NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069074

Metagenome / Metatranscriptome Family F069074

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069074
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 46 residues
Representative Sequence DDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Number of Associated Samples 112
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 95.97 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.645 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.097 % of family members)
Environment Ontology (ENVO) Unclassified
(24.194 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.032 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.52%    β-sheet: 0.00%    Coil/Unstructured: 46.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02310B12-binding 31.45
PF04055Radical_SAM 17.74
PF01928CYTH 3.23
PF13536EmrE 1.61
PF00494SQS_PSY 1.61
PF15631Imm-NTF2-2 1.61
PF01593Amino_oxidase 0.81
PF07690MFS_1 0.81
PF02586SRAP 0.81
PF08450SGL 0.81
PF07811TadE 0.81
PF00892EamA 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1562Phytoene/squalene synthetaseLipid transport and metabolism [I] 1.61
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.81
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.81
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.65 %
UnclassifiedrootN/A44.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001545|JGI12630J15595_10060053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300001977|JGI24746J21847_1059448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis545Open in IMG/M
3300002245|JGIcombinedJ26739_100025455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5162Open in IMG/M
3300002245|JGIcombinedJ26739_100785982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae832Open in IMG/M
3300002561|JGI25384J37096_10052460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1544Open in IMG/M
3300002853|draft_1020773All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300004156|Ga0062589_100552489All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300005330|Ga0070690_100817525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae724Open in IMG/M
3300005364|Ga0070673_100351499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1308Open in IMG/M
3300005455|Ga0070663_100131304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1902Open in IMG/M
3300005467|Ga0070706_100403777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1272Open in IMG/M
3300005534|Ga0070735_10903506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae518Open in IMG/M
3300005536|Ga0070697_101360838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae634Open in IMG/M
3300005546|Ga0070696_100060011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2659Open in IMG/M
3300005557|Ga0066704_10443557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae858Open in IMG/M
3300005559|Ga0066700_10175699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1467Open in IMG/M
3300005560|Ga0066670_10056424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.2058Open in IMG/M
3300005587|Ga0066654_10648993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae587Open in IMG/M
3300005610|Ga0070763_10424937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae750Open in IMG/M
3300005764|Ga0066903_106135980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae629Open in IMG/M
3300005921|Ga0070766_10793961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae645Open in IMG/M
3300006176|Ga0070765_101837237All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006358|Ga0068871_102273187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae517Open in IMG/M
3300006806|Ga0079220_10356728All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae933Open in IMG/M
