| Basic Information | |
|---|---|
| Family ID | F069099 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKKLCLILVALACLPALAAGQVVEEIIARVNNQIITRSEFDRSK |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.41 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 85.48 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.677 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.258 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07228 | SpoIIE | 84.68 |
| PF13485 | Peptidase_MA_2 | 3.23 |
| PF01327 | Pep_deformylase | 0.81 |
| PF00733 | Asn_synthase | 0.81 |
| PF00990 | GGDEF | 0.81 |
| PF01255 | Prenyltransf | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.81 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.68 % |
| Unclassified | root | N/A | 15.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10025772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3535 | Open in IMG/M |
| 3300000789|JGI1027J11758_12224073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
| 3300001471|JGI12712J15308_10203251 | Not Available | 521 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101676026 | Not Available | 534 | Open in IMG/M |
| 3300004092|Ga0062389_103213777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 612 | Open in IMG/M |
| 3300004092|Ga0062389_104277871 | Not Available | 537 | Open in IMG/M |
| 3300005434|Ga0070709_11260711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 595 | Open in IMG/M |
| 3300005435|Ga0070714_100891523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300005471|Ga0070698_101989325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300005529|Ga0070741_10410391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300005532|Ga0070739_10511122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300005542|Ga0070732_10015036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4309 | Open in IMG/M |
| 3300005558|Ga0066698_10657124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300005764|Ga0066903_100180985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3108 | Open in IMG/M |
| 3300006176|Ga0070765_100266584 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
| 3300006176|Ga0070765_101583794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 616 | Open in IMG/M |
| 3300006794|Ga0066658_10079991 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300006800|Ga0066660_11469358 | Not Available | 536 | Open in IMG/M |
| 3300006854|Ga0075425_100768025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300006893|Ga0073928_10305050 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300009038|Ga0099829_11272952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300009143|Ga0099792_11114871 | Not Available | 532 | Open in IMG/M |
| 3300009522|Ga0116218_1305510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 712 | Open in IMG/M |
| 3300009624|Ga0116105_1123784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300010358|Ga0126370_11555780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300012096|Ga0137389_10462922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300012189|Ga0137388_11159051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300012209|Ga0137379_10110653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2644 | Open in IMG/M |
| 3300012210|Ga0137378_10101534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2642 | Open in IMG/M |
