| Basic Information | |
|---|---|
| Family ID | F069074 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.645 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.097 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02310 | B12-binding | 31.45 |
| PF04055 | Radical_SAM | 17.74 |
| PF01928 | CYTH | 3.23 |
| PF13536 | EmrE | 1.61 |
| PF00494 | SQS_PSY | 1.61 |
| PF15631 | Imm-NTF2-2 | 1.61 |
| PF01593 | Amino_oxidase | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF02586 | SRAP | 0.81 |
| PF08450 | SGL | 0.81 |
| PF07811 | TadE | 0.81 |
| PF00892 | EamA | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 1.61 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.81 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.65 % |
| Unclassified | root | N/A | 44.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10060053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300001977|JGI24746J21847_1059448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 545 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100025455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5162 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100785982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 832 | Open in IMG/M |
| 3300002561|JGI25384J37096_10052460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1544 | Open in IMG/M |
| 3300002853|draft_1020773 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300004156|Ga0062589_100552489 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005330|Ga0070690_100817525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
| 3300005364|Ga0070673_100351499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1308 | Open in IMG/M |
| 3300005455|Ga0070663_100131304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1902 | Open in IMG/M |
| 3300005467|Ga0070706_100403777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1272 | Open in IMG/M |
| 3300005534|Ga0070735_10903506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
| 3300005536|Ga0070697_101360838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300005546|Ga0070696_100060011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2659 | Open in IMG/M |
| 3300005557|Ga0066704_10443557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 858 | Open in IMG/M |
| 3300005559|Ga0066700_10175699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1467 | Open in IMG/M |
| 3300005560|Ga0066670_10056424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2058 | Open in IMG/M |
| 3300005587|Ga0066654_10648993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 587 | Open in IMG/M |
| 3300005610|Ga0070763_10424937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 750 | Open in IMG/M |
| 3300005764|Ga0066903_106135980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 629 | Open in IMG/M |
| 3300005921|Ga0070766_10793961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300006176|Ga0070765_101837237 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006358|Ga0068871_102273187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300006806|Ga0079220_10356728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 933 | Open in IMG/M |
| 3300007255|Ga0099791_10121987 | Not Available | 1208 | Open in IMG/M |
| 3300009176|Ga0105242_11337084 | Not Available | 742 | Open in IMG/M |
| 3300009521|Ga0116222_1058740 | Not Available | 1669 | Open in IMG/M |