3300007255|Ga0099791_10121987Not Available1208Open in IMG/M
3300009176|Ga0105242_11337084Not Available742Open in IMG/M
3300009521|Ga0116222_1058740Not Available1669Open in IMG/M
3300009545|Ga0105237_10567077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1142Open in IMG/M
3300009665|Ga0116135_1127418Not Available938Open in IMG/M
3300009665|Ga0116135_1404553All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300009698|Ga0116216_10406759Not Available826Open in IMG/M
3300009700|Ga0116217_10347617Not Available947Open in IMG/M
3300009700|Ga0116217_10973575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300009839|Ga0116223_10192732Not Available1248Open in IMG/M
3300010046|Ga0126384_11842296All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010321|Ga0134067_10066204Not Available1189Open in IMG/M
3300010337|Ga0134062_10629321Not Available556Open in IMG/M
3300010371|Ga0134125_10217893All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2123Open in IMG/M
3300010371|Ga0134125_11920291All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300010371|Ga0134125_12367326Not Available577Open in IMG/M
3300010379|Ga0136449_103718178Not Available576Open in IMG/M
3300011120|Ga0150983_12295571Not Available1725Open in IMG/M
3300012096|Ga0137389_10394538Not Available1181Open in IMG/M
3300012096|Ga0137389_10731360Not Available850Open in IMG/M
3300012189|Ga0137388_10042885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3617Open in IMG/M
3300012198|Ga0137364_11416278Not Available514Open in IMG/M
3300012201|Ga0137365_11104485All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012208|Ga0137376_11026373Not Available706Open in IMG/M
3300012356|Ga0137371_10439028All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300012683|Ga0137398_10892335Not Available620Open in IMG/M
3300012917|Ga0137395_10294793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1148Open in IMG/M
3300012924|Ga0137413_11111594All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300014200|Ga0181526_10060438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum2416Open in IMG/M
3300014495|Ga0182015_10991132Not Available522Open in IMG/M
3300014501|Ga0182024_12023505Not Available636Open in IMG/M
3300015264|Ga0137403_10042866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4709Open in IMG/M
3300015371|Ga0132258_10117839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6303Open in IMG/M
3300015371|Ga0132258_13472844Not Available1080Open in IMG/M
3300015373|Ga0132257_103525056Not Available569Open in IMG/M
3300016270|Ga0182036_11402848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300017823|Ga0187818_10113734Not Available1172Open in IMG/M
3300017943|Ga0187819_10423321All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300017966|Ga0187776_10818679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300017973|Ga0187780_10338955Not Available1061Open in IMG/M
3300017993|Ga0187823_10138015Not Available760Open in IMG/M
3300017999|Ga0187767_10046341Not Available1061Open in IMG/M
3300018012|Ga0187810_10532250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300018043|Ga0187887_10275696Not Available994Open in IMG/M
3300018043|Ga0187887_10657486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300018047|Ga0187859_10622573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300018062|Ga0187784_11233064All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300018085|Ga0187772_10216910All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300018088|Ga0187771_11181749Not Available649Open in IMG/M
3300019789|Ga0137408_1269463Not Available1467Open in IMG/M
3300020002|Ga0193730_1164213Not Available575Open in IMG/M
3300020580|Ga0210403_10188422Not Available1692Open in IMG/M