| 3300012923|Ga0137359_11385121 | Not Available | 591 | Open in IMG/M |
| 3300012944|Ga0137410_10925235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300014164|Ga0181532_10496507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300015265|Ga0182005_1091073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300017927|Ga0187824_10038290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300017935|Ga0187848_10035020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2503 | Open in IMG/M |
| 3300017936|Ga0187821_10327228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300017961|Ga0187778_10856900 | Not Available | 622 | Open in IMG/M |
| 3300017974|Ga0187777_10500243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300017975|Ga0187782_11073012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 628 | Open in IMG/M |
| 3300017988|Ga0181520_10326574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300017994|Ga0187822_10107137 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018022|Ga0187864_10176106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300018062|Ga0187784_10208293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1595 | Open in IMG/M |
| 3300018085|Ga0187772_11294488 | Not Available | 539 | Open in IMG/M |
| 3300018090|Ga0187770_10306045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1237 | Open in IMG/M |
| 3300018090|Ga0187770_11762597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 507 | Open in IMG/M |
| 3300018468|Ga0066662_10707118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300018468|Ga0066662_11655424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300020199|Ga0179592_10171082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300020581|Ga0210399_10789831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300020581|Ga0210399_11051776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300021181|Ga0210388_10563310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021403|Ga0210397_10947052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021420|Ga0210394_10328611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300021420|Ga0210394_10637987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300021476|Ga0187846_10476462 | Not Available | 511 | Open in IMG/M |
| 3300021478|Ga0210402_10972287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300021479|Ga0210410_10452601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300021479|Ga0210410_10499653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300021479|Ga0210410_10749397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300021479|Ga0210410_11672540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 530 | Open in IMG/M |
| 3300021559|Ga0210409_10779215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300022522|Ga0242659_1120695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300022711|Ga0242674_1008220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300022730|Ga0224570_114908 | Not Available | 509 | Open in IMG/M |
| 3300024271|Ga0224564_1064974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300025414|Ga0208935_1041222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300025448|Ga0208037_1045169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300025906|Ga0207699_10534628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300025928|Ga0207700_10047642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3178 | Open in IMG/M |