| 3300009545|Ga0105237_10567077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300009665|Ga0116135_1127418 | Not Available | 938 | Open in IMG/M |
| 3300009665|Ga0116135_1404553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300009698|Ga0116216_10406759 | Not Available | 826 | Open in IMG/M |
| 3300009700|Ga0116217_10347617 | Not Available | 947 | Open in IMG/M |
| 3300009700|Ga0116217_10973575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009839|Ga0116223_10192732 | Not Available | 1248 | Open in IMG/M |
| 3300010046|Ga0126384_11842296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010321|Ga0134067_10066204 | Not Available | 1189 | Open in IMG/M |
| 3300010337|Ga0134062_10629321 | Not Available | 556 | Open in IMG/M |
| 3300010371|Ga0134125_10217893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2123 | Open in IMG/M |
| 3300010371|Ga0134125_11920291 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010371|Ga0134125_12367326 | Not Available | 577 | Open in IMG/M |
| 3300010379|Ga0136449_103718178 | Not Available | 576 | Open in IMG/M |
| 3300011120|Ga0150983_12295571 | Not Available | 1725 | Open in IMG/M |
| 3300012096|Ga0137389_10394538 | Not Available | 1181 | Open in IMG/M |
| 3300012096|Ga0137389_10731360 | Not Available | 850 | Open in IMG/M |
| 3300012189|Ga0137388_10042885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3617 | Open in IMG/M |
| 3300012198|Ga0137364_11416278 | Not Available | 514 | Open in IMG/M |
| 3300012201|Ga0137365_11104485 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012208|Ga0137376_11026373 | Not Available | 706 | Open in IMG/M |
| 3300012356|Ga0137371_10439028 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300012683|Ga0137398_10892335 | Not Available | 620 | Open in IMG/M |
| 3300012917|Ga0137395_10294793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1148 | Open in IMG/M |
| 3300012924|Ga0137413_11111594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300014200|Ga0181526_10060438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 2416 | Open in IMG/M |
| 3300014495|Ga0182015_10991132 | Not Available | 522 | Open in IMG/M |
| 3300014501|Ga0182024_12023505 | Not Available | 636 | Open in IMG/M |
| 3300015264|Ga0137403_10042866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4709 | Open in IMG/M |
| 3300015371|Ga0132258_10117839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6303 | Open in IMG/M |
| 3300015371|Ga0132258_13472844 | Not Available | 1080 | Open in IMG/M |
| 3300015373|Ga0132257_103525056 | Not Available | 569 | Open in IMG/M |
| 3300016270|Ga0182036_11402848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300017823|Ga0187818_10113734 | Not Available | 1172 | Open in IMG/M |
| 3300017943|Ga0187819_10423321 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300017966|Ga0187776_10818679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300017973|Ga0187780_10338955 | Not Available | 1061 | Open in IMG/M |
| 3300017993|Ga0187823_10138015 | Not Available | 760 | Open in IMG/M |
| 3300017999|Ga0187767_10046341 | Not Available | 1061 | Open in IMG/M |
| 3300018012|Ga0187810_10532250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300018043|Ga0187887_10275696 | Not Available | 994 | Open in IMG/M |
