| Basic Information | |
|---|---|
| Family ID | F069122 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGNEDSYVALGLKVWKAQIDRADKLFGGLSSEEVLREIAPG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.77 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.129 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.548 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02826 | 2-Hacid_dh_C | 24.19 |
| PF12680 | SnoaL_2 | 18.55 |
| PF02321 | OEP | 7.26 |
| PF13561 | adh_short_C2 | 3.23 |
| PF02082 | Rrf2 | 3.23 |
| PF07883 | Cupin_2 | 2.42 |
| PF12697 | Abhydrolase_6 | 2.42 |
| PF00753 | Lactamase_B | 2.42 |
| PF00106 | adh_short | 1.61 |
| PF07366 | SnoaL | 1.61 |
| PF00313 | CSD | 0.81 |
| PF05368 | NmrA | 0.81 |
| PF02852 | Pyr_redox_dim | 0.81 |
| PF02954 | HTH_8 | 0.81 |
| PF08447 | PAS_3 | 0.81 |
| PF13602 | ADH_zinc_N_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 14.52 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 3.23 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 3.23 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 3.23 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 3.23 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 3.23 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 3.23 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 3.23 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 3.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.13 % |
| Unclassified | root | N/A | 8.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02G9AK5 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300001545|JGI12630J15595_10059414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6 | 758 | Open in IMG/M |
| 3300001593|JGI12635J15846_10233034 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100008947 | All Organisms → cellular organisms → Bacteria | 8029 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100961870 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005333|Ga0070677_10418664 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005347|Ga0070668_102242081 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005440|Ga0070705_100716622 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005456|Ga0070678_101700339 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005467|Ga0070706_100587277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1035 | Open in IMG/M |
| 3300005467|Ga0070706_101065434 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005468|Ga0070707_101932137 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005538|Ga0070731_10632923 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005541|Ga0070733_10278773 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300005552|Ga0066701_10357395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 904 | Open in IMG/M |
| 3300005575|Ga0066702_10784595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 567 | Open in IMG/M |
| 3300005843|Ga0068860_100053232 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
| 3300006175|Ga0070712_101954428 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006358|Ga0068871_101580307 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006796|Ga0066665_10299892 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300006852|Ga0075433_11862208 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006854|Ga0075425_103037857 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006871|Ga0075434_100998228 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300007076|Ga0075435_101332265 | Not Available | 629 | Open in IMG/M |
