NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069072

Metagenome / Metatranscriptome Family F069072

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069072
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 109 residues
Representative Sequence VYLPTAFAQQARFQAAVARAAQRLTPHVVGIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNITNQVSQATVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPTLV
Number of Associated Samples 103
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 41.13 %
% of genes near scaffold ends (potentially truncated) 36.29 %
% of genes from short scaffolds (< 2000 bps) 79.84 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.79

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.903 % of family members)
Environment Ontology (ENVO) Unclassified
(29.032 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.548 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.85%    β-sheet: 20.30%    Coil/Unstructured: 39.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.79
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
e.23.1.1: Acetyl-CoA synthetase-liked1nnma_1nnm0.6163
d.80.1.3: MIF-relatedd3kana_3kan0.61239
d.218.1.2: DNA polymerase beta-liked2fmpa32fmp0.61131
e.23.1.0: automated matchesd6m2oa_6m2o0.60091
e.23.1.0: automated matchesd3eyna_3eyn0.59842


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF02321OEP 8.06
PF13280WYL 2.42
PF00589Phage_integrase 2.42
PF01979Amidohydro_1 1.61
PF08357SEFIR 1.61
PF01416PseudoU_synth_1 1.61
PF16277DUF4926 1.61
PF03682UPF0158 1.61
PF01663Phosphodiest 1.61
PF01011PQQ 0.81
PF01425Amidase 0.81
PF02811PHP 0.81
PF00593TonB_dep_Rec 0.81
PF07676PD40 0.81
PF00480ROK 0.81
PF09996DUF2237 0.81
PF01610DDE_Tnp_ISL3 0.81
PF08241Methyltransf_11 0.81
PF01266DAO 0.81
PF00171Aldedh 0.81
PF02597ThiS 0.81
PF12543DUF3738 0.81
PF01161PBP 0.81
PF01408GFO_IDH_MocA 0.81
PF01467CTP_transf_like 0.81
PF04191PEMT 0.81
PF02566OsmC 0.81
PF01713Smr 0.81
PF00571CBS 0.81
PF00873ACR_tran 0.81
PF06441EHN 0.81
PF02604PhdYeFM_antitox 0.81
PF00106adh_short 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 16.13
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 1.61
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.61
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.81
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.81
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.81
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.81
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.81
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.81
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.81
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.81
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.81
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.81
COG3464TransposaseMobilome: prophages, transposons [X] 0.81
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.81
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10002119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus14618Open in IMG/M
3300003310|D1draft_1006993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5196Open in IMG/M
3300004082|Ga0062384_100145976All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300004092|Ga0062389_100671260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1207Open in IMG/M
3300004092|Ga0062389_101846116All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium783Open in IMG/M
3300004092|Ga0062389_102086224All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4742Open in IMG/M
3300004114|Ga0062593_102416936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4593Open in IMG/M
3300004631|Ga0058899_10809037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4525Open in IMG/M
3300004635|Ga0062388_101393862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4703Open in IMG/M
3300004635|Ga0062388_102614760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4530Open in IMG/M
3300005541|Ga0070733_10005388All Organisms → cellular organisms → Bacteria8441Open in IMG/M
3300005591|Ga0070761_10438409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4800Open in IMG/M
3300005617|Ga0068859_101454366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4756Open in IMG/M
3300005617|Ga0068859_102429302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4577Open in IMG/M