| 3300018043|Ga0187887_10657486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300018047|Ga0187859_10622573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300018062|Ga0187784_11233064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300018085|Ga0187772_10216910 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300018088|Ga0187771_11181749 | Not Available | 649 | Open in IMG/M |
| 3300019789|Ga0137408_1269463 | Not Available | 1467 | Open in IMG/M |
| 3300020002|Ga0193730_1164213 | Not Available | 575 | Open in IMG/M |
| 3300020580|Ga0210403_10188422 | Not Available | 1692 | Open in IMG/M |
| 3300021178|Ga0210408_11378020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021180|Ga0210396_10094880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2701 | Open in IMG/M |
| 3300021180|Ga0210396_10662160 | Not Available | 904 | Open in IMG/M |
| 3300021403|Ga0210397_10121308 | Not Available | 1793 | Open in IMG/M |
| 3300021404|Ga0210389_11060003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300021407|Ga0210383_11431509 | Not Available | 574 | Open in IMG/M |
| 3300021420|Ga0210394_10231817 | Not Available | 1614 | Open in IMG/M |
| 3300021478|Ga0210402_10350375 | Not Available | 1370 | Open in IMG/M |
| 3300021559|Ga0210409_10146860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2161 | Open in IMG/M |
| 3300025924|Ga0207694_10909152 | Not Available | 744 | Open in IMG/M |
| 3300026334|Ga0209377_1098459 | Not Available | 1217 | Open in IMG/M |
| 3300026547|Ga0209156_10263433 | Not Available | 793 | Open in IMG/M |
| 3300027625|Ga0208044_1156157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027641|Ga0208827_1161407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300027737|Ga0209038_10219386 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300027768|Ga0209772_10219321 | Not Available | 603 | Open in IMG/M |
| 3300027846|Ga0209180_10156345 | Not Available | 1314 | Open in IMG/M |
| 3300027853|Ga0209274_10482656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300027855|Ga0209693_10402723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300027867|Ga0209167_10232869 | Not Available | 986 | Open in IMG/M |
| 3300027875|Ga0209283_10562166 | Not Available | 727 | Open in IMG/M |
| 3300027879|Ga0209169_10286749 | Not Available | 864 | Open in IMG/M |
| 3300027884|Ga0209275_10019626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3009 | Open in IMG/M |
| 3300027905|Ga0209415_10476636 | Not Available | 971 | Open in IMG/M |
| 3300028037|Ga0265349_1024455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300028807|Ga0307305_10500219 | Not Available | 545 | Open in IMG/M |
| 3300028906|Ga0308309_11214042 | Not Available | 650 | Open in IMG/M |
| 3300030494|Ga0310037_10342343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300030707|Ga0310038_10338309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300030707|Ga0310038_10517647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300030862|Ga0265753_1052128 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300030940|Ga0265740_1003610 | Not Available | 1165 | Open in IMG/M |
| 3300031708|Ga0310686_115393438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8405 | Open in IMG/M |
| 3300031771|Ga0318546_10797430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300031962|Ga0307479_11591254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300031981|Ga0318531_10005745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4388 | Open in IMG/M |
| 3300031996|Ga0308176_10531506 | Not Available | 1199 | Open in IMG/M |
