| Basic Information | |
|---|---|
| Family ID | F069067 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LLKDGGETVRMRIGEGWDVDIYKAMILAVEQDAMALLPA |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.16 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.548 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.516 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.871 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 17.91% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07969 | Amidohydro_3 | 15.32 |
| PF01070 | FMN_dh | 5.65 |
| PF01979 | Amidohydro_1 | 4.84 |
| PF00474 | SSF | 4.03 |
| PF00083 | Sugar_tr | 3.23 |
| PF00583 | Acetyltransf_1 | 1.61 |
| PF02687 | FtsX | 0.81 |
| PF00672 | HAMP | 0.81 |
| PF13594 | Obsolete Pfam Family | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 5.65 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 5.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.55 % |
| Unclassified | root | N/A | 6.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN01A16TJ | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300001145|JGI12682J13319_1015446 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300002908|JGI25382J43887_10278765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300002917|JGI25616J43925_10283540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300005172|Ga0066683_10656625 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005439|Ga0070711_101756314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300005568|Ga0066703_10043998 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300005610|Ga0070763_10874891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005764|Ga0066903_103234974 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005764|Ga0066903_104757793 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005764|Ga0066903_105646391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300006176|Ga0070765_102156869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300006237|Ga0097621_102209547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300006755|Ga0079222_11348455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300006755|Ga0079222_11885081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300006804|Ga0079221_11725370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300007788|Ga0099795_10094401 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300009038|Ga0099829_10268820 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300009038|Ga0099829_11399576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009088|Ga0099830_10888450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300009088|Ga0099830_10988421 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010046|Ga0126384_11176020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300010048|Ga0126373_11254772 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300010304|Ga0134088_10129289 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300010329|Ga0134111_10126998 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010341|Ga0074045_10905741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010343|Ga0074044_10982618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300010359|Ga0126376_12164291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300010360|Ga0126372_11986605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300010361|Ga0126378_10178105 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300010362|Ga0126377_12927072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300010375|Ga0105239_12145337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300010376|Ga0126381_101628385 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010398|Ga0126383_11284812 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300011269|Ga0137392_10517634 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300012096|Ga0137389_10521192 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300012189|Ga0137388_10819065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 862 | Open in IMG/M |