| 3300007076|Ga0075435_101352992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300007076|Ga0075435_101427639 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300007265|Ga0099794_10557215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 605 | Open in IMG/M |
| 3300007788|Ga0099795_10096775 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300009088|Ga0099830_10987886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 697 | Open in IMG/M |
| 3300009089|Ga0099828_10486294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. OK233 | 1113 | Open in IMG/M |
| 3300009156|Ga0111538_12525509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 644 | Open in IMG/M |
| 3300009156|Ga0111538_12662465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 627 | Open in IMG/M |
| 3300010304|Ga0134088_10139384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1151 | Open in IMG/M |
| 3300010343|Ga0074044_10162653 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300010400|Ga0134122_11613192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 673 | Open in IMG/M |
| 3300010403|Ga0134123_10586471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1068 | Open in IMG/M |
| 3300011269|Ga0137392_10801821 | Not Available | 778 | Open in IMG/M |
| 3300011270|Ga0137391_10502372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1026 | Open in IMG/M |
| 3300011270|Ga0137391_10967585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300012096|Ga0137389_10560928 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300012203|Ga0137399_10243473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1473 | Open in IMG/M |
| 3300012401|Ga0134055_1177639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 773 | Open in IMG/M |
| 3300012582|Ga0137358_10129898 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300012683|Ga0137398_10030654 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
| 3300012683|Ga0137398_10469964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 862 | Open in IMG/M |
| 3300012685|Ga0137397_11184076 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012917|Ga0137395_10230943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300012918|Ga0137396_10647416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6 | 781 | Open in IMG/M |
| 3300012922|Ga0137394_10122091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2206 | Open in IMG/M |
| 3300012923|Ga0137359_11121849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 672 | Open in IMG/M |
| 3300012924|Ga0137413_10047044 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300012924|Ga0137413_10277502 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012924|Ga0137413_11043992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. 23TSA30-6 | 643 | Open in IMG/M |
| 3300012929|Ga0137404_10772855 | Not Available | 872 | Open in IMG/M |
| 3300012930|Ga0137407_10483149 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300013296|Ga0157374_11558463 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300015054|Ga0137420_1154558 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300018013|Ga0187873_1309347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300019885|Ga0193747_1048073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1061 | Open in IMG/M |
| 3300019887|Ga0193729_1204104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 670 | Open in IMG/M |
| 3300020199|Ga0179592_10085407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