| 3300025928|Ga0207700_10793346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300025939|Ga0207665_11311350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300026308|Ga0209265_1090078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300026331|Ga0209267_1272058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300026530|Ga0209807_1323103 | Not Available | 524 | Open in IMG/M |
| 3300026538|Ga0209056_10132824 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300027370|Ga0209010_1014455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1409 | Open in IMG/M |
| 3300027583|Ga0209527_1029239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300027641|Ga0208827_1216541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 503 | Open in IMG/M |
| 3300027676|Ga0209333_1017270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2070 | Open in IMG/M |
| 3300027745|Ga0209908_10001860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2596 | Open in IMG/M |
| 3300027745|Ga0209908_10032824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300027812|Ga0209656_10014562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4900 | Open in IMG/M |
| 3300027853|Ga0209274_10152151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
| 3300027855|Ga0209693_10228540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300027879|Ga0209169_10590454 | Not Available | 581 | Open in IMG/M |
| 3300027882|Ga0209590_10079285 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300027884|Ga0209275_10817806 | Not Available | 537 | Open in IMG/M |
| 3300027889|Ga0209380_10730692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027903|Ga0209488_10366423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300027908|Ga0209006_10103809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2518 | Open in IMG/M |
| 3300028572|Ga0302152_10251891 | Not Available | 576 | Open in IMG/M |
| 3300028747|Ga0302219_10170236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300028798|Ga0302222_10008992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4159 | Open in IMG/M |
| 3300028863|Ga0302218_10073338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300028906|Ga0308309_11446091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300029910|Ga0311369_11119992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300029915|Ga0311358_10409737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300029951|Ga0311371_11330093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300029999|Ga0311339_10570908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300030503|Ga0311370_10591101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300030618|Ga0311354_10069603 | All Organisms → cellular organisms → Bacteria | 4018 | Open in IMG/M |
| 3300030618|Ga0311354_11046654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300030706|Ga0310039_10211184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300030739|Ga0302311_10307705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300030815|Ga0265746_1001704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
| 3300030815|Ga0265746_1041615 | Not Available | 618 | Open in IMG/M |
| 3300030991|Ga0073994_12359843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300031027|Ga0302308_10478934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 735 | Open in IMG/M |
| 3300031090|Ga0265760_10007121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3203 | Open in IMG/M |