| 3300012189|Ga0137388_10899920 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012200|Ga0137382_10318600 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012202|Ga0137363_10913178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012203|Ga0137399_11688768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012205|Ga0137362_11376284 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012205|Ga0137362_11772333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012356|Ga0137371_10458383 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012925|Ga0137419_10966089 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012929|Ga0137404_10977729 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012931|Ga0153915_12062357 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012944|Ga0137410_11918952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300014168|Ga0181534_10111985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1373 | Open in IMG/M |
| 3300015241|Ga0137418_10569612 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300015372|Ga0132256_103373490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300016270|Ga0182036_10799931 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300016294|Ga0182041_11672460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300016294|Ga0182041_12287581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300016319|Ga0182033_11530444 | Not Available | 602 | Open in IMG/M |
| 3300016341|Ga0182035_11363369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300017942|Ga0187808_10368539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300017995|Ga0187816_10303257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300018085|Ga0187772_11486724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300019789|Ga0137408_1221380 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300020579|Ga0210407_10818361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300020579|Ga0210407_10939003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300020579|Ga0210407_11418255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300020580|Ga0210403_10323110 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300021168|Ga0210406_10622599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300021168|Ga0210406_11154671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300021168|Ga0210406_11384164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021171|Ga0210405_10204407 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300021178|Ga0210408_10121641 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300021180|Ga0210396_10208944 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300021180|Ga0210396_10509415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300021181|Ga0210388_10252182 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300021401|Ga0210393_10454437 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300021401|Ga0210393_11265362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300021407|Ga0210383_10014364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6680 | Open in IMG/M |
| 3300021433|Ga0210391_10877438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300021477|Ga0210398_11067633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300021478|Ga0210402_11282853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300021479|Ga0210410_10155023 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300021560|Ga0126371_11297902 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300021560|Ga0126371_13792594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300024227|Ga0228598_1012257 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300024330|Ga0137417_1020128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300024330|Ga0137417_1202623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300025915|Ga0207693_10888061 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300025928|Ga0207700_10038369 | All Organisms → cellular organisms → Bacteria | 3477 | Open in IMG/M |