| 3300032160|Ga0311301_10319962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2462 | Open in IMG/M |
| 3300032205|Ga0307472_102634855 | Not Available | 513 | Open in IMG/M |
| 3300032783|Ga0335079_10013341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9383 | Open in IMG/M |
| 3300032783|Ga0335079_10504854 | Not Available | 1289 | Open in IMG/M |
| 3300032783|Ga0335079_11009084 | Not Available | 848 | Open in IMG/M |
| 3300032805|Ga0335078_11346080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300032828|Ga0335080_10343942 | Not Available | 1610 | Open in IMG/M |
| 3300032955|Ga0335076_11046900 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300033158|Ga0335077_11262968 | Not Available | 719 | Open in IMG/M |
| 3300033807|Ga0314866_011591 | Not Available | 1184 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.10% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100600533 | 3300001545 | Forest Soil | SVGWHDVQDAREQADERYNSLRDANFELERARITLLRATGELESWVGAAK* |
| JGI24746J21847_10594481 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | DTATLHELDDARTQAAERYLAAQDAAIELARARIALMRSTGELEKWVQAGQD* |
| JGIcombinedJ26739_1000254556 | 3300002245 | Forest Soil | LSERYNSLQDANFELERARITLLRATGELEAWVGAGN* |
| JGIcombinedJ26739_1007859823 | 3300002245 | Forest Soil | GWHDVQDAREQADERYNSLRDANFELERARITLLRATGELESWVGAAK* |
| JGI25384J37096_100524601 | 3300002561 | Grasslands Soil | TATLHDVXDARMQANERYNALQDTSFELQKARITLLRATDELAAWAGVGK* |
| draft_10207731 | 3300002853 | Hydrocarbon Resource Environments | SVSASLHDLDDARNQANEHYDAMQDTNFELERARISLLRTTGDLEAWIGVGK* |
| Ga0062589_1005524891 | 3300004156 | Soil | ATLHELDDARAQAAERYLASQDAALELDRARIALMRSTGGLEKWVEAGQE* |
| Ga0070690_1008175252 | 3300005330 | Switchgrass Rhizosphere | SAAWHDVQDAREQVNQRYNSLQDANFELERARITLLRATGELASWAGAGQ* |
| Ga0070673_1003514992 | 3300005364 | Switchgrass Rhizosphere | VQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ* |
| Ga0070663_1001313041 | 3300005455 | Corn Rhizosphere | AAWHDVQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ* |
| Ga0070706_1004037772 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DVGTASFHDVEDARNQATERFNALQDANFEVERARIALLRATGELESWVGIGK* |
| Ga0070735_109035061 | 3300005534 | Surface Soil | NERYVALADTNFELQRARISLLRATGDLETWVGVGK* |
| Ga0070697_1013608381 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | WHDVQDAREQLNERYNSLQDANFELERARITLLRATGELASWAGAGQ* |
| Ga0070696_1000600111 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DVQDAREQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK* |
| Ga0070665_1010611101 | 3300005548 | Switchgrass Rhizosphere | RYHAFQSADFELQRAKIGLLRATGDLESWVGIPK* |
| Ga0066704_104435572 | 3300005557 | Soil | TATLHDVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK* |
| Ga0066700_101756992 | 3300005559 | Soil | DVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK* |
| Ga0066670_100564241 | 3300005560 | Soil | ANERFGALQDADFELERARIALLRATGELESWVGVGK* |
| Ga0066654_106489932 | 3300005587 | Soil | QVRLDAGTASFHDLEDARDQANERFNALQDVNFEVERARIALLRATGELENWVGVGK* |
| Ga0070763_104249371 | 3300005610 | Soil | LHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK* |
| Ga0066903_1061359801 | 3300005764 | Tropical Forest Soil | RNQVNERFGALQDANFELERARITLIRATGELENWVGIGK* |
| Ga0070766_107939611 | 3300005921 | Soil | RNQVNERYDALQDTNFDLQRARISLLRTTGELEDWVGVGK* |
| Ga0070765_1018372371 | 3300006176 | Soil | RYNQLQDANFELDRSRIELLRATGDLEAWVEAAPSQ* |
