVRRELLRQRRAVEERIG* |
| Ga0070712_1016124661 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVLRGVRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0068871_1009517432 | 3300006358 | Miscanthus Rhizosphere | RELERAVDAVVVGQRQRTVAELRGPNRELLRQRSAVQERIG* |
| Ga0074049_127074711 | 3300006580 | Soil | VRELERAVHPVVVGQRKRLVPELGRPCRELLGLRGAVQERIG* |
| Ga0074062_119183071 | 3300006606 | Soil | VDPVVVGQRERLVTQLGRASRQLLRQRRAVEERIG* |
| Ga0066665_111109261 | 3300006796 | Soil | VGELERAVDPVVIGQRERVVAELGGPCGQLFGLGGSIEERVG* |
| Ga0075431_1000679332 | 3300006847 | Populus Rhizosphere | MRELERAVDAVVISERERVVAELRRVRRELLRQRRAVEDE* |
| Ga0075431_1021704512 | 3300006847 | Populus Rhizosphere | RELERAADAVVVGERQGVVTEVGGTGGELLGLRSPVEERVR* |
| Ga0075425_1030053181 | 3300006854 | Populus Rhizosphere | PHAERLRRVRELERAVDAVVVGQRERVVAELGRASRELLRQRGAVQERIG* |
| Ga0079217_100597415 | 3300006876 | Agricultural Soil | AEVLRRVRELERAVDTVVVCERERLVAELGRPQGELLGMGGAVEERIR* |
| Ga0075436_1001540274 | 3300006914 | Populus Rhizosphere | VDAVVVGQRERAVTELGGANRKVLRQRGAVQERIG* |
| Ga0066710_1006370182 | 3300009012 | Grasslands Soil | MRELERAVDAVVVGERERLVAELRRPRGQLLGQRRPVEE |
| Ga0066709_1015703091 | 3300009137 | Grasslands Soil | LERAVDAVVVCERERFVAELCRPRGQLLGQRCPVEERIG* |
| Ga0105242_118517491 | 3300009176 | Miscanthus Rhizosphere | LERAVDPVVVGQRQRLVPELRRPRRQLLGQRRAVEERIG* |
| Ga0105249_108153132 | 3300009553 | Switchgrass Rhizosphere | MRELERAVDAVVISERERVVAELRRVRSELLRQRRAVEERIG* |
| Ga0126305_109263322 | 3300010036 | Serpentine Soil | ELERAVDAVVVGERERLVAELGGAEGELLRQRGAVEERIR* |
| Ga0134086_103672342 | 3300010323 | Grasslands Soil | ELERAIEPVVVGEGERLVAQLCRPRGELLGERGAVEERIR* |
| Ga0126372_100923552 | 3300010360 | Tropical Forest Soil | MCELERAVDAVVVGERERLVAELGRARGELLGQRRAVEERIR* |
| Ga0134128_105711202 | 3300010373 | Terrestrial Soil | MRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR* |
| Ga0126383_112633802 | 3300010398 | Tropical Forest Soil | VGELQRTVDAVVVGERERLVAELGSARGQLLRQRRAVEERIR* |
| Ga0105246_124550721 | 3300011119 | Miscanthus Rhizosphere | DAVVVGQRQRTVAELRGPNRELLRQRSAVQERIG* |
| Ga0120167_10773632 | 3300012001 | Permafrost | VIEPHADRLRRVRELERAAHPVVIGERERVVAELGGRERQFLGMRCAVEERIG* |
| Ga0120159_10035524 | 3300012014 | Permafrost | VRELERAAHPVVIGERERVVAELGGRERQFLGMRCAVEERIG* |
| Ga0136623_100705651 | 3300012045 | Polar Desert Sand | PEVLRRVRELERAVDTVVVGERERLVAELGCAQRELLRVRGTVEERIR* |
| Ga0137367_102768922 | 3300012353 | Vadose Zone Soil | MHAERLRRVRELERAVDTVVVGERERCVAELGRADDQFFRERSAVQKRIG* |