| 3300026294|Ga0209839_10230924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300026305|Ga0209688_1047062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 814 | Open in IMG/M |
| 3300026324|Ga0209470_1341486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300026514|Ga0257168_1077595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300026557|Ga0179587_10237544 | Not Available | 1163 | Open in IMG/M |
| 3300026557|Ga0179587_11077513 | Not Available | 529 | Open in IMG/M |
| 3300027590|Ga0209116_1140880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027629|Ga0209422_1111332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300027660|Ga0209736_1039254 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300027674|Ga0209118_1034743 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300027684|Ga0209626_1147553 | Not Available | 620 | Open in IMG/M |
| 3300027737|Ga0209038_10237728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300027738|Ga0208989_10202924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027745|Ga0209908_10166898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300027825|Ga0209039_10253017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300027846|Ga0209180_10422025 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300027853|Ga0209274_10448605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300027854|Ga0209517_10163998 | Not Available | 1409 | Open in IMG/M |
| 3300027874|Ga0209465_10394833 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027875|Ga0209283_10217915 | Not Available | 1268 | Open in IMG/M |
| 3300027882|Ga0209590_10323498 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300027882|Ga0209590_10369274 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300027884|Ga0209275_10373773 | Not Available | 801 | Open in IMG/M |
| 3300027908|Ga0209006_10479205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300027910|Ga0209583_10713990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300029636|Ga0222749_10478677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300030906|Ga0302314_10609028 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300031122|Ga0170822_14807107 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300031740|Ga0307468_100076519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1886 | Open in IMG/M |
| 3300031754|Ga0307475_10270750 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300031754|Ga0307475_10469645 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031754|Ga0307475_10609820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300031823|Ga0307478_10197109 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300031962|Ga0307479_10294537 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300032035|Ga0310911_10904051 | Not Available | 509 | Open in IMG/M |
| 3300032205|Ga0307472_100402963 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300032205|Ga0307472_100490992 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300032954|Ga0335083_11050421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001145 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_05384290 | 2170459013 | Grass Soil | ATSRFRCVSLLKDGGETLRMRIGDGWDVDIYKTMVMAVEEDAMALIPA |
| JGI12682J13319_10154462 | 3300001145 | Forest Soil | GESDEALRVRIGGGWDVDIYKTMVLAVEEDSWMNVT* |
| JGI25382J43887_102787651 | 3300002908 | Grasslands Soil | GKLLKDGPETVRMRIGEGWDVDIYKAMILAVEEDSMISLPA* |