| 3300031231|Ga0170824_125013667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 600 | Open in IMG/M |
| 3300031236|Ga0302324_103549838 | Not Available | 505 | Open in IMG/M |
| 3300031525|Ga0302326_11987629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300031708|Ga0310686_105702892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300031715|Ga0307476_10343949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300032160|Ga0311301_12881431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 522 | Open in IMG/M |
| 3300032180|Ga0307471_100008762 | All Organisms → cellular organisms → Bacteria | 6643 | Open in IMG/M |
| 3300032180|Ga0307471_102882866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300032898|Ga0335072_10025265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8310 | Open in IMG/M |
| 3300032898|Ga0335072_10345092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1634 | Open in IMG/M |
| 3300033134|Ga0335073_11597209 | Not Available | 622 | Open in IMG/M |
| 3300033158|Ga0335077_11457184 | Not Available | 657 | Open in IMG/M |
| 3300034282|Ga0370492_0381395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.10% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.45% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.61% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100257721 | 3300000567 | Peatlands Soil | MKKLCLILTAVACLPALAAGQVVEEIIARVNNQIVTRSEFTRSKDQLKDEV |
| JGI1027J11758_122240732 | 3300000789 | Soil | MKKLALTLIALACMPVVVAGQVVEEIIARVNGQIITRSEFARSKD |
| JGI12712J15308_102032511 | 3300001471 | Forest Soil | MNSMKKLCLLLIALACLPAFAAGQVVEEIITRVNNQIITQ |
| JGIcombinedJ26739_1016760261 | 3300002245 | Forest Soil | MKKLPLVLAVMACLCGVSAGQVVEEIITRVNNQIITRSEFLRNKDQLKDDV |
| Ga0062389_1032137772 | 3300004092 | Bog Forest Soil | VATPENLMKKLLLVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEYMRS |
| Ga0062389_1042778712 | 3300004092 | Bog Forest Soil | MKRLVLILVATAYLPVFAVGQVVEEIVTRVNGQIITLSEY |
| Ga0070709_112607111 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLYLVLIALACLSGLAAGQVVEEIIARINNQIVTHSEFVRSK |
| Ga0070714_1008915232 | 3300005435 | Agricultural Soil | MKRLPLILIVLACTSALATGQVVEEIIARVNNQIITRSEYARSKDQLRDEIKSQ |
| Ga0070698_1019893251 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLCLVLLALASLPALSVGQVVEEIIARVNNQIVTRSEFVR |
| Ga0070741_104103911 | 3300005529 | Surface Soil | MTPMKKLCLTSIALACVPVLAAGQVVEEIVARVNNQII |
| Ga0070739_105111222 | 3300005532 | Surface Soil | MNRFALTLIALACMPALAAGQVVEEIVARVNNQIITRSEYIRSK |
| Ga0070732_100150361 | 3300005542 | Surface Soil | MKKLCLILVALACLPALAAGQVVEEIIARVNNQIITRSEFDRSK |
| Ga0066698_106571241 | 3300005558 | Soil | MKKLCILSIIFACFPVLAGAQVVEEIIARVNSQIVTRS |
| Ga0066903_1001809851 | 3300005764 | Tropical Forest Soil | MKRLRLILIVLACTPALAAGQVVEEIIARVNNQII |
| Ga0070765_1002665844 | 3300006176 | Soil | MKKFCLFLAVLAWMPVLASAQVVEEIIARVNNQIVTRSEF |
| Ga0070765_1015837942 | 3300006176 | Soil | MSQGLCRRIVVATPENLMKKLLFVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEYMRSKD |
| Ga0066658_100799911 | 3300006794 | Soil | MTPMKKLCLTCIALACLPALAAGQVVEEIVARVNNQIITRSEFTRSKDQ |
| Ga0066660_114693581 | 3300006800 | Soil | MTPMKKLCLTYFALACLPALASGQVVEEIVARVNNQIITGSEFSRSK |
| Ga0075425_1007680252 | 3300006854 | Populus Rhizosphere | MRKLFLMLVALACMPALAAGQVVEEIIARVNNQIITHSEFER |
| Ga0073928_103050502 | 3300006893 | Iron-Sulfur Acid Spring | MKKHCLVLIALTCGPALAAGQAAQNGQVVEEIIARVNNQIITRSEFDRSKDQLKDEV* |