3300021178|Ga0210408_11378020All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300021180|Ga0210396_10094880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2701Open in IMG/M
3300021180|Ga0210396_10662160Not Available904Open in IMG/M
3300021403|Ga0210397_10121308Not Available1793Open in IMG/M
3300021404|Ga0210389_11060003All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300021407|Ga0210383_11431509Not Available574Open in IMG/M
3300021420|Ga0210394_10231817Not Available1614Open in IMG/M
3300021478|Ga0210402_10350375Not Available1370Open in IMG/M
3300021559|Ga0210409_10146860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2161Open in IMG/M
3300025924|Ga0207694_10909152Not Available744Open in IMG/M
3300026334|Ga0209377_1098459Not Available1217Open in IMG/M
3300026547|Ga0209156_10263433Not Available793Open in IMG/M
3300027625|Ga0208044_1156157All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300027641|Ga0208827_1161407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300027737|Ga0209038_10219386All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300027768|Ga0209772_10219321Not Available603Open in IMG/M
3300027846|Ga0209180_10156345Not Available1314Open in IMG/M
3300027853|Ga0209274_10482656All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300027855|Ga0209693_10402723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300027867|Ga0209167_10232869Not Available986Open in IMG/M
3300027875|Ga0209283_10562166Not Available727Open in IMG/M
3300027879|Ga0209169_10286749Not Available864Open in IMG/M
3300027884|Ga0209275_10019626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3009Open in IMG/M
3300027905|Ga0209415_10476636Not Available971Open in IMG/M
3300028037|Ga0265349_1024455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300028807|Ga0307305_10500219Not Available545Open in IMG/M
3300028906|Ga0308309_11214042Not Available650Open in IMG/M
3300030494|Ga0310037_10342343All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300030707|Ga0310038_10338309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300030707|Ga0310038_10517647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300030862|Ga0265753_1052128All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300030940|Ga0265740_1003610Not Available1165Open in IMG/M
3300031708|Ga0310686_115393438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8405Open in IMG/M
3300031771|Ga0318546_10797430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300031962|Ga0307479_11591254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300031981|Ga0318531_10005745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4388Open in IMG/M
3300031996|Ga0308176_10531506Not Available1199Open in IMG/M
3300032160|Ga0311301_10319962All Organisms → cellular organisms → Bacteria → Acidobacteria2462Open in IMG/M
3300032205|Ga0307472_102634855Not Available513Open in IMG/M
3300032783|Ga0335079_10013341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis9383Open in IMG/M
3300032783|Ga0335079_10504854Not Available1289Open in IMG/M
3300032783|Ga0335079_11009084Not Available848Open in IMG/M
3300032805|Ga0335078_11346080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300032828|Ga0335080_10343942Not Available1610Open in IMG/M
3300032955|Ga0335076_11046900All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300033158|Ga0335077_11262968Not Available719Open in IMG/M
3300033807|Ga0314866_011591Not Available1184Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.10%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.84%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.23%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Hydrocarbon Resource EnvironmentsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002853PDIso9.ppmwps2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12630J15595_1006005333300001545Forest SoilSVGWHDVQDAREQADERYNSLRDANFELERARITLLRATGELESWVGAAK*