| JGI25616J43925_102835402 | 3300002917 | Grasslands Soil | LRGKLLKEGGETVRMRIGEGWDVDIYKAMIVAVEEDSMVLLPA* |
| Ga0066683_106566253 | 3300005172 | Soil | VMKDGGETVRMRIGDGWDVDIYKAMILAVEEDAMALIPA* |
| Ga0070711_1017563141 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RGRVMKDGGDTVRMRIGDGWEVDIYKAMILAVEEDAMALIPA* |
| Ga0066703_100439984 | 3300005568 | Soil | MKDGGETLRIRIGDGWDVDIYKAMILAVEEDTMALIPA* |
| Ga0070763_108748912 | 3300005610 | Soil | LRGKLLKDKGETVRIRIDGSDIDIYKTMILAVEEDAMVLLPA* |
| Ga0066903_1032349743 | 3300005764 | Tropical Forest Soil | RLLKDGGETLRMRIGDGWDVDIYKTMVMAVEEDAMALIPA* |
| Ga0066903_1047577931 | 3300005764 | Tropical Forest Soil | PLRGRVMKDGGDTLRMRIGDGWDVDIYKTMILAVEEDAMALIPA* |
| Ga0066903_1056463911 | 3300005764 | Tropical Forest Soil | RVLKDGGDTLRMRIGDGWDVDIYKVMILAVEEDAMALVPA* |
| Ga0070765_1021568691 | 3300006176 | Soil | EETVRMRIGEGWDVDIYKAMILAVEKDGMALFPAA* |
| Ga0097621_1022095471 | 3300006237 | Miscanthus Rhizosphere | LLKDGGETVRMKIGEGWDVDIYKTMILAVEQDAMALLPA* |
| Ga0079222_113484551 | 3300006755 | Agricultural Soil | EGGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA* |
| Ga0079222_118850811 | 3300006755 | Agricultural Soil | KDGSDTVRMRIGEGWDVDIYKTMILAVEEDGMVLLPS* |
| Ga0079221_117253703 | 3300006804 | Agricultural Soil | LRGRLLKDGGETLRMRIGDGWDVDIYKTMVMAVEEDAMALIPA* |
| Ga0099795_100944011 | 3300007788 | Vadose Zone Soil | LLKEGGDTLRMRIGDEWDVDIYKTMILAVEEDGMAMVAA* |
| Ga0099829_102688203 | 3300009038 | Vadose Zone Soil | GGETLRMRIGDGWDRDIYKNMVLAVEEDAMALIPA* |
| Ga0099829_113995762 | 3300009038 | Vadose Zone Soil | KVGGETVRMRIGDAWDVDIYKAMILAVEEDSMVLLPA* |
| Ga0099830_108884503 | 3300009088 | Vadose Zone Soil | GKLLKDGDDTVRMRIGDGWDVDIYKAMILAVEEDSMVLLPA* |
| Ga0099830_109884211 | 3300009088 | Vadose Zone Soil | KDSGETLRMRIGEKWDVDIYKAMVMAVEEDSMATLPA* |
| Ga0126384_111760203 | 3300010046 | Tropical Forest Soil | VALGDIKVPLRGKLLKDGGETVRMRVGDGWDIDIYKAMILAVEQDAMALMPA* |
| Ga0126373_112547723 | 3300010048 | Tropical Forest Soil | GDTIRMRIGEGWDVDIYKTMILAVEEDGMALIPA* |
| Ga0134088_101292893 | 3300010304 | Grasslands Soil | LLMDGGETLRMRIGDGWDVDIYKSMVLAVEEDAMALIPA* |
| Ga0134111_101269984 | 3300010329 | Grasslands Soil | GETVRMRIGDGWDVDIYKAMILAVEEDAMALIPA* |
| Ga0074045_109057411 | 3300010341 | Bog Forest Soil | GKLLKESGETVRMRIGEGWDVDIYKAMILAVEEDGMSMIPA* |
| Ga0074044_109826182 | 3300010343 | Bog Forest Soil | GKLLKENGETVRMRIGDGWDVDIYKAMILGVEEDGMAMIPA* |
| Ga0126376_121642911 | 3300010359 | Tropical Forest Soil | GKLLKDGSDTVRMRIGEGWDVDIYKTMILAVEEDGMVLLPS* |
| Ga0126372_119866051 | 3300010360 | Tropical Forest Soil | KVPLKGKLLKDGGETIRMRVGDGWDIDIYKTMVLAVEQDATALMPA* |
| Ga0126378_101781054 | 3300010361 | Tropical Forest Soil | GGETLRMRIGDGWDVDIYKTMVMAVEEDAMALIPA* |
| Ga0126377_129270722 | 3300010362 | Tropical Forest Soil | KDDGETLRMRIGDGWDVDIYKTMVMAVEEDAMALIPA* |
| Ga0105239_121453372 | 3300010375 | Corn Rhizosphere | VVSGDIKVPLRGKLLKDKGDSVRIRIDGSDIDIYKTMILAVEEDAMVMLPA* |
| Ga0126381_1016283851 | 3300010376 | Tropical Forest Soil | SDTVRMRIGDGWDVDIYKTMILAVEEDGMVLLPS* |
| Ga0126383_112848121 | 3300010398 | Tropical Forest Soil | DGSDTVRMRIGEGWDVDIYKAMILAVEEDAMVLLPS* |
| Ga0137392_105176343 | 3300011269 | Vadose Zone Soil | EGSETVRMRIGDGWDVDIYKTMIVKVEEDHMAAAAA* |
| Ga0137389_105211923 | 3300012096 | Vadose Zone Soil | GGETVRMRIGDGWDVDIYKAMIVAVEEDSMDRLPA* |
| Ga0137388_108190651 | 3300012189 | Vadose Zone Soil | KLLKDGDDTVRMRIGDGWDVDIYKAMILAVEEDGMVLLPS* |
| Ga0137388_108999203 | 3300012189 | Vadose Zone Soil | MLKEGSETVRMRIGDGWDVDIYKTMIVKVEEDHMAAAAA* |
| Ga0137382_103186003 | 3300012200 | Vadose Zone Soil | GETVRMRIGDGWDVDIYKAMILAVEEDSMVLLPA* |
| Ga0137363_109131783 | 3300012202 | Vadose Zone Soil | LKDSGETLRMRIGDGWDVDIYKNMVLAVEEDAMALIPA* |
| Ga0137399_116887682 | 3300012203 | Vadose Zone Soil | GGETVRMRIGDGWDVDIYKAMILAVEEDSMVLLPA* |