| Ga0099829_112729521 | 3300009038 | Vadose Zone Soil | MKKLCILSVIFACFPVFAGAQVVEEIIARVNSQIVTRSEF |
| Ga0099792_111148711 | 3300009143 | Vadose Zone Soil | MKRLCLVLIILASLPALSAGQVVEEIIARVNNQII |
| Ga0116218_13055102 | 3300009522 | Peatlands Soil | MKKLVLILIAMAGLPVFAAGQVVEEIVTRVNSQIITLSE* |
| Ga0116105_11237842 | 3300009624 | Peatland | MKKLALLFTAFLCCSAFAAGQVVEEIIARVNSQIITRSEFLRSKDQRKDDVK |
| Ga0126370_115557802 | 3300010358 | Tropical Forest Soil | MKKLLLTLIAIGWIPTLAAGQVVEEIIARVNNQIITKSEFGRSKDQLREEAK |
| Ga0137389_104629222 | 3300012096 | Vadose Zone Soil | MNKLLLILIATLCLPILAAGQVVEEIITRVNGQIITRSEFQR |
| Ga0137388_111590512 | 3300012189 | Vadose Zone Soil | MKKLVLVLIAVACLPVFCAGQVVEEIIARVNSQIVTRSEFVRSKDQLK |
| Ga0137379_101106533 | 3300012209 | Vadose Zone Soil | MKKFSLVLIASVCLPALAAGQVVEEIITRVNNQII |
| Ga0137378_101015343 | 3300012210 | Vadose Zone Soil | MKKLCLALIPLVCFSVLAAGQVVEEIITRVNNQIITRSEYDRSKDQLKEEAKQQDPKDP |
| Ga0137359_113851212 | 3300012923 | Vadose Zone Soil | MKKLVLILIAVGCLPVFCAGQVVEEIIARVNSQIITRSEFA |
| Ga0137410_109252351 | 3300012944 | Vadose Zone Soil | MKKLPLALITLTCLHIPASGQVVEEIVTRVNSQIVTRSEFERSKEQLKDECKQQGG |
| Ga0181532_104965071 | 3300014164 | Bog | MKRMLLIVASVTCLSAFAAGQVIEEVVARVNSQIITLSEFQRSKDQ |
| Ga0182005_10910731 | 3300015265 | Rhizosphere | MKRLYLTSITLACLPVLASGQVVEEIVARVNNQIITRSEFN |
| Ga0187824_100382903 | 3300017927 | Freshwater Sediment | MKKISLVALALFCLPIVAGGQVVEEIITRVNNQIITRSEFQRSKDQLKDEVK |
| Ga0187848_100350203 | 3300017935 | Peatland | MKRPFLILVAIACLPAFAAGQVVEEIVTRVNGQIITLSEFQRSKDQLKDDVKQQDPAN |
| Ga0187821_103272281 | 3300017936 | Freshwater Sediment | MKKPFFALVITACLPALAAGQVVEEIIARVNNQIVTRSEFQRSK |
| Ga0187778_108569002 | 3300017961 | Tropical Peatland | MKRVPLVLAALACSSVLATAQAVVEEIITRVNNQIITRSELERSKEQLKDE |
| Ga0187777_105002431 | 3300017974 | Tropical Peatland | MKRVPLVLAALACSSVLATAQAVVEEIITRVNNQIITRSELERSK |
| Ga0187782_110730122 | 3300017975 | Tropical Peatland | MKKLCLVLTAFACLPSLAAGQQVVEEIIARVNNQIITKSEFER |
| Ga0181520_103265742 | 3300017988 | Bog | MKKIFFAIIGMACVPAMMAGQSVVEEIIARVNGQIITRSEFIRSK |
| Ga0187822_101071372 | 3300017994 | Freshwater Sediment | MKKLSLILIALACLPALATGQVVEEIIARVNNQIITRSEIARSKDQLRD |
| Ga0187864_101761062 | 3300018022 | Peatland | MKTMLLMVIGMSLMPAFAAGQVVEEIVARVNSQIITHSEFLRSKDQLK |
| Ga0187784_102082933 | 3300018062 | Tropical Peatland | MKKSFLMLLGVACLSSFAAGQSVVEEIIARVNNQIITLSEFERSKDQL |
| Ga0187772_112944881 | 3300018085 | Tropical Peatland | MNRLFVILIGIACLPAFCAGQVVEEIVARVNNQIITRSEFDRSKDQLR |
| Ga0187770_103060451 | 3300018090 | Tropical Peatland | MKKLCLVLSAFACLPSLAAGQQVVEEIITRVNNQII |
| Ga0187770_117625971 | 3300018090 | Tropical Peatland | MKKHCLILVALACMPAVAFGQVVEEIIARVNNQIITSSEFARSKDQLRDEVKAQNPND |
| Ga0066662_107071182 | 3300018468 | Grasslands Soil | MKKLFSVILALTCVPALAAGQVVEEIIARVNNQIVTRSEFLRS |
| Ga0066662_116554242 | 3300018468 | Grasslands Soil | MKKLCILSIIFACFPVLAGAQVVEEIIARVNSQIVTRSEFARSKDQLKEEAK |
| Ga0179592_101710821 | 3300020199 | Vadose Zone Soil | MKKLLLLLIAMASLPALCAGQVVEEIIARVNSQIVTRSEFLR |
| Ga0210399_107898311 | 3300020581 | Soil | MKKLCLLIIALSCLTALAAAQGGQVVEEIVTRVNGQIITRSEF |
| Ga0210399_110517762 | 3300020581 | Soil | MKKHCLVLIALTCGPALAAGQAAQNGQVVEEIIARVNNQIITRSEFDRSKDQL |
| Ga0210388_105633102 | 3300021181 | Soil | MKKLCLVLIALSCVPALAAGQATQNGQVVEEIIARVNNQIITRSEFDRSK |
| Ga0210397_109470521 | 3300021403 | Soil | MKRVVLILVGMACLSALAAGQVVEEIVTRVNSQIITRSEF |