3300005764|Ga0066903_102106009All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300005841|Ga0068863_100891895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium889Open in IMG/M
3300005938|Ga0066795_10112481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4810Open in IMG/M
3300006059|Ga0075017_100398334All Organisms → cellular organisms → Bacteria → Acidobacteria1032Open in IMG/M
3300006059|Ga0075017_101299030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4571Open in IMG/M
3300006176|Ga0070765_101914053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4555Open in IMG/M
3300006854|Ga0075425_102887766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4527Open in IMG/M
3300009012|Ga0066710_101038153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41266Open in IMG/M
3300009012|Ga0066710_103316753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4614Open in IMG/M
3300009029|Ga0066793_10550168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4658Open in IMG/M
3300009038|Ga0099829_11533551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4550Open in IMG/M
3300009088|Ga0099830_10983420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4699Open in IMG/M
3300009089|Ga0099828_10760468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4869Open in IMG/M
3300009137|Ga0066709_103474583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4572Open in IMG/M
3300009521|Ga0116222_1070137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41515Open in IMG/M
3300009522|Ga0116218_1140905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41095Open in IMG/M
3300009628|Ga0116125_1003058All Organisms → cellular organisms → Bacteria5819Open in IMG/M
3300009644|Ga0116121_1139449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4765Open in IMG/M
3300009644|Ga0116121_1145246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4748Open in IMG/M
3300009762|Ga0116130_1197902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4636Open in IMG/M
3300009839|Ga0116223_10105038All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300010379|Ga0136449_100129220All Organisms → cellular organisms → Bacteria5040Open in IMG/M
3300010379|Ga0136449_101047623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41306Open in IMG/M
3300010379|Ga0136449_102406579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4759Open in IMG/M
3300011269|Ga0137392_10083790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42479Open in IMG/M
3300011271|Ga0137393_10660776All Organisms → cellular organisms → Bacteria → Acidobacteria896Open in IMG/M
3300012096|Ga0137389_10780088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4821Open in IMG/M
3300012205|Ga0137362_11038707All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4697Open in IMG/M
3300012209|Ga0137379_11694007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300012350|Ga0137372_10275932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41312Open in IMG/M
3300012353|Ga0137367_10299464All Organisms → cellular organisms → Bacteria → Acidobacteria1151Open in IMG/M
3300012356|Ga0137371_10464968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4978Open in IMG/M
3300012362|Ga0137361_11141068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4701Open in IMG/M
3300012917|Ga0137395_10443130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4932Open in IMG/M
3300012929|Ga0137404_12313040All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4503Open in IMG/M
3300012930|Ga0137407_12252654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4521Open in IMG/M
3300013308|Ga0157375_12942079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4569Open in IMG/M
3300014160|Ga0181517_10178549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41175Open in IMG/M
3300014164|Ga0181532_10056429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42570Open in IMG/M
3300014165|Ga0181523_10137983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41443Open in IMG/M
3300014199|Ga0181535_10015018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6713Open in IMG/M
3300014200|Ga0181526_10040369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42992Open in IMG/M
3300014326|Ga0157380_10115778All Organisms → cellular organisms → Bacteria2261Open in IMG/M