| Ga0068871_1022731871 | 3300006358 | Miscanthus Rhizosphere | VEDAREQASERFISLGDTSYELEKARITLLRATGELESWVGLAR* |
| Ga0079220_103567281 | 3300006806 | Agricultural Soil | QDERYNSLQDANFQLERARITLLRATGDLERWVGVGK* |
| Ga0099791_101219872 | 3300007255 | Vadose Zone Soil | ATLHDVEDARMQANERYNALQDTSFELQKARITLLRATDELAAWAGVGK* |
| Ga0105242_113370841 | 3300009176 | Miscanthus Rhizosphere | EQVNERYNSLQDANFELERARITLLRATGELAGWVGAGQ* |
| Ga0116222_10587401 | 3300009521 | Peatlands Soil | HEQYDALQDTNFELQRARISLLRATGELEAWVGVTK* |
| Ga0105237_105670771 | 3300009545 | Corn Rhizosphere | AADTATLHELDDARTQAAERYLAAQDAAIELARARIALMRSTGELEKWVQAGQD* |
| Ga0116135_11274181 | 3300009665 | Peatland | NERYDALQDTNFDLQRARISLLRATGELEDWVGVGK* |
| Ga0116135_14045531 | 3300009665 | Peatland | KSDLDATQTRVDSGSATLHDLDDARNQVNERYDALQDTNFELQRARIGLLRVTGELEDWVGVGK* |
| Ga0116216_104067591 | 3300009698 | Peatlands Soil | HDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK* |
| Ga0116217_103476172 | 3300009700 | Peatlands Soil | ATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK* |
| Ga0116217_109735751 | 3300009700 | Peatlands Soil | DDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVAK* |
| Ga0116223_101927322 | 3300009839 | Peatlands Soil | EQYDALQDTNFELQRARISLLRATGELEAWVGVAK* |
| Ga0126384_118422962 | 3300010046 | Tropical Forest Soil | ANERYNGLLDASFELQRARIALLRVTGELAKWVSGQK* |
| Ga0134067_100662041 | 3300010321 | Grasslands Soil | ALQVRLDAGTASFHDLEDARDQANERFNALQDANFEVERARIALLRATGELENWVGVGK* |
| Ga0134062_106293211 | 3300010337 | Grasslands Soil | MDDARTQSNERYHAFQSADFELQRARIGLLRATGELEIWAGVPK* |
| Ga0134125_102178931 | 3300010371 | Terrestrial Soil | QVRVDAGSATLHDMDDARTQSNERYHAFQSADFELQRARIGLLRATGELETWVGVPK* |
| Ga0134125_119202912 | 3300010371 | Terrestrial Soil | EQLNERYNSLQDANFELERARITLLRATGELASWAGAVQ* |
| Ga0134125_123673262 | 3300010371 | Terrestrial Soil | QDAREQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK* |
| Ga0136449_1037181781 | 3300010379 | Peatlands Soil | EQYDALQDTNFELQRARISLLRATGELEAWVGVTK* |
| Ga0150983_122955712 | 3300011120 | Forest Soil | ERYDALQDTSFELERARISLLRATGDLEAWVGVGK* |
| Ga0137389_103945381 | 3300012096 | Vadose Zone Soil | QVNERYNSLQDANFELERARITLLRATGELEAWVGAGK* |
| Ga0137389_107313601 | 3300012096 | Vadose Zone Soil | ATLHDVEDARGQANQRYNALQDVNFELERARIALLRATGELETWVGAGK* |
| Ga0137388_100428851 | 3300012189 | Vadose Zone Soil | VRVDAGTATVHDAEDARNQADERFNALQDANFQLERARIILLRATGVLETWVGAGR* |
| Ga0137364_114162782 | 3300012198 | Vadose Zone Soil | DAGSATIHDLQDARDQANERYNVLQDSSFELERAQIALLRATGELAIWVGISK* |
| Ga0137365_111044852 | 3300012201 | Vadose Zone Soil | RYHALQSADFELERAKIGLLRATGELENWVGVPK* |
| Ga0137376_110263731 | 3300012208 | Vadose Zone Soil | IHDLQDARDQANDRYNILQDSNFELERAQIALLRTTGDLANWVGVSK* |
| Ga0137371_104390282 | 3300012356 | Vadose Zone Soil | KINERYHALQSAAFELERAKIGLLRATGELENWVGVPK* |
| Ga0137398_108923352 | 3300012683 | Vadose Zone Soil | HEVQDAREQSSERYNSLQDANFQLERARITLLRATGGLEGWVGVGK* |
| Ga0137395_102947931 | 3300012917 | Vadose Zone Soil | ERFNALQDANFEVERARIALLRATGELENWVGVGK* |
| Ga0137413_111115941 | 3300012924 | Vadose Zone Soil | SNERYHALQSANFELERARIGLLRATGELEGWLGIPK* |
| Ga0181526_100604383 | 3300014200 | Bog | VDSGSATLHDLDDARNQVNERYDALEDTNFELQRARISLLRATGELEDWVGVGK* |
| Ga0182015_109911322 | 3300014495 | Palsa | DEADARNQVNERYNALQDSNFDLERARITLLRSTGDLEKWARGEN* |
| Ga0182024_120235052 | 3300014501 | Permafrost | QANLQALETRVDSGTAALHDEADARNQANERYNALQDSNFELQRARITLLRSTGDLEKWAMGEN* |