| Ga0210394_103286111 | 3300021420 | Soil | MKRVALILAGMACLPALAAGQVVEEIVTRVNSQIITRSEF |
| Ga0210394_106379872 | 3300021420 | Soil | MKKLVLILIALISLPTFAAGQLVEEIVTRVNGQIITLSEFQRSKD |
| Ga0187846_104764621 | 3300021476 | Biofilm | MKKLSLVLILISAMPVLSGAQVVEEIIARVNNQIVTRSEFIRS |
| Ga0210402_109722871 | 3300021478 | Soil | MKKLCLVLAVLACLPAIAAGQVVEEIIARVNNQIITRSEYERS |
| Ga0210410_104526011 | 3300021479 | Soil | MKRLVLTLIVTVCMPTFVVGQVVEEIITRVNGQIIT |
| Ga0210410_104996532 | 3300021479 | Soil | MKKLCLLIIVLSCLSALAAAQGGQVVEEIVTRVNGQIITRS |
| Ga0210410_107493972 | 3300021479 | Soil | MKKIFLILIVIASLPVLAAGQVVEEIVTRVNSQIITLSEYQRSKDQ |
| Ga0210410_116725402 | 3300021479 | Soil | MMKKLFPVLLAFACLPALAAGQVVEEIIARVNNQIVTRSE |
| Ga0210409_107792152 | 3300021559 | Soil | MKKLCLVLAVLACLPAIAAGQVVEEIIARVNNQIITRSEY |
| Ga0242659_11206952 | 3300022522 | Soil | VATPENLMKKLLLVLIAMACLPTFVVGQVVEEIIARVNSQIITRSEY |
| Ga0242674_10082202 | 3300022711 | Soil | MKRLVLILIAMAYLPAFAAGQVVEEIVTRVNSQIITRSEYQRSKDQLRDD |
| Ga0224570_1149081 | 3300022730 | Rhizosphere | MKKLCLLIIALSCLTALAAAQGGQVVEEIVTRVNGQIITRSEFDRSKDTLKDE |
| Ga0224564_10649741 | 3300024271 | Soil | MKRPLLILIAMVCLAAFAAGQVVEEIVARVNSAIIT |
| Ga0208935_10412221 | 3300025414 | Peatland | MKKLALLFTAFLCCSAFAAGQVVEEIIARVNSQIIT |
| Ga0208037_10451692 | 3300025448 | Peatland | MLLILIGMSFVPAFAAGQVVEEIVARVNSQIITRSEFLRSKD |
| Ga0207699_105346282 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLALTLIALTFVPSLASAQQTVEEIIACVNNQIITKSEYTRSKDQLRDEAKQ |
| Ga0207700_100476421 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLCLIPVALACLPAFAAGQVVEEIITRVNNQIITRSEYQRSKD |
| Ga0207700_107933461 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLALTLIALTFVPSLASAQQTVEEIIARVNNQIITKS |
| Ga0207665_113113502 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLCLVLVASACLPALAAGQVVEEIVTRVNNQIITRSE |
| Ga0209265_10900781 | 3300026308 | Soil | MTPMKKRCLTCIALACLPALAAGQVVEEIVARVTNQIITRSE |
| Ga0209267_12720582 | 3300026331 | Soil | MKKLCILSVIFACFPVLAGAQVVEEIIARVNSQIVTRSEF |
| Ga0209807_13231032 | 3300026530 | Soil | MTPMKKLCLTCIALACLPALAAGQVVEEIVARVNNQIITRSEFTRSKDQLRDEVKQ |
| Ga0209056_101328241 | 3300026538 | Soil | MKKLCILSVIFACFPVLAGAQVVEEIIARVNSQIVT |
| Ga0209010_10144553 | 3300027370 | Forest Soil | MKKLWLVLIASTCVPALAAAQAAQNGQVVEEIITRVNNQIITRSE |
| Ga0209527_10292393 | 3300027583 | Forest Soil | MKKLFCVLVAIAGLPVVCAGQVVEEIIARVNNQIITRSEFVRSKDQ |
| Ga0208827_12165412 | 3300027641 | Peatlands Soil | MKKVCLVLTALACLPPLAAGQVVEEIIARVNNQIVTRSEFGRSKD |
| Ga0209333_10172703 | 3300027676 | Forest Soil | MKRLVLILIAMAYLPVLAGGQVVEEIVTRVNGQIIT |
| Ga0209908_100018601 | 3300027745 | Thawing Permafrost | MKKLVLILIALICLPVFAAGQVVEEIVTRVNSQIITLSEFQRSKDQLKDEVKQQLSLIHI |
| Ga0209908_100328241 | 3300027745 | Thawing Permafrost | MLLIVASVTCLSAFAAGQVIEEVVARVNSQIITLSEFQRSKDQLKD |
| Ga0209656_100145624 | 3300027812 | Bog Forest Soil | MKKFCLVLIASACLPVFASAQVIEEIIARVNNQIVTRSEF |
| Ga0209274_101521512 | 3300027853 | Soil | MKKLCLLIIALSCLSALAAAQGGQVVEEIVTRVNGQIITRSEFDRSKDT |
| Ga0209693_102285401 | 3300027855 | Soil | MKRVVLILVGMACLSALAAGQVVEEIVTRVNSQIITRSEFLRSKD |
| Ga0209169_105904542 | 3300027879 | Soil | MKKLVLILIALISLPAFAAGQVVEEIVTRVNGQIITLSEFQRSKDQ |
| Ga0209590_100792853 | 3300027882 | Vadose Zone Soil | MKKFSLVLIASVCLPALAAGQVVEEIITRVNNQIIT |
| Ga0209275_108178062 | 3300027884 | Soil | MKRLVLISIAMAYLPGLAAGQVVEEIVTRVNGQIITRSEYQRSKDQLRD |