JGI24746J21847_105944813300001977Corn, Switchgrass And Miscanthus RhizosphereDTATLHELDDARTQAAERYLAAQDAAIELARARIALMRSTGELEKWVQAGQD*
JGIcombinedJ26739_10002545563300002245Forest SoilLSERYNSLQDANFELERARITLLRATGELEAWVGAGN*
JGIcombinedJ26739_10078598233300002245Forest SoilGWHDVQDAREQADERYNSLRDANFELERARITLLRATGELESWVGAAK*
JGI25384J37096_1005246013300002561Grasslands SoilTATLHDVXDARMQANERYNALQDTSFELQKARITLLRATDELAAWAGVGK*
draft_102077313300002853Hydrocarbon Resource EnvironmentsSVSASLHDLDDARNQANEHYDAMQDTNFELERARISLLRTTGDLEAWIGVGK*
Ga0062589_10055248913300004156SoilATLHELDDARAQAAERYLASQDAALELDRARIALMRSTGGLEKWVEAGQE*
Ga0070690_10081752523300005330Switchgrass RhizosphereSAAWHDVQDAREQVNQRYNSLQDANFELERARITLLRATGELASWAGAGQ*
Ga0070673_10035149923300005364Switchgrass RhizosphereVQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ*
Ga0070663_10013130413300005455Corn RhizosphereAAWHDVQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ*
Ga0070706_10040377723300005467Corn, Switchgrass And Miscanthus RhizosphereDVGTASFHDVEDARNQATERFNALQDANFEVERARIALLRATGELESWVGIGK*
Ga0070735_1090350613300005534Surface SoilNERYVALADTNFELQRARISLLRATGDLETWVGVGK*
Ga0070697_10136083813300005536Corn, Switchgrass And Miscanthus RhizosphereWHDVQDAREQLNERYNSLQDANFELERARITLLRATGELASWAGAGQ*
Ga0070696_10006001113300005546Corn, Switchgrass And Miscanthus RhizosphereDVQDAREQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK*
Ga0070665_10106111013300005548Switchgrass RhizosphereRYHAFQSADFELQRAKIGLLRATGDLESWVGIPK*
Ga0066704_1044355723300005557SoilTATLHDVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK*
Ga0066700_1017569923300005559SoilDVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK*
Ga0066670_1005642413300005560SoilANERFGALQDADFELERARIALLRATGELESWVGVGK*
Ga0066654_1064899323300005587SoilQVRLDAGTASFHDLEDARDQANERFNALQDVNFEVERARIALLRATGELENWVGVGK*
Ga0070763_1042493713300005610SoilLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK*
Ga0066903_10613598013300005764Tropical Forest SoilRNQVNERFGALQDANFELERARITLIRATGELENWVGIGK*
Ga0070766_1079396113300005921SoilRNQVNERYDALQDTNFDLQRARISLLRTTGELEDWVGVGK*
Ga0070765_10183723713300006176SoilRYNQLQDANFELDRSRIELLRATGDLEAWVEAAPSQ*
Ga0068871_10227318713300006358Miscanthus RhizosphereVEDAREQASERFISLGDTSYELEKARITLLRATGELESWVGLAR*
Ga0079220_1035672813300006806Agricultural SoilQDERYNSLQDANFQLERARITLLRATGDLERWVGVGK*
Ga0099791_1012198723300007255Vadose Zone SoilATLHDVEDARMQANERYNALQDTSFELQKARITLLRATDELAAWAGVGK*
Ga0105242_1133708413300009176Miscanthus RhizosphereEQVNERYNSLQDANFELERARITLLRATGELAGWVGAGQ*
Ga0116222_105874013300009521Peatlands SoilHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK*
Ga0105237_1056707713300009545Corn RhizosphereAADTATLHELDDARTQAAERYLAAQDAAIELARARIALMRSTGELEKWVQAGQD*
Ga0116135_112741813300009665PeatlandNERYDALQDTNFDLQRARISLLRATGELEDWVGVGK*
Ga0116135_140455313300009665PeatlandKSDLDATQTRVDSGSATLHDLDDARNQVNERYDALQDTNFELQRARIGLLRVTGELEDWVGVGK*
Ga0116216_1040675913300009698Peatlands SoilHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK*
Ga0116217_1034761723300009700Peatlands SoilATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK*
Ga0116217_1097357513300009700Peatlands SoilDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVAK*
Ga0116223_1019273223300009839Peatlands SoilEQYDALQDTNFELQRARISLLRATGELEAWVGVAK*
Ga0126384_1184229623300010046Tropical Forest SoilANERYNGLLDASFELQRARIALLRVTGELAKWVSGQK*
Ga0134067_1006620413300010321Grasslands SoilALQVRLDAGTASFHDLEDARDQANERFNALQDANFEVERARIALLRATGELENWVGVGK*
Ga0134062_1062932113300010337Grasslands SoilMDDARTQSNERYHAFQSADFELQRARIGLLRATGELEIWAGVPK*
Ga0134125_1021789313300010371Terrestrial SoilQVRVDAGSATLHDMDDARTQSNERYHAFQSADFELQRARIGLLRATGELETWVGVPK*
Ga0134125_1192029123300010371Terrestrial SoilEQLNERYNSLQDANFELERARITLLRATGELASWAGAVQ*