| 3300020580|Ga0210403_11500414 | Not Available | 507 | Open in IMG/M |
| 3300020581|Ga0210399_11484833 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300020583|Ga0210401_11222933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 609 | Open in IMG/M |
| 3300021088|Ga0210404_10517137 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021168|Ga0210406_10857039 | Not Available | 687 | Open in IMG/M |
| 3300021171|Ga0210405_10583401 | Not Available | 871 | Open in IMG/M |
| 3300021178|Ga0210408_10501715 | Not Available | 964 | Open in IMG/M |
| 3300021178|Ga0210408_10677229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 813 | Open in IMG/M |
| 3300021363|Ga0193699_10470241 | Not Available | 516 | Open in IMG/M |
| 3300021405|Ga0210387_10607763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300021406|Ga0210386_10969432 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300021420|Ga0210394_11302328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 621 | Open in IMG/M |
| 3300021420|Ga0210394_11713715 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021474|Ga0210390_11304745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 582 | Open in IMG/M |
| 3300021479|Ga0210410_10442742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300021479|Ga0210410_10820694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 815 | Open in IMG/M |
| 3300021479|Ga0210410_10934020 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300022533|Ga0242662_10323183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 520 | Open in IMG/M |
| 3300024288|Ga0179589_10343320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 677 | Open in IMG/M |
| 3300024330|Ga0137417_1492408 | Not Available | 1276 | Open in IMG/M |
| 3300025477|Ga0208192_1071800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300025926|Ga0207659_10356242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1215 | Open in IMG/M |
| 3300026035|Ga0207703_10333025 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300026118|Ga0207675_101765167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 638 | Open in IMG/M |
| 3300026285|Ga0209438_1098087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 894 | Open in IMG/M |
| 3300026304|Ga0209240_1130556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300026319|Ga0209647_1098698 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300026319|Ga0209647_1157747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 938 | Open in IMG/M |
| 3300026469|Ga0257169_1046743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300026508|Ga0257161_1131407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026515|Ga0257158_1124407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300026532|Ga0209160_1277009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300026557|Ga0179587_10027521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3126 | Open in IMG/M |
| 3300026557|Ga0179587_10483597 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300027537|Ga0209419_1063962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300027587|Ga0209220_1154145 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300027610|Ga0209528_1150050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 509 | Open in IMG/M |
| 3300027643|Ga0209076_1032331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300027671|Ga0209588_1091489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300027729|Ga0209248_10050177 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300027862|Ga0209701_10721427 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027875|Ga0209283_10562679 | Not Available | 727 | Open in IMG/M |