| Ga0209380_107306921 | 3300027889 | Soil | MKKLVLILIAMAGLPVFTAAQVVEEIVTRVNGQIITLSEFQRSKDQ |
| Ga0209488_103664231 | 3300027903 | Vadose Zone Soil | MKKLVLILIAVGCLPVFCAGQVVEEIIARVNSQIITRSEFARSKDQLKGDVKQQS |
| Ga0209006_101038092 | 3300027908 | Forest Soil | MKRMLLILLGLSLVPAFAAGQVVEEIVARVNGSIITRSEF |
| Ga0302152_102518912 | 3300028572 | Bog | MKKLVLIFVAMACLPVFCAGQVVEEIITRVNGQIITLSEFQRSKD |
| Ga0302219_101702362 | 3300028747 | Palsa | MKRMLLILLGMASVSAFAAGQVIEEIVARVNSQIITRSE |
| Ga0302222_100089924 | 3300028798 | Palsa | MKKLVLILVAMSCLPVYCAGQVVEEIITRVNGQIITLSEFQ |
| Ga0302218_100733381 | 3300028863 | Palsa | MTISCLAPFCAGQVVEEIIARVNSQIITRSEYIRSKDQLKDDVKQQ |
| Ga0308309_114460912 | 3300028906 | Soil | MKKLVLTLISMACLPGFTAAQVVEEIVTRVNGQIV |
| Ga0311369_111199921 | 3300029910 | Palsa | MKKIPLLLAVIACLCAASAGQVVEEIIARVNNQIVTRSEFLRNKD |
| Ga0311358_104097371 | 3300029915 | Bog | MKRPFLILVAITCLSAFAAGQVVEEIVTRVNGRIITLSE |
| Ga0311371_113300931 | 3300029951 | Palsa | MKKLCLLLIALSCLSALAAAQGGQVVEEIVTRVNGQIITHAEFDRSKDTL |
| Ga0311339_105709081 | 3300029999 | Palsa | MKKFSCAIICLLSLPALATGQVVEEIIARVNNQIVTRSEFTRS |
| Ga0311370_105911012 | 3300030503 | Palsa | MNSMKRLSLVLIASACLPALAAGQVVEEIITRVNNQIITHSEYVRSKDQLRD |
| Ga0311354_100696034 | 3300030618 | Palsa | MKRMLLILLGMASVSAFAAGQVIEEIVARVNSQIITRSEFLRSK |
| Ga0311354_110466542 | 3300030618 | Palsa | MKKLVLILIAMAGLPVFTAGQVVEEIVTRVNGQIITL |
| Ga0310039_102111842 | 3300030706 | Peatlands Soil | MKKVCLVLTALACLPPLAAGQVVEEIIARVNNQIVTR |
| Ga0302311_103077051 | 3300030739 | Palsa | MKRLVLILTAMACLPALATGQVVEEIIARVNSQIIT |
| Ga0265746_10017043 | 3300030815 | Soil | MKKTVLILLCLSFVPALAAGQVVEEIVARVNSQIITRSEY |
| Ga0265746_10416151 | 3300030815 | Soil | MKKLCLLIVTLSCLSALAAAQGGQVVEEIVTRVNSQIITRAEFDR |
| Ga0073994_123598432 | 3300030991 | Soil | MKKLCLVILASACLPALAVGQVVEEIIARVNNQIVTRSEFVRSKDQLKDEVKQ |
| Ga0302308_104789341 | 3300031027 | Palsa | MKKMILIFLGMACVPAIVSAQVVEEIIARVNGQIVTLSEFQRSKDQLKEDV |
| Ga0302180_102720531 | 3300031028 | Palsa | MHMKKFSCAIICLLSLPALATGQVVEEIIARVNNQIVTRSEFTRS |
| Ga0265760_100071211 | 3300031090 | Soil | MKKLASLFTAVLCCSAFATGQVVEEIIARVNSQIITRSEFLRSKDQL |
| Ga0170824_1250136671 | 3300031231 | Forest Soil | MKRLSLTLIGFACLPAFAHAQVVEEIIARVNNQIITQSEYARSKDQL |
| Ga0302324_1035498381 | 3300031236 | Palsa | MKKLVLTLITMACLPVFCAGQVVEEIITRVNGQIITLSEFQRSKDQL |
| Ga0302326_119876292 | 3300031525 | Palsa | MKRIVFLLVGLCCLPLFATGQVVEEIVARVNGQIVTRSEF |
| Ga0310686_1057028922 | 3300031708 | Soil | MKRPFLLLVAVACLSVFAAGQVVEEIVARVNSQIITLSEFQRSKD |
| Ga0307476_103439491 | 3300031715 | Hardwood Forest Soil | MKKLPLILIALTCMPAFAAGQVVEEIVARVNNQIITKSEFARSKDQLRDE |
| Ga0311301_128814311 | 3300032160 | Peatlands Soil | MKKLCAVLTAFACLPALAAGQQVVEEIIARVNNQII |
| Ga0307471_1000087621 | 3300032180 | Hardwood Forest Soil | MKKFPLTLVALACMPALAEGQVVEEIIARVNNQIITKSE |
| Ga0307471_1028828662 | 3300032180 | Hardwood Forest Soil | MKKFSLALVALACMPALAEGQVVEEIIARVNNQIITKSEFARSKDQ |
| Ga0335072_100252658 | 3300032898 | Soil | VISMKRLLVVLTVLVCLPVLAGAQVVEEIIARINNQIITRSEYDRSKDQLRDE |
| Ga0335072_103450923 | 3300032898 | Soil | MKRLSLLLVAFACLPAFVAGQTVVEEIIARVNNQIITRSEYLRSKDQ |
| Ga0335073_115972091 | 3300033134 | Soil | MKKIFLLSFAVAFLPALAAAQVVEEIITQVNTEIITRSEYQRSKD |
| Ga0335077_114571841 | 3300033158 | Soil | MKKLSLLLIAIACAPALAAGQSGQVVEEIIAHVNNQIITKSEYERSKDQLRDEVKAQSPNDADK |
| Ga0370492_0381395_3_107 | 3300034282 | Untreated Peat Soil | MLLILIGMSFVPAFAAGQVVEEIVARVNSQIITRS |
| ⦗Top⦘ |