3300014489|Ga0182018_10141955All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300014491|Ga0182014_10173135All Organisms → cellular organisms → Bacteria → Acidobacteria1193Open in IMG/M
3300014493|Ga0182016_10445962All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300014494|Ga0182017_10581146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4683Open in IMG/M
3300014501|Ga0182024_11134641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4920Open in IMG/M
3300014502|Ga0182021_11703246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4759Open in IMG/M
3300014657|Ga0181522_10055620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42232Open in IMG/M
3300014658|Ga0181519_10165461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41404Open in IMG/M
3300014839|Ga0182027_10211673All Organisms → cellular organisms → Bacteria → Acidobacteria2241Open in IMG/M
3300014839|Ga0182027_11030191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4840Open in IMG/M
3300015053|Ga0137405_1339468All Organisms → cellular organisms → Bacteria3562Open in IMG/M
3300016750|Ga0181505_10023356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4689Open in IMG/M
3300017946|Ga0187879_10088433All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300017946|Ga0187879_10867262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4505Open in IMG/M
3300017970|Ga0187783_10060243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42800Open in IMG/M
3300017970|Ga0187783_11117310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4568Open in IMG/M
3300017988|Ga0181520_10239692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41394Open in IMG/M
3300018017|Ga0187872_10391187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4590Open in IMG/M
3300018034|Ga0187863_10018409All Organisms → cellular organisms → Bacteria → Acidobacteria4306Open in IMG/M
3300018034|Ga0187863_10025599All Organisms → cellular organisms → Bacteria3545Open in IMG/M
3300018037|Ga0187883_10028192All Organisms → cellular organisms → Bacteria → Acidobacteria3062Open in IMG/M
3300018037|Ga0187883_10352595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4752Open in IMG/M
3300018038|Ga0187855_10287528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4962Open in IMG/M
3300018044|Ga0187890_10036689All Organisms → cellular organisms → Bacteria2961Open in IMG/M
3300018046|Ga0187851_10760953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4545Open in IMG/M
3300018047|Ga0187859_10009376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5683Open in IMG/M
3300018047|Ga0187859_10360205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4794Open in IMG/M
3300018081|Ga0184625_10137868All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300018431|Ga0066655_10345857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4975Open in IMG/M
3300018476|Ga0190274_11613307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4742Open in IMG/M
3300020582|Ga0210395_10438786All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300020583|Ga0210401_11158569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4632Open in IMG/M
3300021170|Ga0210400_10140003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41943Open in IMG/M
3300021478|Ga0210402_10005474All Organisms → cellular organisms → Bacteria11359Open in IMG/M
3300021479|Ga0210410_10516243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41066Open in IMG/M
3300023091|Ga0224559_1120726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4954Open in IMG/M
3300023259|Ga0224551_1055924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4688Open in IMG/M
3300025473|Ga0208190_1094464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4589Open in IMG/M
3300026294|Ga0209839_10056495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41408Open in IMG/M
3300027570|Ga0208043_1201351All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4503Open in IMG/M
3300027867|Ga0209167_10009294All Organisms → cellular organisms → Bacteria → Acidobacteria4694Open in IMG/M
3300027911|Ga0209698_11364829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300029636|Ga0222749_10082940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1477Open in IMG/M
3300030606|Ga0299906_10345490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41157Open in IMG/M