| Ga0137403_100428664 | 3300015264 | Vadose Zone Soil | MFPSPSPLESHHVRIDAGTANLHDMDDARNQSNERYHALQSADFELERAKIGLLRATGELEDWVGVPK* |
| Ga0132258_101178391 | 3300015371 | Arabidopsis Rhizosphere | NLHELDDARNQTNQLYHTLQSANFELQRAKIALLRTTGELENWIGVSK* |
| Ga0132258_134728442 | 3300015371 | Arabidopsis Rhizosphere | NERYNSLQDATFELERAGITLLRATGELEAWVNAGK* |
| Ga0132257_1035250562 | 3300015373 | Arabidopsis Rhizosphere | EQLNERYNSLQDATFELERAGITLLRATGELEAWVNAGK* |
| Ga0182036_114028481 | 3300016270 | Soil | TATLHDEDDARNLANERFNTLEDTTFELERAQIALLRATGELSSWVGLAK |
| Ga0187818_101137341 | 3300017823 | Freshwater Sediment | EYQLAESNRDAVQVRMDAGTATLRDGEDARTQENTRYDALQDANFELERARITLLRSTGDLDNWVGVGK |
| Ga0187819_104233212 | 3300017943 | Freshwater Sediment | DDARNQANEQYDALQDTNFELQRARISLLRATGELEAWVGVIK |
| Ga0187776_108186791 | 3300017966 | Tropical Peatland | DDARNQANERYNTLEDTTFEVERAQIALLRATGELSSWVGVAK |
| Ga0187780_103389551 | 3300017973 | Tropical Peatland | EDEARNQANERYVALQDTRFELQRARIALLRAIGDLSSWLGLSK |
| Ga0187823_101380151 | 3300017993 | Freshwater Sediment | TRVNAGNGTWHDAEDAREQADARYNALQDASFDLERSRIALLRATGGLATWLGVIP |
| Ga0187767_100463411 | 3300017999 | Tropical Peatland | EDDARNQASERYDTLQDTRFELQRARIALLRATGDLGSWLGLSSK |
| Ga0187810_105322501 | 3300018012 | Freshwater Sediment | ANERYDALQDTNFELERARINLLRATGELESWVGVGK |
| Ga0187887_102756962 | 3300018043 | Peatland | ARVLVTERFNSLQDADFELERARIGLLRVTGDLPAWVGLNTAGPNK |
| Ga0187887_106574861 | 3300018043 | Peatland | TRVDSGSATLHDLDDARNQVNERYDALEDTNFELQRARISLLRATGELEDWVGVGK |
| Ga0187859_106225731 | 3300018047 | Peatland | SNLDATQTRVDSGSATLHDLDDARNQANEHYDALQDTNFELQRARISLLRVTGELEAWVGVGK |
| Ga0187784_112330641 | 3300018062 | Tropical Peatland | NQANERYDTLQDTRFELQRARIALLRATGDLSSWLGLNK |
| Ga0187772_102169101 | 3300018085 | Tropical Peatland | SERYGALQDANFELQRARITLLRATGEISDWVGVEK |
| Ga0187771_111817492 | 3300018088 | Tropical Peatland | LHEEDDAHNQANERYDTLQDTRFELQRARIALLRATGDLSSWLGLAK |
| Ga0137408_12694632 | 3300019789 | Vadose Zone Soil | TASFHDVEDARDQANERFNALQDANFEVERARIALLRASGELGNWVGVGK |
| Ga0193730_11642132 | 3300020002 | Soil | ERYNSLQDANFQLERARITLLRATGGLEDWIGGSK |
| Ga0210403_101884222 | 3300020580 | Soil | TANWHDVQDAREQSSDRYNSLQDANFQLERARITLLRATGELESWVGVGK |
| Ga0210408_113780201 | 3300021178 | Soil | AKNQAAEHYDALQDANFELQRARISLLRATGEIESWVGVGK |
| Ga0210396_100948804 | 3300021180 | Soil | VDSGSATLRDLDDARNQANERYDALQDTNFELQRARISLLRVTGELEDWVGIGK |
| Ga0210396_106621601 | 3300021180 | Soil | GRATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAGVGVGK |
| Ga0210397_101213082 | 3300021403 | Soil | DARNQVNERYDALQDTNFELQRARISLLRATGELEAWVGIQK |
| Ga0210389_110600031 | 3300021404 | Soil | GSATHHDLDDARSQVNERYDALQDTNFELQRARISLLRATGELEAWVGIQK |
| Ga0210383_114315092 | 3300021407 | Soil | QVNERYDALQDTNFELQRARISLLRVTGELEAWVGVGK |
| Ga0210394_102318172 | 3300021420 | Soil | VDSGSATLHELDDARGQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0210402_103503752 | 3300021478 | Soil | LSERYNSLQDANFELERARITLLRATGELEAWVGAGN |
| Ga0210409_101468603 | 3300021559 | Soil | VQDAREQLSERYNSLQDANFELERARITLLRATGELEAWIGAGN |
| Ga0207694_109091521 | 3300025924 | Corn Rhizosphere | GSAAWHDVQDAREQVNERYNSLQDANFELERARITLLRATGELASWAGAGQ |
| Ga0209377_10984592 | 3300026334 | Soil | DAGTATLHDVEDARSQANERYNTLQDSSFELQKARITLLRAMDELATWAGVGK |
| Ga0209156_102634332 | 3300026547 | Soil | QANDRYNALQDANFELQRARISLLRATGELEGWVGVGK |