| 3300027889|Ga0209380_10061400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2138 | Open in IMG/M |
| 3300028587|Ga0247828_10548891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 696 | Open in IMG/M |
| 3300028784|Ga0307282_10135672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1160 | Open in IMG/M |
| 3300028906|Ga0308309_10475930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300028906|Ga0308309_11044441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300029636|Ga0222749_10411485 | Not Available | 718 | Open in IMG/M |
| 3300029636|Ga0222749_10594544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300031057|Ga0170834_111702647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031057|Ga0170834_111847351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1156 | Open in IMG/M |
| 3300031446|Ga0170820_14550939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 552 | Open in IMG/M |
| 3300031718|Ga0307474_10954164 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031820|Ga0307473_10225472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300031823|Ga0307478_11012631 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031892|Ga0310893_10564361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 517 | Open in IMG/M |
| 3300031940|Ga0310901_10218571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 768 | Open in IMG/M |
| 3300031954|Ga0306926_12264460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031962|Ga0307479_10111293 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
| 3300032174|Ga0307470_10209907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | 1252 | Open in IMG/M |
| 3300032174|Ga0307470_10779038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300032180|Ga0307471_101995735 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300032205|Ga0307472_101693349 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11928240 | 2170459005 | Grass Soil | MENEGSYVALGLKVWKTQIERADKLFGSLLSEDVLREIAP |
| JGI12630J15595_100594141 | 3300001545 | Forest Soil | MGNEGSYVALGLKVWKAQIERADKLFRSLSSDDVLREIAPG |
| JGI12635J15846_102330341 | 3300001593 | Forest Soil | MGNEDSCVAVGLKVRKSQIDRVDKLFGTLSSDEVLREIAPGRNRL |
| JGIcombinedJ26739_10000894710 | 3300002245 | Forest Soil | MKMEMGNEGSCIALTLKVWKAQIERADKLSGSLSSEEVLREIK* |
| JGIcombinedJ26739_1009618703 | 3300002245 | Forest Soil | MENQGSYVALGLKVWKAQIERADKLFEGLSSEDLLREIAPGR |
| Ga0070677_104186641 | 3300005333 | Miscanthus Rhizosphere | MANDLPCVALALKAWKTQIDRADKLFGALSSEEVLREIAPGR |
| Ga0070668_1022420811 | 3300005347 | Switchgrass Rhizosphere | MGNDPSCVALGLKGWKTQIDRADKLFGSLSSEEVLREIAPGR |
| Ga0070705_1007166221 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MANEGTYVALGLKVWKAQIERADKLFGSLSSEEVLREIAP |
| Ga0070678_1017003391 | 3300005456 | Miscanthus Rhizosphere | MADDLPFVALALKSWKTQVDRAEKLFGALSSDELLREIAPGRN |
| Ga0070706_1005872771 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MENEGSYVALGLKVWKTQIGRADKLFGSLSSENVLGEIAPG |
| Ga0070706_1010654342 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREIAPGRN |
| Ga0070707_1019321371 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVEGDGDMGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREI |
| Ga0070731_106329231 | 3300005538 | Surface Soil | MGNDDAYVSLGLKVWKAQIERADKLFGGLSPEEVLREIAPGRN |
| Ga0070733_102787732 | 3300005541 | Surface Soil | MGNEGSYVALGLKAWKAQIGRADTLFGALSSEQVLREIAPDRNR |