3300031057|Ga0170834_109725492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4908Open in IMG/M
3300031231|Ga0170824_105535151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4909Open in IMG/M
3300031234|Ga0302325_10632000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1565Open in IMG/M
3300031236|Ga0302324_101245551All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4987Open in IMG/M
3300031525|Ga0302326_10850500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761306Open in IMG/M
3300031525|Ga0302326_11165808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41064Open in IMG/M
3300031525|Ga0302326_11223862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41031Open in IMG/M
3300032046|Ga0315289_10239963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41934Open in IMG/M
3300032118|Ga0315277_10243059All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300032160|Ga0311301_10029731All Organisms → cellular organisms → Bacteria14266Open in IMG/M
3300032160|Ga0311301_10109844All Organisms → cellular organisms → Bacteria5301Open in IMG/M
3300032160|Ga0311301_11731802All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300032160|Ga0311301_12240793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4625Open in IMG/M
3300032261|Ga0306920_104041493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4532Open in IMG/M
3300032401|Ga0315275_10932666All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300032515|Ga0348332_11305696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4510Open in IMG/M
3300032515|Ga0348332_13011237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4646Open in IMG/M
3300032770|Ga0335085_10000208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia183381Open in IMG/M
3300032805|Ga0335078_10584314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41413Open in IMG/M
3300032895|Ga0335074_10022892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8808Open in IMG/M
3300032897|Ga0335071_10924242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4820Open in IMG/M
3300033521|Ga0316616_103499696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300034065|Ga0334827_084164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41081Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland10.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.45%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.23%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.23%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.42%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.61%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Down-Flow Hanging Sponge ReactorEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300003310Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHSEngineeredOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_10002119113300000567Peatlands SoilVARAAQRLAPHVVSIIPTLGSDWSGEPAVFFMVILADAASRHEKLLNVSNQVEQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPTLA*
D1draft_100699373300003310Down-Flow Hanging Sponge ReactorVYVPKAFAQQAQFEAAVEQAAKRLAPNVVNIIPTLDNDWSGEPAVFFMVILADAASRRDQLLAISNQVSEHIVQKVQPLEQWGVLPYFNFRSQSEQTKLDQPALV*
Ga0062384_10014597623300004082Bog Forest SoilVYVPKAFASQAEFEAAVSRAARGLAPVVRVIPTLGNDWSGEPAVFFMVILSDAASSRRDQLLNIAEGVSKAIVGQLEPVEQWGVRPYFNFRSQSEQAKLEPTLA*
Ga0062389_10067126023300004092Bog Forest SoilVYVPRAFVHQDQFQAEVRRVAEGLAPEVVEIISTLGNDWSGETAVFFMVILADTATRRDRLLGITNRVSQVMVEQVQPLEEWGVLPYFNFRSKSEQANIEQRTVA*
Ga0062389_10184611613300004092Bog Forest SoilVKRVAKRLAPDVVSITPTLGDDWTGEPAAFFMVILADAATRRDQLRNVTNRVSEAIFQQVEPLERWEVFPFFNFRSQSEQAELDQRTVA*
Ga0062389_10208622413300004092Bog Forest SoilVVLGKAVPGAVRSWIKCFSLEAKARDNRVMYVPTAFAQKAQFQLVVNRAAEQLRPNVIDLTFALGNDWSGEPAVFFMVILSSAASHREQLLRITNQVSNAIVQRVQPLEQWGVLPYFNFRSEAEQAKINRESLAS*
Ga0062593_10241693623300004114SoilVAQILAPDVVGISPTLGNDWSGEPAVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEPVLAASDTRPVFRPRPDENSLRS*
Ga0058899_1080903723300004631Forest SoilARVAQRLAPDVVDIIPTLGNDWTGDPAVFFMVILADAATRRDRLLNASNQVQHAIVQQVQPLEKWGVLPYFNFRSQSEQANLKQPALG*
Ga0062388_10139386213300004635Bog Forest SoilKCFSLEAKARDNRVMYVPTAFAQKAQFQLVVNRAAEQLRPNVIDLTFALGNDWSGEPAVFFMVILSSAASHREQLLRITNQVSNAIVQRVQPLEQWGVLPYFNFRSEAEQAKINRESLAS
Ga0062388_10261476013300004635Bog Forest SoilVYVPTAFANQARFEAAVKQAAQHLPHDVVSVIPTLGNDWIGEPAVFFMVILEDAASRRDRLLNISNQVSQAIVEQVQPLEQWGVLPYFNFRSRSEQAKLNQPTLA*