Ga0134125_1236732623300010371Terrestrial SoilQDAREQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK*
Ga0136449_10371817813300010379Peatlands SoilEQYDALQDTNFELQRARISLLRATGELEAWVGVTK*
Ga0150983_1229557123300011120Forest SoilERYDALQDTSFELERARISLLRATGDLEAWVGVGK*
Ga0137389_1039453813300012096Vadose Zone SoilQVNERYNSLQDANFELERARITLLRATGELEAWVGAGK*
Ga0137389_1073136013300012096Vadose Zone SoilATLHDVEDARGQANQRYNALQDVNFELERARIALLRATGELETWVGAGK*
Ga0137388_1004288513300012189Vadose Zone SoilVRVDAGTATVHDAEDARNQADERFNALQDANFQLERARIILLRATGVLETWVGAGR*
Ga0137364_1141627823300012198Vadose Zone SoilDAGSATIHDLQDARDQANERYNVLQDSSFELERAQIALLRATGELAIWVGISK*
Ga0137365_1110448523300012201Vadose Zone SoilRYHALQSADFELERAKIGLLRATGELENWVGVPK*
Ga0137376_1102637313300012208Vadose Zone SoilIHDLQDARDQANDRYNILQDSNFELERAQIALLRTTGDLANWVGVSK*
Ga0137371_1043902823300012356Vadose Zone SoilKINERYHALQSAAFELERAKIGLLRATGELENWVGVPK*
Ga0137398_1089233523300012683Vadose Zone SoilHEVQDAREQSSERYNSLQDANFQLERARITLLRATGGLEGWVGVGK*
Ga0137395_1029479313300012917Vadose Zone SoilERFNALQDANFEVERARIALLRATGELENWVGVGK*
Ga0137413_1111159413300012924Vadose Zone SoilSNERYHALQSANFELERARIGLLRATGELEGWLGIPK*
Ga0181526_1006043833300014200BogVDSGSATLHDLDDARNQVNERYDALEDTNFELQRARISLLRATGELEDWVGVGK*
Ga0182015_1099113223300014495PalsaDEADARNQVNERYNALQDSNFDLERARITLLRSTGDLEKWARGEN*
Ga0182024_1202350523300014501PermafrostQANLQALETRVDSGTAALHDEADARNQANERYNALQDSNFELQRARITLLRSTGDLEKWAMGEN*
Ga0137403_1004286643300015264Vadose Zone SoilMFPSPSPLESHHVRIDAGTANLHDMDDARNQSNERYHALQSADFELERAKIGLLRATGELEDWVGVPK*
Ga0132258_1011783913300015371Arabidopsis RhizosphereNLHELDDARNQTNQLYHTLQSANFELQRAKIALLRTTGELENWIGVSK*
Ga0132258_1347284423300015371Arabidopsis RhizosphereNERYNSLQDATFELERAGITLLRATGELEAWVNAGK*
Ga0132257_10352505623300015373Arabidopsis RhizosphereEQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK*
Ga0182036_1140284813300016270SoilTATLHDEDDARNLANERFNTLEDTTFELERAQIALLRATGELSSWVGLAK
Ga0187818_1011373413300017823Freshwater SedimentEYQLAESNRDAVQVRMDAGTATLRDGEDARTQENTRYDALQDANFELERARITLLRSTGDLDNWVGVGK
Ga0187819_1042332123300017943Freshwater SedimentDDARNQANEQYDALQDTNFELQRARISLLRATGELEAWVGVIK
Ga0187776_1081867913300017966Tropical PeatlandDDARNQANERYNTLEDTTFEVERAQIALLRATGELSSWVGVAK
Ga0187780_1033895513300017973Tropical PeatlandEDEARNQANERYVALQDTRFELQRARIALLRAIGDLSSWLGLSK
Ga0187823_1013801513300017993Freshwater SedimentTRVNAGNGTWHDAEDAREQADARYNALQDASFDLERSRIALLRATGGLATWLGVIP
Ga0187767_1004634113300017999Tropical PeatlandEDDARNQASERYDTLQDTRFELQRARIALLRATGDLGSWLGLSSK
Ga0187810_1053225013300018012Freshwater SedimentANERYDALQDTNFELERARINLLRATGELESWVGVGK
Ga0187887_1027569623300018043PeatlandARVLVTERFNSLQDADFELERARIGLLRVTGDLPAWVGLNTAGPNK
Ga0187887_1065748613300018043PeatlandTRVDSGSATLHDLDDARNQVNERYDALEDTNFELQRARISLLRATGELEDWVGVGK
Ga0187859_1062257313300018047PeatlandSNLDATQTRVDSGSATLHDLDDARNQANEHYDALQDTNFELQRARISLLRVTGELEAWVGVGK
Ga0187784_1123306413300018062Tropical PeatlandNQANERYDTLQDTRFELQRARIALLRATGDLSSWLGLNK
Ga0187772_1021691013300018085Tropical PeatlandSERYGALQDANFELQRARITLLRATGEISDWVGVEK
Ga0187771_1118174923300018088Tropical PeatlandLHEEDDAHNQANERYDTLQDTRFELQRARIALLRATGDLSSWLGLAK
Ga0137408_126946323300019789Vadose Zone SoilTASFHDVEDARDQANERFNALQDANFEVERARIALLRASGELGNWVGVGK
Ga0193730_116421323300020002SoilERYNSLQDANFQLERARITLLRATGGLEDWIGGSK
Ga0210403_1018842223300020580SoilTANWHDVQDAREQSSDRYNSLQDANFQLERARITLLRATGELESWVGVGK
Ga0210408_1137802013300021178SoilAKNQAAEHYDALQDANFELQRARISLLRATGEIESWVGVGK
Ga0210396_1009488043300021180SoilVDSGSATLRDLDDARNQANERYDALQDTNFELQRARISLLRVTGELEDWVGIGK
Ga0210396_1066216013300021180SoilGRATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAGVGVGK
Ga0210397_1012130823300021403SoilDARNQVNERYDALQDTNFELQRARISLLRATGELEAWVGIQK