| Ga0066701_103573951 | 3300005552 | Soil | MTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREIA |
| Ga0066702_107845952 | 3300005575 | Soil | MGNEGSYVALGLKVWKAQIDRADKLFGSPSSEEVLREIAPGRN |
| Ga0068860_1000532321 | 3300005843 | Switchgrass Rhizosphere | MGNEGSYVALALKTWTAQIDRADKLFGRLSSEEVLREIAPGRN |
| Ga0070712_1019544281 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREIAPG |
| Ga0068871_1015803071 | 3300006358 | Miscanthus Rhizosphere | MGNEGTHVALGLKAWKAQIERADKLFGTLSSEEVLGEIAPGRNR |
| Ga0066665_102998923 | 3300006796 | Soil | MANEGSYVALALRVWKAQIERADKLFGGLSSEEVLREI |
| Ga0075433_118622082 | 3300006852 | Populus Rhizosphere | MENEGSCVALGLKAWKTQIDRADKLFGALSSEDVLREIA |
| Ga0075425_1030378572 | 3300006854 | Populus Rhizosphere | MGNEGTYVALGLKVWKAQIERADKLFGSLSSEEVLRE |
| Ga0075434_1009982281 | 3300006871 | Populus Rhizosphere | MGNEFSYVALGLKTWNAQIDRADKLFGDLSSEEVLR |
| Ga0075435_1013322651 | 3300007076 | Populus Rhizosphere | MGNDLSCEALGLKVWKNQIDRADKLFGSLSSEEVLREI |
| Ga0075435_1013529921 | 3300007076 | Populus Rhizosphere | MANEGSYVALALKVWKAQIERADKLFGGLSSEEVLRE |
| Ga0075435_1014276392 | 3300007076 | Populus Rhizosphere | MENEGSCVALGLRAWKTQIDRADKLFGALSSEEVLREIAPGRN |
| Ga0099794_105572151 | 3300007265 | Vadose Zone Soil | MGNDSSFAALGLKAWKTQIDRADKLFGALSSEQVLREIAP |
| Ga0099795_100967753 | 3300007788 | Vadose Zone Soil | MGNEGSYVALGLKTWNAQIDRADKLFAGLSSEEIL |
| Ga0099830_109878861 | 3300009088 | Vadose Zone Soil | MGTDDAYIALGLKVWKAQIERADKLFGSLSSEEVQREIAPG |
| Ga0099828_104862943 | 3300009089 | Vadose Zone Soil | MGNDGACVALGLKVWKTQIDRADKLFGTLSSEEVLREIAPG |
| Ga0111538_125255092 | 3300009156 | Populus Rhizosphere | MADDLPFVALALKSWKTQVDRAEKLFGALSSEEVLREIAPGR |
| Ga0111538_126624651 | 3300009156 | Populus Rhizosphere | MADDLPFVALALKSWKTQVDRAEKLFGALSSDELLREIAP |
| Ga0134088_101393841 | 3300010304 | Grasslands Soil | MGNEDSCVALGLKVWKAQLERADKLFGSLSSDDVLREIAP |
| Ga0074044_101626534 | 3300010343 | Bog Forest Soil | MGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREI |
| Ga0134122_116131922 | 3300010400 | Terrestrial Soil | MGNEGSCVAIGLKAWKTQIDQADKLFGTLSSEEVLGEIA |
| Ga0134123_105864711 | 3300010403 | Terrestrial Soil | MADDLPFVALALKSWKTQVDRAEKLFGALSSDELLRE |
| Ga0137392_108018213 | 3300011269 | Vadose Zone Soil | MGNDGWVALGLKAWKTQIDRADRLFGTLSSEDVLREIAPGR |
| Ga0137391_105023723 | 3300011270 | Vadose Zone Soil | MRGDGAMTNEGSYVALGLKVWKAQLDRADKLFGGLSSEE |
| Ga0137391_109675852 | 3300011270 | Vadose Zone Soil | MTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREI |
| Ga0137389_105609283 | 3300012096 | Vadose Zone Soil | MRGDGTMANEGSYVALGLKVWKAQLERADKLFGGLSSEEVL |
| Ga0137399_102434731 | 3300012203 | Vadose Zone Soil | MRNEGSCVALGLKAWKTQIDRADKFFGTLSSEEVM |
| Ga0134055_11776391 | 3300012401 | Grasslands Soil | VVDRSWFMGNEGSYVALGLKAWKAQIERADKLFGSLSSEEVLREIAP |
| Ga0137358_101298982 | 3300012582 | Vadose Zone Soil | MANDPSLAALGLNPWTTQIDRAATLSGSLSSEEVLREIAPG |
| Ga0137398_100306541 | 3300012683 | Vadose Zone Soil | MGNEGSYVALGLKTWNAQIDLADKLFGGLSSDEILREI |
| Ga0137398_104699641 | 3300012683 | Vadose Zone Soil | MTNDPSFAALGLKAWKTQIDRADKLFGSLSSEEVLREIAPGRN |
| Ga0137397_111840762 | 3300012685 | Vadose Zone Soil | MGNEGTYVALGLKVWKAQIERADKLFGSLSSGEVLREIAPG |
| Ga0137395_102309433 | 3300012917 | Vadose Zone Soil | MENEGSYVALGLKVWKTQIGRADKLFGSLSSEDVLREI |
| Ga0137396_106474161 | 3300012918 | Vadose Zone Soil | MGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVL |
| Ga0137394_101220914 | 3300012922 | Vadose Zone Soil | VVDRRWSMGNDPSCVALGLKAWKTQIDRADKLFGSLSSEEVL |