Ga0070733_1000538833300005541Surface SoilVFDDEEVLHPLEAARDNGVVQLPTAFVQQARFQTAVSRAAQRLAPHGVVQIIPTLGEDWSGEPAVFFMVILTDAASRRDRLLNISNEVSQTIYQQVQPLEKWGVLPYFNFRSQSEQAKLDQPAMV*
Ga0070761_1043840913300005591SoilAAQQLRPHVMDVILTLGNDWSGEPAVFFMVILSNAASQRAQLLRVTNQVSNAIVQMVQPLEQWGVLPYFNFRSEAEQAQINQQSLAS*
Ga0068859_10145436623300005617Switchgrass RhizosphereMAAIDRAARSLAPDVVDIIPTLGNDWSGEPAVFLMVILSDGAASRHDQLLNVTNRVSKFIVQHVAPLEEWDVLPYFSFRSQSEQAKLEPSWAETNGIFR*
Ga0068859_10242930213300005617Switchgrass RhizosphereRVAQILAPDVVGISPTLGNDWSGEPAVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEPVLAASDTRPVFRPRPDENSLRS*
Ga0066903_10210600933300005764Tropical Forest SoilMQVPTAFVHQAQFSRAVARAAQRLAPDVVSKIPTLRNDWSGEPAVFFMVILSDAASLRDRILTTSNRVQQVLNDEVQLLEQWGVLPYFNFRSQSEQARLDQLAVA*
Ga0068863_10089189513300005841Switchgrass RhizosphereMHAPPAFVRQSQFYAAVARVAQILAPDVVGISPTLGNDWSGEPAVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEP
Ga0066795_1011248123300005938SoilNGFVYVPTAFAQQARFQAAVARAAQRLAPHVVSIIPTLGNDWVGEPAVFFMVILADAASRRDQLWNISNQVSEAIVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPALA*
Ga0075017_10039833423300006059WatershedsVAATRSIQTRDNGVVHVPPAFVDQARFNATIERAARRLAPQVVRIIPTLGDDWSGEPSVFFMVILADEATAHDRLLGATKRVSQAIVGQVQPLEQWGVLPYFNFRSQSEQAKLDQLALV*
Ga0075017_10129903013300006059WatershedsHHCRLVYVPRAFTEQARFQAAVARGANSLPQVWSTLFQPLVTIGAESPRFLMVILADAASRRDRLLRVSNQVSQAIEQRVQPLEEWGVLPYFNFRSQSEQAKLNQLALA*
Ga0070765_10191405323300006176SoilMAFAQQAQFQSAVNLAAQQLRPHVMDVILTLGNDWSGEPAVFFMVILSNAASQRAQLLRVTNQVSNAIVQMVQPLEQWGVLPYFNFRSEAEQAQINQQSLAS*
Ga0075425_10288776613300006854Populus RhizosphereKQARFQAAVARAAQRLAPQVVNIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLTISNQVSQVIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPTLV*
Ga0066710_10103815313300009012Grasslands SoilMNVPRAFVHQSQFQAAIARASRRVAPDVVSITATLGNDWRGEPAVFFMVILSDAASSRERLLSVTDRVSKTMVGELEPLEEWGVLPYFNFRSQSEQAKLNEPTLA
Ga0066710_10331675313300009012Grasslands SoilVRACWRKSESRDYRSYPLLARTRDNRVVYVPAAFAQQARFQAAVARAAQRLAPNVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNISNQVSQAIVQQIQPLEQWGVLPYFNFRSQSEQAKLNQPTLA
Ga0066793_1055016823300009029Prmafrost SoilPLFQAAVDRAAQRLAPDLVDIIPTLGDDWRGEPAVFFMVILTDASSRREQLLRVTNQVSTSITQQVQPLEKWGVLPYFNFRSESEQASMNQHALAS*
Ga0099829_1153355123300009038Vadose Zone SoilVYVPTAFAQQTRFQAAVARAAQSLAPHVVGIIPTLGNDWSGEPAVFFMVILADAASRRDLLLNISNQVEQTVIQQVQPLEQWGVLPYFNFRSQSEHAKLNQPALA*
Ga0099830_1098342023300009088Vadose Zone SoilVYVPTAFAQQARFRAAVARAAQRLAPDVVSIIPTLGNDWSGEPAVFFMVILADAATRRDRLWSISNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPALA*
Ga0099828_1076046813300009089Vadose Zone SoilPLLALTRDTGVVYVPTAFAQQGRFLAEVARAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNISNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLKQPILA*
Ga0066709_10347458313300009137Grasslands SoilRAHVNQRQFMAAIARAAQNLAPDVVAIIPTLGNDWTGEPSVFFMVILSDATANRRDQLLNATNRISNFIVQNVAPLEEWDVLPYFNFRSQSEQAKLEPSFA*
Ga0116222_107013743300009521Peatlands SoilVYVPTAFAHQARFQAAVARAAQRLAPHVVSIIPTLGSDWSGEPAVFFMVILADAASRHEKLLNVSNQVEQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPTLA*
Ga0116218_114090533300009522Peatlands SoilVYVPTAFAHQARFHAAVARAAQRLAPHVVSIIPTLGSDWSGEPAVFFMVILADAASRHEKLLNVSNQVEQAIVQQVQPLEPWGVLPYFNFRSQSEQAKLDQPTLA*
Ga0116125_100305863300009628PeatlandVYVPTAFAQEARFQATVTRAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLNISNQVSEAIVREVQPLEQWGVLPYFNFRSQSEQAKLNQPALA*
Ga0116121_113944923300009644PeatlandVYLPRAFAQQPLFQAAVARAAQRLAPQVVNIMPTLGNDWRGEPAVFFMVILADAASRRDQLLRVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0116121_114524623300009644PeatlandVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0116130_119790223300009762PeatlandARSLAPHVASIVCTLGNDWTGEPAVFFMVILSDSASRGDGLLNITDQVSQAIARQVEPLEKWGVLPYFNYRSQSEQAKLDQPTLA*
Ga0116223_1010503823300009839Peatlands SoilLTGIEARHLPIQAGLWRQSRKRYPSLAQTRDNGVVYVPTAFAQQARFEAAVARAAQSLAPHVVGIIPTLGNDWSGEPAVFFMVILADSATRRDRLLSISNRVEQTIVQHVQPLEQWGVLPYFNFRSQSEQAKLDQPTLA*
Ga0136449_10012922073300010379Peatlands SoilMYVPTAFAQQARFEAAIARAAQRLGPHVVSVIPTLGNDWSGEPAVFFMVILADAATRRDQLWTISNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPALA*
Ga0136449_10104762323300010379Peatlands SoilMQVPKAHIHQRQFMAAITRAARSLAPDVVGIIPTLGNDWSGEPAVFFMVILSDAAAGRREELLDVTNHISNFIVQHVAPLEKWDVLPYFTFRSQSEQSKLEPAWA*
Ga0136449_10240657923300010379Peatlands SoilVNVPPAFVHQTRFQTAVARAAQRLAPQVVSVIPTLGNDWTGEPAVFFMVILADAASRRDQLLNVSNQVEQAIVQQVQPLEQWGVLPYFNFRSQSEQAELNQPALG*