Ga0210389_1106000313300021404SoilGSATHHDLDDARSQVNERYDALQDTNFELQRARISLLRATGELEAWVGIQK
Ga0210383_1143150923300021407SoilQVNERYDALQDTNFELQRARISLLRVTGELEAWVGVGK
Ga0210394_1023181723300021420SoilVDSGSATLHELDDARGQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0210402_1035037523300021478SoilLSERYNSLQDANFELERARITLLRATGELEAWVGAGN
Ga0210409_1014686033300021559SoilVQDAREQLSERYNSLQDANFELERARITLLRATGELEAWIGAGN
Ga0207694_1090915213300025924Corn RhizosphereGSAAWHDVQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ
Ga0209377_109845923300026334SoilDAGTATLHDVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK
Ga0209156_1026343323300026547SoilQANDRYNALQDANFELQRARISLLRATGELEGWVGVGK
Ga0208044_115615713300027625Peatlands SoilSATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0208827_116140713300027641Peatlands SoilSATLHDLDDARNQANEQYDALQDTNFELQRARISLLRATGELEAWVGVTK
Ga0209038_1021938623300027737Bog Forest SoilAATLHDLDDARNQVNERYDALQDTNFDLQRARISLLRATGELEDWVGVGK
Ga0209772_1021932123300027768Bog Forest SoilTLHDAEDARIQANEHYNQLQDANFELQRGRIELLRTTGDLESWVEGGNSN
Ga0209180_1015634513300027846Vadose Zone SoilERYNALQDTSFELQKARITLLRATDELAAWAGVGK
Ga0209274_1048265613300027853SoilDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0209693_1040272313300027855SoilVDAGGATVHDLDDARNQANERYDALQDTNFELERARISLLRVTGELEAWVGVGK
Ga0209167_1023286923300027867Surface SoilLDALQIRVDAGSATLHDLDDANNQVNERYDALQDTNFELQRARISLLRATGELEAWVGAG
Ga0209283_1056216623300027875Vadose Zone SoilEQSNERYSSLQDANFELERARITLLRAMGELESWLGVGK
Ga0209169_1028674913300027879SoilARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0209275_1001962613300027884SoilRGQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0209415_1047663613300027905Peatlands SoilATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK
Ga0265349_102445513300028037SoilTQTRVDSGSATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0307305_1050021923300028807SoilEQTSERYNSLQDANFQLERARITLLRATGELEGWIGVGK
Ga0308309_1121404213300028906SoilRYNQLQDANFELDRSRIELLRATGDLEAWVEAAPSQ
Ga0310037_1034234323300030494Peatlands SoilLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0310038_1033830913300030707Peatlands SoilIQVRVDAGSATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK
Ga0310038_1051764713300030707Peatlands SoilRANERFDALQDANFELQRARILLLRATGDLEAWVGVASK
Ga0265753_105212823300030862SoilADSGSATLHDLDDARSQANERYDALQDPNFELQRARISLLRATGELEAWVGVGK
Ga0265740_100361023300030940SoilDSGSATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK
Ga0310686_11539343873300031708SoilKSTLDAAQVRMESGSATLHDAEDARVQSNERFGALQDANFELDRARITLLRLTGELGSWVGVTN
Ga0318546_1079743023300031771SoilANERFNTLEDTTFELERAQIALLRATGELSSWVGLAK
Ga0307479_1159125413300031962Hardwood Forest SoilAEMTEKYGALQDANFQLVRAKIGLLRATGELEAWAGQAK
Ga0318531_1000574563300031981SoilLSERYIALQDTNFELQRARIGLLRSTGELEKWINGGL
Ga0308176_1053150623300031996SoilQQVNERYLSLQDMKFELEKSRIMLLRATGELENWVGK
Ga0311301_1031996213300032160Peatlands SoilATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVAK
Ga0307472_10263485523300032205Hardwood Forest SoilQDAHEQPNERYNSLQDANFQLERARITLLRATGNLESWIGVGK
Ga0335079_1001334113300032783SoilRTNAEGLYNQLQDANFELERARITLLRATGSLESWVMAGN
Ga0335079_1050485423300032783SoilKDQSNQRFDALQDSGFELEKARIALLRATGELADWAGVSK
Ga0335079_1100908413300032783SoilEEGNGTLHDEEDARNQANERYNALQNADFELERGRIALLRATGELDAWVGVSK
Ga0335078_1134608023300032805SoilDDARNLANERYNTLEDTTFELERAQIALLRATGELSSWVGLAK
Ga0335080_1034394213300032828SoilAQVRVDSGTATLHDLDDARTQASERYNALQDASFQLQRARIGLLRATGELENWVGIAK
Ga0335076_1104690023300032955SoilDLDDARTQADERYDALQDANFQLERARIALLRATGQLESWVGIAK
Ga0335077_1126296823300033158SoilAQVRMNSGAVTIHDLDDARTQADERYDALQDANFQLERARIALLRATGQLESWVGVAK
Ga0314866_011591_1026_11693300033807PeatlandLHEEEDARTQVNERYNSLQDADFQLERARIMLLRSTGDLSSWAGVDK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.