| Ga0137359_111218492 | 3300012923 | Vadose Zone Soil | VGNEGSYVALGLKAWKTQIERADKLFGNLSPEGALREIAPGRNR |
| Ga0137413_100470445 | 3300012924 | Vadose Zone Soil | MGNEGSYVTLGLKTWNAQIDRADKLFGGLSSEEILREIAPG |
| Ga0137413_102775022 | 3300012924 | Vadose Zone Soil | MGTDGASLGLKVWKAQIERAEKLFGSLSSEEVQREIAPGRNRLLY |
| Ga0137413_110439921 | 3300012924 | Vadose Zone Soil | MGNEGSYVALGLKIWKAQIDRADKLFGSLSSEEVQHEI |
| Ga0137404_107728551 | 3300012929 | Vadose Zone Soil | VANEDSYVALGLKAWRAQIERADKLFGSLSSEEVLREIAPGR |
| Ga0137407_104831493 | 3300012930 | Vadose Zone Soil | MGNEVSYVALGLKTWNAQIDRADKLFGGLSSEEILREIA |
| Ga0157374_115584631 | 3300013296 | Miscanthus Rhizosphere | MGNEGSYVALGLKAWKAQIDRVDTLFGALSSEQVLREIAPDRNRLLYLW |
| Ga0137420_11545581 | 3300015054 | Vadose Zone Soil | MGNEVTYVALGLKTWNAQIDRADKLFGGLSSEEILR |
| Ga0187873_13093471 | 3300018013 | Peatland | MGNEASYTTLGLKAWKAQVDRADKLFGTLSSEQVLQQIAPGRN |
| Ga0193747_10480731 | 3300019885 | Soil | MGNEGSYAALGLKAWKTQIDRADKLFENLSSEEVLREI |
| Ga0193729_12041041 | 3300019887 | Soil | MANDPSFVALGLKSWKTQIDRADKLLGGFSSEEILREI |
| Ga0179592_100854073 | 3300020199 | Vadose Zone Soil | MTNEGSYVAVGLKMWKTQIGRADKLFGSLSFEDVLREIAPGRN |
| Ga0210403_115004142 | 3300020580 | Soil | MGNEDSYVALGLKVWKAQIDRADKLFGSLSSEDLLREIAPGR |
| Ga0210399_114848331 | 3300020581 | Soil | MGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVLREI |
| Ga0210401_112229332 | 3300020583 | Soil | MGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREI |
| Ga0210404_105171371 | 3300021088 | Soil | MGNEFSYVALGLKTWNAQINRADKLFGGLSSEEILREI |
| Ga0210406_108570391 | 3300021168 | Soil | MKMEMGNEGSCIALTLKVWKAQIERADKLSGSLSSEEVLREIK |
| Ga0210405_105834013 | 3300021171 | Soil | MGNEGSYVALGLKTWNAQIDRADKLFGGFSPEELLREIAPG |
| Ga0210408_105017153 | 3300021178 | Soil | STNIALTLKVWKAQIERADKLFGSLSSEEVLREIK |
| Ga0210408_106772293 | 3300021178 | Soil | MGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREIAP |
| Ga0193699_104702411 | 3300021363 | Soil | MGNDPSCVALGLRGWKTQVDRADKLFGSLSSEDVLREIAL |
| Ga0210387_106077633 | 3300021405 | Soil | MGNEGSYTALGLKVWKAQVDRADKLFGTLSSEQILQEIAPGR |
| Ga0210386_109694321 | 3300021406 | Soil | MGNDDAYVSLGLKVWKAQIERADKLFGGLTSEEVLREIAPARNR |
| Ga0210394_113023281 | 3300021420 | Soil | MGNDDAYVSLGLKVWKAQIERADKLFGGLSSEEVLREIA |
| Ga0210394_117137151 | 3300021420 | Soil | MGNEGSYIALGLKVWKTQIDRADKVFGGLSSEEVLREIAPGR |
| Ga0210390_113047451 | 3300021474 | Soil | MGNDDAYVSLGLKVWKAQIERADKLFGGLTSEEVLREIA |
| Ga0210410_104427423 | 3300021479 | Soil | MANEGSYVALALKVWKTQVDRADKLFGGLSSEEVLREIA |
| Ga0210410_108206943 | 3300021479 | Soil | MGNEGSYVALGLKTWNAQIDRADKLFGGLSSEEILREIAPGR |
| Ga0210410_109340201 | 3300021479 | Soil | MGNDDAYVSLGLKVWKAQIERADKLFGGLSSEEVLREIAPGRN |
| Ga0242662_103231831 | 3300022533 | Soil | MANEGSYVALGLKVWKAQIERADKLFGSLSSEEIL |
| Ga0179589_103433202 | 3300024288 | Vadose Zone Soil | MGTDGAYVALGLEVWKAQIERAEKLFGSLSSEEVQR |
| Ga0137417_14924081 | 3300024330 | Vadose Zone Soil | MANDPSCVALALKVWKTQIDRADKLFGSLSSEEVLRK |
| Ga0208192_10718002 | 3300025477 | Peatland | MGNEGSYTALGLKVWKAQVDRADKLFGTLSSEQILQEIAPGRN |
| Ga0207659_103562421 | 3300025926 | Miscanthus Rhizosphere | MGTDPSCVALALKAWKTQIDRAGKLFGALSSEEVLREIAPGRNLSLMS |
| Ga0207703_103330251 | 3300026035 | Switchgrass Rhizosphere | MGNEGSYVALGLKTWNTQIDRADKLFGGLSSEEILREIAPGR |
| Ga0207675_1017651671 | 3300026118 | Switchgrass Rhizosphere | MGTDPSCVALALKAWKTQIDLTDTLFGALSSEEVLREIAPERR |
| Ga0209438_10980872 | 3300026285 | Grasslands Soil | MGNDPSCVALALKAWKTQIDRADKLFGSLSSEEVLRE |
| Ga0209240_11305563 | 3300026304 | Grasslands Soil | MENEGSYVALGLKMWKTQIGRADKLFGSLSFEDVLREIA |