Ga0137392_1008379023300011269Vadose Zone SoilVYVPTAFAQQARFQDAVARAAKRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLKVSNQVSQAIEQQVQPLERWGVLPYFNFRSESEQAKLNQAIVA*
Ga0137393_1066077623300011271Vadose Zone SoilMPMVPRAFVHQSQFKAATARAARRLAPDVVSIIPTLGNDWSGEPAVFFMVILSDVASSRERLLSVTDRVSKAIVGELEPLEEWGVLPYFNFRSQSEQAKLNEPTLA*
Ga0137389_1078008813300012096Vadose Zone SoilPEPLPLLARTRDDGIVYVPTAFAQQARFQDAVARAAKRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLKVSNQVSQAIEQQVQPLERWGVLPYFNFRSESEQAKLNQAIVA
Ga0137362_1103870723300012205Vadose Zone SoilVPRAFVHQSQFKAAIARAARRVAPDVIAIIPTLGDDWSGEPAVFFMVILSDAASSRERLLSVTDRVSKTIAGDLEPLEEWGVLPYFNFRSQSEQAKLNEPTLA*
Ga0137379_1169400723300012209Vadose Zone SoilGTRDIEVMYLPTAFAQPARFRAAVARAEQSLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNISNQVSQDIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPALR*
Ga0137372_1027593223300012350Vadose Zone SoilVYLPRAFAQQPLFQAAVARAAQQLAPRVVDIIPTLGNDWSGEPAVFFMVILADAASHRDQLLRVTNQVSTFIVEQVQPLEQWGVLPYFNFRSQSEQASINQHTLAS*
Ga0137367_1029946423300012353Vadose Zone SoilVSIGIRPEAGTRDNEVVYVPTAFAQQARFRAAVARAAKHLAPHVVNIIPTLGNDWSGEPAVFFMVILADFASRRDQLLSISDRVEQTIIQQVQPLEQWGVLPYFNFRSQSEQAKLDQPALA*
Ga0137371_1046496823300012356Vadose Zone SoilVYLPRAFAQQPLFQAAVARAAQQLVPRVVDIIPTLGNDWSGEPAVFFMVILADAASHRDQLLRVTNQVSTFIVEQVQPLEQWGVLPYFNFRSQSEQ
Ga0137361_1114106823300012362Vadose Zone SoilGICFEGGATASIHSDCPIGVKTRDNEVMPMVPRAFVHQSQFKAATARAARRLAPDVVSIIPTLGNDWSGEPAVFFMVILSDVASSRERLLSVTDRVSKALVGELEPLEEWGVLPYFNFRSQSEQAKLNEPTLA*
Ga0137395_1044313023300012917Vadose Zone SoilVYVPTAFAQQARFQDAVARAAKRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLKISNQVSQAIEQQVQPLERWGVLPYFNFRSESEQAKLNQAIVA*
Ga0137404_1231304013300012929Vadose Zone SoilAARRLSPDVVAIIPTLGDDWSGEPAVFFMVILSDVASSRERLLSVTDRVSKAIVGELEPLEEWGVLPYFNFRSQSEQAKLNEPTLA*
Ga0137407_1225265413300012930Vadose Zone SoilPFCVKTRDNKGMQVPRAHVHQRQFMAAIDRAARSLAPDVVGIIPTLGNDWSGEPAVFFMVILSDAAASRRDQLLNVTNQVSNFIVQHVAPLEEWDVLPYFSFRSQSEQAKLEPSYA*
Ga0157375_1294207923300013308Miscanthus RhizosphereMHAPPAFVRQSQFYAAVARVAQILAPDVVGISPTLGNDWSGEPTVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEPVLAASDTRPVFRPRPDE
Ga0181517_1017854923300014160BogVYLPRAFAQQPQFQTAVGGAALRLARQVVDILPTGGKDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0181532_1005642923300014164BogVYLPRAFAQQALFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0181523_1013798323300014165BogLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0181535_1001501843300014199BogVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLP
Ga0181526_1004036923300014200BogVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0157380_1011577833300014326Switchgrass RhizosphereMHAPPAFVRQSQFYAAVARVAQILAPDVVGISPTLGNDWSGEPTVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEPVLAASDTRPVFRPRPDENSLRS*
Ga0182018_1014195523300014489PalsaVYVPTAFTHQARFEAAVERAARSLAPRVASIILTLGNDWSGEPAVFFMVILSDSAIGPEQLLKVTNDVSEAIVQKVQPLEQWGVLPYFNFRSQSEQAKLNQPTMA*
Ga0182014_1017313523300014491BogVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0182016_1044596223300014493BogMCVPLAFTQERRFQAAIARVAKRLPYVADVNATLGSDWAGDPAVFFMVILADTASGRDQLLKTSHQASQAIVLQVQPLGKWGVLPYFNFRSQSEQAHLDQAALA*
Ga0182017_1058114613300014494FenVYIPRAFAQLSLFQAAVARAARQLAPHVVDITPTLGNDWSGEPAVFFMIILADAASRRDQLLKVTNQVSSLIVQQVQPLEQWGVLPYFDFRSQSEQARIGPQSLAS*
Ga0182024_1113464113300014501PermafrostVARAAQRLAPHVVSVIPTLGDDWSGEPAVFFMVILADAATRRDQLGRISNQVSEAIVQQVQPLEEWGVLPYFNFRSQSEQAKLTQPTLA*
Ga0182021_1170324623300014502FenVETRDNGLVYLPRAVAQQSLFQAEVARATHRLAPNVVDIIPTLGDDWTGAPAVFFMVILADAASRREQLLRITNQVSSFIVQQVQPLEQWGVLPYFNFRSQSEQARINQHALAS*
Ga0181522_1005562013300014657BogVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHA
Ga0181519_1016546133300014658BogVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS*
Ga0182027_1021167353300014839FenARHPARGVRPVQITFPIPGKARDNGFVYLPRALAQQPLFQAAVARAAQRLAPDVVNIIPTLGNDWSGAPAVFFMVILDDAASRREQLLRVTNQVSSFIVQQVQPLEQWGVLPYFNFRSQSEQARINQHALAS*
Ga0182027_1103019123300014839FenVYIPRASAQFPLFQAAVARATRQLAPQVVDIMPTLGNDWSGEPAVFFMIILADAASRRDQLLKVTNRVSTLIVQQVQPLEQWGVLPYFDFRSQSEQARIGPQSLAS*
Ga0137405_133946863300015053Vadose Zone SoilMKSCRWFKGVCPPIQFKAATARAARRLAPDVVSIIPTLGNDWSGEPAVFFMVILSDVASSRERLLSVTDRVSKAIVGELEPLEEWGVLPYFNFRSQSEQAKLNEPTLA*
Ga0181505_1002335623300016750PeatlandAAVARVARSLAPHVASIVCTLGNDWTGEPAVFFMVILSDSASRGDGLLNITDQVSQAIARQVEPLEKWDVLPYFNYRSQSEQAKLDQPTLA