| Ga0157339_10504982 | 3300012505 | Arabidopsis Rhizosphere | ELERAVDAVVVGQRQGPIAQLGSAGGKLLRQRGAVQERIG* |
| Ga0157308_103835802 | 3300012910 | Soil | VRELERAVDAVVVGERERLVAKLGRSRRELLGQRGAVEERIG* |
| Ga0164301_102640542 | 3300012960 | Soil | MRELERAVDAVVIGQRQRLVAELGRPRRELLRQRGAVEERIR* |
| Ga0164309_107885101 | 3300012984 | Soil | PVDAVVVGERECLVAELGGARGELLGLRGAVEERVG* |
| Ga0164308_104920971 | 3300012985 | Soil | VRELQRAVDAVVIGQRERLVAELGRSCRQLLRQRGAVEERIG* |
| Ga0157377_107637022 | 3300014745 | Miscanthus Rhizosphere | ERLGCMGELERAADGVVVGERERLVAEVGGARGELVGQRGAVEERVR* |
| Ga0134069_10265261 | 3300017654 | Grasslands Soil | RLGKLERAVDPVVVGQRERAVAKLGRADRELLWQRSAVEERIG |
| Ga0180121_103778613 | 3300017695 | Polar Desert Sand | RADADELRGVRELERAVDAVVVGERERLVAELRRTQRQLLGVRGAVKERIG |
| Ga0163161_109849931 | 3300017792 | Switchgrass Rhizosphere | RLRELERTVDPVVVGQRKRAVAELGGPNRQLLRQRSAVEKRIG |
| Ga0184605_103619753 | 3300018027 | Groundwater Sediment | RELERAVDAVVVGQRKRLVAEISRAGGELFRVRSAVQERIG |
| Ga0184623_102049772 | 3300018056 | Groundwater Sediment | AERLRRMGELERAVDAVVVGERERFVAEFSGPCGELLGLRGPVEERVG |
| Ga0066655_101058501 | 3300018431 | Grasslands Soil | LSRLRELERAVDSVVVGQRERAVAELGRPERELFGQRGAVQERIG |
| Ga0190274_123320141 | 3300018476 | Soil | ELRRVGELERAVDAVVVGEREGLVAELRRPQSELLGMRSAVEERIG |
| Ga0210382_102903361 | 3300021080 | Groundwater Sediment | ERLRRVRELERAVNPVVVGQRERLVAEISRAGGELFRVRSAVQERIG |
| Ga0182009_102591582 | 3300021445 | Soil | VRELQRAVDAVVVGERERLVAELRRAGREFLGERRTVEERIR |
| Ga0222621_11147091 | 3300021510 | Groundwater Sediment | LERSVHTVVIRERERLVAELGRAGRELLGVRGPVEERIG |
| Ga0247687_10557571 | 3300024286 | Soil | RLGRVGELERAADAVVVGERQCRIPEIGGPRTELVGRRGTVEERIR |
| Ga0209641_104842212 | 3300025322 | Soil | VRELERAVDAVVVGERERLVPELGRARGELFRLRRPVQE |
| Ga0207660_101830071 | 3300025917 | Corn Rhizosphere | ELERAVDPVVVGQRQRLVPELRRPRRQLLGQRRAVEERIG |
| Ga0207659_118553052 | 3300025926 | Miscanthus Rhizosphere | AEGFGRMRELERAVDAVVISERERVVAELRRVRRELLRQRRAVEERIG |
| Ga0207709_104833392 | 3300025935 | Miscanthus Rhizosphere | MGELERAADGVVVGERKRLVAEVGGAGGELVGQRGAVEERIR |
| Ga0207669_105240241 | 3300025937 | Miscanthus Rhizosphere | RSVRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR |
| Ga0207661_106480532 | 3300025944 | Corn Rhizosphere | MRELERAVDPLVVGQRQRLVTELGRPRRQFLRQRGAVEEGIG |
| Ga0207679_105491452 | 3300025945 | Corn Rhizosphere | VGELERAVDAVVVGERERVVAELGGPRGELLGQRGAVEERIG |
| Ga0207658_108653631 | 3300025986 | Switchgrass Rhizosphere | ERLRSVRELERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR |
| Ga0207677_112487311 | 3300026023 | Miscanthus Rhizosphere | VEPVVVGERERLVPQFGRLGRELFGQRGAVQERIG |
| Ga0207639_103387891 | 3300026041 | Corn Rhizosphere | ERLRSMRKLERAVDAVVVGQRERLVAELGRACRQLLRQRSAVQERIR |
| Ga0207702_100156883 | 3300026078 | Corn Rhizosphere | VRELQRAVDAVVVGERERLVAELRRAGREFLGQRRTVEERIR |
| Ga0207702_101084675 | 3300026078 | Corn Rhizosphere | VGELERAADGVVVGERERLVAEVGGARGELVGQRGAVEERVR |
| Ga0207702_102478741 | 3300026078 | Corn Rhizosphere | ERAVDPVVVGQRQRLIPELGRPRRQFLRQRGAVEEGIG |
| Ga0207675_1002151744 | 3300026118 | Switchgrass Rhizosphere | MRELERAVDAVVISERERVVAELRRVRRELLRQRRAVEERIG |
| Ga0209239_11138243 | 3300026310 | Grasslands Soil | RASDRPDADRLRHMRELERAVDAVVVGERERFVAELCRPRGQLLGQRCPVEERIG |
| Ga0209473_12349342 | 3300026330 | Soil | GELQRAVDAVMVGQRKRAVAELGSPNRKLLGQRGAVEERIG |
| Ga0268266_105754621 | 3300028379 | Switchgrass Rhizosphere | ERLRRVRELERAVDAVVVGQRERLVPELRRARRQLLRQRGAVQERIR |
| Ga0247821_103102971 | 3300028596 | Soil | AQPERLRRVSELERPVKAVVVGERERLVAELGGARGELLGLRSAVEERVG |
| Ga0307276_101042132 | 3300028705 | Soil | LRELERAVDAVVVGQRECAVAELGGPKRDLLGQRSTVEKRIG |
| Ga0307306_100569791 | 3300028782 | Soil | ARDRPHAERLRRMRELERAVDAVVVGQRERLVAELSRARRQLFRQRGAVQKRIR |
| Ga0307282_105668602 | 3300028784 | Soil | AERLRCVRELERAVEPVVVGERKRLVAELGRLGRELFGQRGAVQERIG |
| Ga0307287_100567564 | 3300028796 | Soil | RLRELERAVDPVVVGQRKRAVAELGGADRELLRQRSAVEERIG |
| Ga0307305_102430682 | 3300028807 | Soil | AVDAVVVGERERLVAEVGGPRGELLGLRGAVEERIR |
| Ga0307305_103637101 | 3300028807 | Soil | GAGDRADAERLRGVRELERAVDPVVIRQRQRLVAELRRPRGEILGQRSAVEERIR |
| Ga0307312_102229853 | 3300028828 | Soil | ELERAVDPVVIGQRQRLVAELRSPRGELLGQRGAVEERIR |
| Ga0307289_103373591 | 3300028875 | Soil | ELERAVDAVVVGERERLVAEVGGPRGELLGLRGAVEERIR |
| Ga0307308_102103714 | 3300028884 | Soil | RSFPPIDAVVVGERERLVSKLGRAGRELLRVGSSVEERIG |
| Ga0307308_102344502 | 3300028884 | Soil | ERAVDAVVVGQRERPVAELGGPKREFLGQRSAVEKRIR |
| Ga0247826_103314913 | 3300030336 | Soil | DELGRVGELERAVDAVVVGECERLVAELRRALRELLRMGRPVEERIG |
| Ga0247826_106542691 | 3300030336 | Soil | VDAVVIGERKRLVAELRRARRELLGMRCPVEEGIG |
| Ga0307500_101057332 | 3300031198 | Soil | VDAVVVGEREPFVAEVGGPRGELLGLRGAVEERIR |
| Ga0307470_102032364 | 3300032174 | Hardwood Forest Soil | RELERAVDAVVISERERVVAELRRVRRELLRQRRAVEERIG |
| Ga0310889_105685952 | 3300032179 | Soil | HAERLGRVRELQRAVDAVVVGERERRVTELGGPCGKLLGQRGAVEERIG |
| Ga0247830_102290391 | 3300033551 | Soil | PGRVRELERAVDAVVVGQRERQSSATRRSRRQLLGERRSVEERIG |
| ⦗Top⦘ |