| Ga0208044_11561571 | 3300027625 | Peatlands Soil | SATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0208827_11614071 | 3300027641 | Peatlands Soil | SATLHDLDDARNQANEQYDALQDTNFELQRARISLLRATGELEAWVGVTK |
| Ga0209038_102193862 | 3300027737 | Bog Forest Soil | AATLHDLDDARNQVNERYDALQDTNFDLQRARISLLRATGELEDWVGVGK |
| Ga0209772_102193212 | 3300027768 | Bog Forest Soil | TLHDAEDARIQANEHYNQLQDANFELQRGRIELLRTTGDLESWVEGGNSN |
| Ga0209180_101563451 | 3300027846 | Vadose Zone Soil | ERYNALQDTSFELQKARITLLRATDELAAWAGVGK |
| Ga0209274_104826561 | 3300027853 | Soil | DDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0209693_104027231 | 3300027855 | Soil | VDAGGATVHDLDDARNQANERYDALQDTNFELERARISLLRVTGELEAWVGVGK |
| Ga0209167_102328692 | 3300027867 | Surface Soil | LDALQIRVDAGSATLHDLDDANNQVNERYDALQDTNFELQRARISLLRATGELEAWVGAG |
| Ga0209283_105621662 | 3300027875 | Vadose Zone Soil | EQSNERYSSLQDANFELERARITLLRAMGELESWLGVGK |
| Ga0209169_102867491 | 3300027879 | Soil | ARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0209275_100196261 | 3300027884 | Soil | RGQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0209415_104766361 | 3300027905 | Peatlands Soil | ATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK |
| Ga0265349_10244551 | 3300028037 | Soil | TQTRVDSGSATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0307305_105002192 | 3300028807 | Soil | EQTSERYNSLQDANFQLERARITLLRATGELEGWIGVGK |
| Ga0308309_112140421 | 3300028906 | Soil | RYNQLQDANFELDRSRIELLRATGDLEAWVEAAPSQ |
| Ga0310037_103423432 | 3300030494 | Peatlands Soil | LDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0310038_103383091 | 3300030707 | Peatlands Soil | IQVRVDAGSATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVTK |
| Ga0310038_105176471 | 3300030707 | Peatlands Soil | RANERFDALQDANFELQRARILLLRATGDLEAWVGVASK |
| Ga0265753_10521282 | 3300030862 | Soil | ADSGSATLHDLDDARSQANERYDALQDPNFELQRARISLLRATGELEAWVGVGK |
| Ga0265740_10036102 | 3300030940 | Soil | DSGSATLHDLDDARSQANERYDALQDTNFELQRARISLLRATGELEAWVGVGK |
| Ga0310686_1153934387 | 3300031708 | Soil | KSTLDAAQVRMESGSATLHDAEDARVQSNERFGALQDANFELDRARITLLRLTGELGSWVGVTN |
| Ga0318546_107974302 | 3300031771 | Soil | ANERFNTLEDTTFELERAQIALLRATGELSSWVGLAK |
| Ga0307479_115912541 | 3300031962 | Hardwood Forest Soil | AEMTEKYGALQDANFQLVRAKIGLLRATGELEAWAGQAK |
| Ga0318531_100057456 | 3300031981 | Soil | LSERYIALQDTNFELQRARIGLLRSTGELEKWINGGL |
| Ga0308176_105315062 | 3300031996 | Soil | QQVNERYLSLQDMKFELEKSRIMLLRATGELENWVGK |
| Ga0311301_103199621 | 3300032160 | Peatlands Soil | ATLHDLDDARNQAHEQYDALQDTNFELQRARISLLRATGELEAWVGVAK |
| Ga0307472_1026348552 | 3300032205 | Hardwood Forest Soil | QDAHEQPNERYNSLQDANFQLERARITLLRATGNLESWIGVGK |
| Ga0335079_100133411 | 3300032783 | Soil | RTNAEGLYNQLQDANFELERARITLLRATGSLESWVMAGN |
| Ga0335079_105048542 | 3300032783 | Soil | KDQSNQRFDALQDSGFELEKARIALLRATGELADWAGVSK |
| Ga0335079_110090841 | 3300032783 | Soil | EEGNGTLHDEEDARNQANERYNALQNADFELERGRIALLRATGELDAWVGVSK |
| Ga0335078_113460802 | 3300032805 | Soil | DDARNLANERYNTLEDTTFELERAQIALLRATGELSSWVGLAK |
| Ga0335080_103439421 | 3300032828 | Soil | AQVRVDSGTATLHDLDDARTQASERYNALQDASFQLQRARIGLLRATGELENWVGIAK |
| Ga0335076_110469002 | 3300032955 | Soil | DLDDARTQADERYDALQDANFQLERARIALLRATGQLESWVGIAK |
| Ga0335077_112629682 | 3300033158 | Soil | AQVRMNSGAVTIHDLDDARTQADERYDALQDANFQLERARIALLRATGQLESWVGVAK |
| Ga0314866_011591_1026_1169 | 3300033807 | Peatland | LHEEEDARTQVNERYNSLQDADFQLERARIMLLRSTGDLSSWAGVDK |
| ⦗Top⦘ |