Ga0187879_1008843323300017946PeatlandVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIAQHVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0187879_1086726213300017946PeatlandTAFAQEARFQATVTRAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLKISNQVSEAIVRDVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0187783_1006024323300017970Tropical PeatlandVYVPTAFAHQAQFRAAVNRAAQELRPQVVDLTFTLGNDWSGEPAVFFMVILSNAASQRDQLLRITNQVSNAIVQRVQPLEQWGVLPYFNFRSEAEQAKIDQRSLAS
Ga0187783_1111731023300017970Tropical PeatlandVYLPNAFTHPAEFRVEIERVAQSLPPHVVSITHTLDYDWSGEPAVFFMVILADSATQRDRLLKNSNQVSEAIWEQVQPLEEWRVYPYFSFRSKSEQARLDERALA
Ga0181520_1023969223300017988BogVYLPRAFAQQALFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0187872_1039118713300018017PeatlandEVRPQGGRANRHHYPPFAQARDNEVVYLPKAFAQPARFRAAVARVARSLAPHVASIVCTLGNDWTGEPAVFFMVILSDSASRGDGLLNITDQVSQAIARQVEPLEKWGVLPYFNYRSQSEQAKLDQPTLA
Ga0187863_1001840933300018034PeatlandVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0187863_1002559923300018034PeatlandVYVPTAFAQEARFQATVTRAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLNISNQVSEAIVREVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0187883_1002819263300018037PeatlandVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIAQHVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0187883_1035259523300018037PeatlandMQHNARQPSVAQTRDNKVVYVPTAFAQEARFQATVTRVAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLKISNQVSEAIVRDVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0187855_1028752813300018038PeatlandVYLPTAFAQPDRFQAAVTRAARRLPHVVSVIPTLGNDWNGAPAAFFMVILTDAASRRDRLLSITNQVSQAIVQQVQPLEKWGVLPYFNFRSQSEQAKLDRRTVA
Ga0187890_1003668913300018044PeatlandLSSAQAPPHQRFPIAIRTRDNGFVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIAQHVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0187851_1076095323300018046PeatlandVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPFNFRSQSEQARINQHALAS
Ga0187859_1000937613300018047PeatlandVSRSRPSHSTPTHPPLAPKSDNKVVYVPTAFAQEARFQATVTRAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILSDAASRRDQLLNISNQVSEAIVREVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0187859_1036020513300018047PeatlandVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIAQHVQPLEEWGVLPYFNFRSQSEQARINQHA
Ga0184625_1013786813300018081Groundwater SedimentMHAPPAFVRQSQFYAAVARVAQILAPDVVGISPTLGNDWSGEPTVFFMVILADSATQRDGLLRITNNASETIVREVQPLEQWGVLPYFNFRGQSELSKLSEPVLA
Ga0066655_1034585713300018431Grasslands SoilVQVPTAFAKQARFQAAVARAAQRLAPHVVNIIPTLGNDWSGEPAVFFMVILADAASRRDQLLHISNQVSQAIVQQVQPLEQWGVLPYFNFRSHSEQARLNQPTLV
Ga0190274_1161330713300018476SoilYCFGHELTIVNSNVICQEYNETMHVPPAFVRQCQFYAAVARVAQILAPDVVGISPTLGNDWSGEPAVFFMVILADSATQRDGLLRITNNASETIVREVPPLEQWGVLPYFNFRGQSELSKLSEPVLA
Ga0210395_1043878623300020582SoilVRVPKAFVQQAEFQAAVKQAGRRLAPQVVDVIPSLGPDWSGEPAVFFMVILDDFATRRDQLLDVTNRVSEAIVQEVQPLEEWDVLPYFNFRSKSEQAKINQTVA
Ga0210401_1115856913300020583SoilVYLPTAFAQQARFQAAVARAAQRLTPHVVGIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNITNQVSQATVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPTLV
Ga0210400_1014000333300021170SoilVAQRLAPHVVGIIPTLGDDWSGEPAVFFMVILSDPASQRDRILSITNQVSQAIVQQVQPLEEWGVLPYFNFRSQSEQAKLNEPALA
Ga0210402_10005474103300021478SoilMPQLPLRVRARRKSGSRESSQLPPAAHPRDNGAVYLPTAFAQQARFQAAVARAAQRLTPHVVGIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNITNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPTLV
Ga0210410_1051624313300021479SoilTRPRTRDNEVVYVPTAFVEQARFQAAVERAARRLAPHVVSVTHTLGDDWSGEPAVFFMVILSDAASRRAQLLNISNQVSEAIVGEVQPLEQWGVLPYFNFRSQSEQARLNQPTLA
Ga0224559_112072613300023091SoilMHCGKPGGCQLPRAPLHDHSPIPIKTRDNGFVYIPRASAQFPLFQAAVARATRQLAPQVVDIMPTLGNDWSGEPAVFFMIILADAASRRDQLLKVTNRVSTLIVQQVQPLEQWGVLPYFDFRSQSEQARIGPQSLAS
Ga0224551_105592423300023259SoilVKTRDNGFVYLPRAFAQQPLFQAAVARAAQRLAPQVVDITPTLGNDWRGEPAVFFMVILADAASRRDQLLRVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHAMAS
Ga0208190_109446423300025473PeatlandVYLPRAFAQQPLFQAAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILVDAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHALAS
Ga0209839_1005649513300026294SoilHDSFPVMIKTRDNGLVYLPRAFAQQPLFQAAVNRAAQRLAPDLVDIIPTLGDDWRGEPAVFFMIILTDASSRREQLLRVTNQVSTSITQQVQPLEKWGVLPYFNFRSESEQASINQHALA
Ga0208043_120135123300027570Peatlands SoilVARAAQRLAPHVVSIIPTLGSDWSGEPAVFFMVILADAASRHEKLLNVSNQVEQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLDQPTLA
Ga0209167_1000929433300027867Surface SoilVFDDEEVLHPLEAARDNGVVQLPTAFVQQARFQTAVSRAAQRLAPHGVVQIIPTLGEDWSGEPAVFFMVILTDAASRRDRLLNISNEVSQTIYQQVQPLEKWGVLPYFNFRSQSEQAKLDQPAMV
Ga0209698_1136482913300027911WatershedsVGGSKGLRLRTRDNTVVNVSSAFVHPIRFQAAVKRCEKRLASHGVVSIIPTLGNDWSGEPAVFFMIILADSASKRDRLLSITNQVSQTIVEEVQPWEEWGVLPYFNFRSQSEQAKLDQPVLV
Ga0222749_1008294023300029636SoilMHVPKAYVQQVQFEAAIARVEHRLAPHVVKIIPTFGNDWTGEPAVFLMVILSDAATKRDQLLNMANRVSNAITQRVEPLEKWGVLPYFNFRSQSEQAQLELVGRS
Ga0299906_1034549023300030606SoilVHVPRAFVEQNRFQAAVAQAAQRLAPHVVSLIPALGDDWSGEPAVFFMVILSDAASRRDQLLSVSNQVSEAIVEQVQPLEQWDVLPYFNFRSQSEQTKLNQPALV
Ga0170834_10972549213300031057Forest SoilVYVPAAFAQQARFQAAVARAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAATRRDQLWNISNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQATLDQPTLV
Ga0170824_10553515113300031231Forest SoilVYVPAAFAQQARFQAAVARAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAATRRDQLWNISNQVSQAIVRQVQPLEQWGVLPYFNFRSQSEQATLDQPTLV
Ga0302325_1063200023300031234PalsaLFDIAAKPKTRDNGFVYLPLAVAQQPLFQAAVARAAQQLAPDVLDVIPTLGDDWRGEPAVFFMVILADAASRRDRLLRVTNHASTFIVQQVQPFEQWGVLPYFNFRSQSEQVRINQHALA
Ga0302324_10124555113300031236PalsaMYVPTAFSQPARFEAAVKRAAQHLPYDVVSVIPTLGNDWREEPAVFFMVILEDAASQRARLLSISNQVSQAIVEQVQPLEQWGVLPYFNFRSRSEQAKLNQPTLA
Ga0302326_1085050023300031525PalsaMYVPTAFSQPARFEAAVKRAAQHLPHDVVSVIPTLGNDWREEPAVFFMVILEDAASQRARLLSISNQVSQAIVEQVQPLEQWAVLPYFNFRSRSEQAKLNQPTLA
Ga0302326_1116580813300031525PalsaPGSSCAILAAKTGLENRLDDPTGSDLFDIAAKPKTRDNGFVYLPLAVAQQPLFQAAVARAAQQLAPDVLDVIPTLGDDWRGEPAVFFMVILADAASRRDRLLRVTNHASTFIVQQVQPFEQWGVLPYFNFRSQSEQVRINQHALAS
Ga0302326_1122386223300031525PalsaWGMHVPTAFAQQAELQSAVNRAAHQLRPHVIDLTFALGNDWSGEPAVFFMVILSSAASRREQLLRITNQVSNAIVQKVQPLEQWGVLPYFNFRSEAEQAKIDRQSLAS
Ga0315289_1023996323300032046SedimentVRCWGKSESRDHRSYPFLARTRDNGVVNVPTAFAQQARFQAAVARAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNISNQVEQTIVQKVQPLEQWGVLPYFNFRSQSEQARLNQPTLV
Ga0315277_1024305913300032118SedimentRCRGKSESRDHRSHPFLARRRDNGVVNVPTAFAQQARFQAAVARAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASRRDQLLNISNQVEQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0311301_1002973153300032160Peatlands SoilLTGIEARHLPIQAGLWRQSRKRYPSLAQTRDNGVVYVPTAFAQQARFEAAVARAAQSLAPHVVGIIPTLGNDWSGEPAVFFMVILADSATRRDRLLSISNRVEQTIVQHVQPLEQWGVLPYFNFRSQSEQAKLDQPTLA
Ga0311301_1010984473300032160Peatlands SoilMYVPTAFAQQARFEAAIARAAQRLGPHVVSVIPTLGNDWSGEPAVFFMVILADAATRRDQLWTISNQVSQAIVQQVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0311301_1173180223300032160Peatlands SoilVAGHFRTRNNGVVYLPRAFIHQRRFEAAVARTEQRLAPHVVSIIPTLGNDWVGEPAVFFMVYLDDAATQRDQLLKISNQVEEAIEQQVQPLERWGVLPYFNFRSQSEHARLHPPALA
Ga0311301_1224079323300032160Peatlands SoilMQVPKAHIHQRQFMAAITRAARSLAPDVVGIIPTLGNDWSGEPAVFFMVILSDAAAGRREELIDVTNHISNFIVQHVAPLEKWDVLPYFTFRSQSEQSKLEPAWA
Ga0306920_10404149323300032261SoilMQVPTAFVHQAQFSRAVARAAQRLAPEVVSIIPTLGNDWSGEPAVFFMVILSDAASLRDRILTTSNRVQQVLNDEVQPLEQWGVLPYFN
Ga0315275_1093266623300032401SedimentVNVPTAFAQQARFQAAVERAAQRLAPHVVSIIPTLGNDWTGEPAVFFMVILADAASQRDRLLNISNQVEQAIVQKVQPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0348332_1130569623300032515Plant LitterRAFAQQPLFQAAVARATQQLAPHVVDIIPTLGNDWSGEPAVFFMVILADSSSRRDQLLRVTNQVSNFIDRQVEPLAQWGVLPYFNFRSQSEQAGIDQHVLAS
Ga0348332_1301123713300032515Plant LitterGVCTRVPIPSGSKRVAKRLAPDVVTIIPTLGDDWTGEPAVFFMVILADAATRRDQLLNVSNRVSQAIYEQVDPLERWEVFPYFNFRSQSEQAEPDQRTVA
Ga0335085_100002081313300032770SoilVYVPRAFVHQAEFQGAVARAARKLGRDVVNVIPTLGDDWTGEPAVFFMVILVDSATRRDLLLNNVNKVSQTLIEQVQPLEEWGVYPYFNFRSESEHAQLSQPSVA
Ga0335078_1058431423300032805SoilVIVPTAFAQQAQFRAIVNRAAQQLRPDVIDLTFTLGNDWSGEPAVFFMIILSNAASQRDQLLSTTSRVSNSIVQFVQPLEQWGVLPYFNFRSEAEQEKINQQSLAS
Ga0335074_1002289243300032895SoilVRRAARKLGPRVVEIVPTLGNDWSGEPAVFFIVILADSATRRDRLLSATNQVSQAVIEQVQPLEEWDVLPYFNFRSKSEQTELDQRTTA
Ga0335071_1092424223300032897SoilESRFQAAVARAAQRLGPHVVNIIPTLGNDWSGEPAVFFMVILADASSRRDQILNISNQVSQAIVQQVQPLEEWGVLPYFNFRSQSEQAKLNQPTLV
Ga0316616_10349969613300033521SoilRENKLGWRGARCWGKSESRDRRSYPFLGRPRDNGVVNVPAAFAQQARFQAAVERAAQRLAPHVVSIIPTLGNDWSGEPAVFFMVILADAASQRDQLLNISNQVEQAIVQKVRPLEQWGVLPYFNFRSQSEQAKLNQPALA
Ga0334827_084164_1_3093300034065SoilVYLPRAFAQQPQFQTAVGRAALRLAPQVVDIIPTLGNDWRGEPAVFFMVILADAASRRDQLLKVTNQASAFIVQQVQPLEEWGVLPYFNFRSQSEQARINQHA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.