| Ga0209647_10986983 | 3300026319 | Grasslands Soil | MANEGSYVALGLKVWKAQIERADKLFGGFSSEEVVREIAP |
| Ga0209647_11577471 | 3300026319 | Grasslands Soil | MGNDGSCVALGLKAWKTQIDRADKLFGSLSSEEVLREIAP |
| Ga0257169_10467431 | 3300026469 | Soil | MANEGSYVALALKVWKAQIERADKLFGGLSSEEVLREIAP |
| Ga0257161_11314072 | 3300026508 | Soil | MENQGSYVALGLNVWKTQIGRADKLFGSLSLKDVLRE |
| Ga0257158_11244072 | 3300026515 | Soil | MENESPYVAVGLKVWKAQIERADKVFGSLSPEDVQREIGP |
| Ga0209160_12770091 | 3300026532 | Soil | MANEGSYVALALKVWKAQIERADKLFGGLSSDEALREIAPGRN |
| Ga0179587_100275213 | 3300026557 | Vadose Zone Soil | MENEGSYVALGLKMWKTQIGRADKLFGSLSFEDVLREIAPGR |
| Ga0179587_104835971 | 3300026557 | Vadose Zone Soil | MGNEGSYVALGLKTWNAQIDRADKLFAGLSSEEILREIAPG |
| Ga0209419_10639621 | 3300027537 | Forest Soil | MGNEGSYAALGLKVWKAQVDRADKLFGTLSSEQVLQEIAPGRN |
| Ga0209220_11541451 | 3300027587 | Forest Soil | MGNEGSYVALGLKVWRAQIERAGKLFGGLSSEEVLREIAPG |
| Ga0209528_11500501 | 3300027610 | Forest Soil | VENQGSYVALGLKVWKAQIERADKLFGGLLSEDLLREIAPG |
| Ga0209076_10323313 | 3300027643 | Vadose Zone Soil | MTNEGSYVAVGLKMWKTQIGRADKLFGSLSFEDVLREIAP |
| Ga0209588_10914893 | 3300027671 | Vadose Zone Soil | MTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLQEIAPG |
| Ga0209248_100501774 | 3300027729 | Bog Forest Soil | MENEGSYVALGLKTWNTQIDRADKLFGGFSSEEILREI |
| Ga0209701_107214272 | 3300027862 | Vadose Zone Soil | MGNESSCVALALKVWKIQIDRADKLFGALSSEEVLR |
| Ga0209283_105626792 | 3300027875 | Vadose Zone Soil | MGNDGACVALGLKAWKNQIDRADKLFGTLSSEEVL |
| Ga0209380_100614001 | 3300027889 | Soil | MEHDGACVALGLKAWKTQIDRADKLFGTLSSEEVLREIA |
| Ga0247828_105488912 | 3300028587 | Soil | MVDDLPCVALALKAWKTQIDRADKLFGALSSEEVLREI |
| Ga0307282_101356721 | 3300028784 | Soil | MGNDPSCVALGLKAWKTQIDRADKLFGSLSSEEVLREIAPG |
| Ga0308309_104759301 | 3300028906 | Soil | MEIEGSYIALGLKVWKTQIERADKLFGRLSSEEVLREIAPG |
| Ga0308309_110444411 | 3300028906 | Soil | MENEASYVALGLKVWKAQIERADKLFGSLSSEHVLREIA |
| Ga0222749_104114851 | 3300029636 | Soil | MGNEGSYVALGLKVWKAQIERADKLFGSLSSEEVLREIK |
| Ga0222749_105945441 | 3300029636 | Soil | MTNEGSYVALGLKAWKGQLDRADKLFGGLSSEEVL |
| Ga0170834_1117026472 | 3300031057 | Forest Soil | MANEGSYVALALKVWKTQIERADKLFAGLSSQEVLREIAPSR |
| Ga0170834_1118473513 | 3300031057 | Forest Soil | MRDKTMGNEGSYAALGLKVWKAQIERADKLFGGLS |
| Ga0170820_145509392 | 3300031446 | Forest Soil | MGNEGTYVALGLKTWNAQIDRADKLFGGFSSEEILREIAPGRN |
| Ga0307474_109541641 | 3300031718 | Hardwood Forest Soil | MANEGSYVALGLKVWKAQIDRADKLFATLSSEEVLREIAPD |
| Ga0307473_102254723 | 3300031820 | Hardwood Forest Soil | MTNEGSYVALGLKVWKAQLDRADKLFGGLSAEEVLRE |
| Ga0307478_110126313 | 3300031823 | Hardwood Forest Soil | MGNEGSYVALGLKAWNAQIDRADKLFGGLSSEEILREIAPGRN |
| Ga0310893_105643611 | 3300031892 | Soil | MADDLPFVALALKSWKTQVDRAEKLFAALSSEDVLREIAPG |
| Ga0310901_102185712 | 3300031940 | Soil | MGTDPSCVALALKAWKTQIDRADKLFGALSSEEVLREIA |
| Ga0306926_122644602 | 3300031954 | Soil | MTNEGSYVALGLKVWKAQLDRADKLFGGLSSEEVLREIAP |
| Ga0307479_101112936 | 3300031962 | Hardwood Forest Soil | MGNEGSFVALGLKTWNAQIDRADKLFGGLSSEEILLEI |
| Ga0307470_102099074 | 3300032174 | Hardwood Forest Soil | MGNEGSYVALGLKTWNAQIDRADKLFGGLSSDEILREIAPGRNR |
| Ga0307470_107790382 | 3300032174 | Hardwood Forest Soil | MGNEDSYVALGLKVWKAQIDRADKLFGGLSSEEVLREIAPG |
| Ga0307471_1019957351 | 3300032180 | Hardwood Forest Soil | MGNEGSYVALGLKVWNAQIDRADKLFGSLSSEEILREIAPG |
| Ga0307472_1016933492 | 3300032205 | Hardwood Forest Soil | MGNDLSCAALALKVWKTQIDRADKLFGALSSEEVLREIAPG |
| ⦗Top⦘ |