| Ga0137362_113762843 | 3300012205 | Vadose Zone Soil | RVMKDGGETVRMRIGDGWDVDIYKAMILAVEEDAMALIPA* |
| Ga0137362_117723332 | 3300012205 | Vadose Zone Soil | GETVRMRIGEGWDVDIYKAMILAVEEDSMVLLPA* |
| Ga0137371_104583833 | 3300012356 | Vadose Zone Soil | LKDGPETVRMRIGEGWDVDIYKAMILAVEEDSMTSLPA* |
| Ga0137419_109660893 | 3300012925 | Vadose Zone Soil | GGETVRMRIGDGWDVDIYKAMILAVEEDAMALIPA* |
| Ga0137404_109777293 | 3300012929 | Vadose Zone Soil | LMDGGETLRMRIGDGWDVDIYKNMVLAVEEDAMALIPA* |
| Ga0153915_120623572 | 3300012931 | Freshwater Wetlands | VGDAGDALRLRVGDGWDVDIYKSMITAVEEDTQAFQAA* |
| Ga0137410_119189522 | 3300012944 | Vadose Zone Soil | EGGDTLRMRIGDEWDVDIYKTMILAVEEDGMAMVAA* |
| Ga0181534_101119851 | 3300014168 | Bog | ESDETVCMRIGDGWDVDIYKAMILGVEEDAMALMPA* |
| Ga0137418_105696123 | 3300015241 | Vadose Zone Soil | RVMKDGGETVRMRIGDGWDVDIYKAMILAVEEDTMALIPA* |
| Ga0132256_1033734902 | 3300015372 | Arabidopsis Rhizosphere | RGRLLKDGGETLRVRIGDGWDVDIYKTMVMAVEEDAMALIPA* |
| Ga0182036_107999313 | 3300016270 | Soil | GRLLKESGDTVRMRIGDGWDVDIYKNMILKVEEDGLALMPA |
| Ga0182041_116724601 | 3300016294 | Soil | RGKLLREGGETIRMRIGEGWDVDIYKAMILAVEEDGMALIPA |
| Ga0182041_122875811 | 3300016294 | Soil | KEAGDTVRMRIGDGWDVDIYKNMILDVEHDGLALMPA |
| Ga0182033_115304441 | 3300016319 | Soil | SQVPMRGELLKENRGRVGMRIGEGWDGDIYKTVVRGVEEDGMAMVPA |
| Ga0182035_113633693 | 3300016341 | Soil | LKDGGETLRMRIGEGWDVDIYKTMVMAVEEDAMALIPA |
| Ga0187808_103685391 | 3300017942 | Freshwater Sediment | KLLKEGGDTVQMRIGEGWDVDIYKNMILGVEEDGLALIRA |
| Ga0187816_103032572 | 3300017995 | Freshwater Sediment | ENRETVRMRIGEGWDVDIYKTMILNVEEDRMGMIPA |
| Ga0187772_114867241 | 3300018085 | Tropical Peatland | KLLKENSETLRVRIGEGWDVDIYKAMILSVEEDLISAIPA |
| Ga0137408_12213803 | 3300019789 | Vadose Zone Soil | LRGRLMKDGGDTLRMRIGDGWDVDIYKAMILAVEEDAMALIPA |
| Ga0210407_108183611 | 3300020579 | Soil | GGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA |
| Ga0210407_109390032 | 3300020579 | Soil | PLRGKLLKDGGETVRMRIGDGWDVDIYKAMILAVEQDAMALLPA |
| Ga0210407_114182552 | 3300020579 | Soil | EETVRMRIGEGWDVDIYKAMILAVEKDGMALFPAA |
| Ga0210403_103231103 | 3300020580 | Soil | VPLRGKLLKVGDETVRMRIGDGWDVDIYKTMIMAVEEDSMALLPA |
| Ga0210406_106225993 | 3300021168 | Soil | LRGTLLKDGGETVRMRIGEGWDVDIYKAMILAVEQDAMALLPA |
| Ga0210406_111546711 | 3300021168 | Soil | LLKEGGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA |
| Ga0210406_113841641 | 3300021168 | Soil | LRGRLLKDSGETLRMRIGDGWDVDIYKNMVLAVEEDAMALIPA |
| Ga0210405_102044073 | 3300021171 | Soil | GGETVRMRIGEGWDVDIYKAMILAVEQDAMALLPA |
| Ga0210408_101216411 | 3300021178 | Soil | VPLRGKMLKDGGDTVRMRIDGWDIDIYKTMILAVEEDAMVLLPA |
| Ga0210396_102089444 | 3300021180 | Soil | LRGRLLKEGGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA |
| Ga0210396_105094151 | 3300021180 | Soil | KNGSETIRMRIGEGWDVDIYKSMIMTVERDSTVLLSA |
| Ga0210388_102521823 | 3300021181 | Soil | GRLLKDDGGETVRMRIGEGWDVDIYKAMILAVEEDAMVLLPA |
| Ga0210393_104544373 | 3300021401 | Soil | DGDETVRMRIGEGWDVDIYKTMILAVEQDAMALLPA |
| Ga0210393_112653621 | 3300021401 | Soil | LQVVSGDIKVPLRGKLLKDKGETVRIRIDGSDIDIYKTMILAVEEDAMVMLPA |
| Ga0210383_100143646 | 3300021407 | Soil | GTLLKDGDETVRMRIGEGWDVDIYKTMILAVEQDAMALLPA |
| Ga0210391_108774383 | 3300021433 | Soil | LRVALGDIKVPLRGKMLKDGGDTIRMRIDGWDIDIYKTMILAVEEDAMVLLPA |
| Ga0210398_110676332 | 3300021477 | Soil | KVPLRGKLLKDKGETVRIRIDGSDIDIYKTMILAVEEDAMVMLPA |
| Ga0210402_112828533 | 3300021478 | Soil | LLKESGDTVRMRIGEGWDVDIYKTMILGVEEDGMALMPA |
| Ga0210410_101550234 | 3300021479 | Soil | GKMLKDGGDTVRMRIDGWDIDIYKTMILAVEEDAMVLLPA |
| Ga0126371_112979023 | 3300021560 | Tropical Forest Soil | LKENSETVRMRIGEGWDVDIYKTMIRGVEEDGMAMVPA |
| Ga0126371_137925942 | 3300021560 | Tropical Forest Soil | LLKDGNDTVRMRIGEGWDVDIYKTMILAVEEDAMVLLPS |
| Ga0228598_10122573 | 3300024227 | Rhizosphere | PLRGTLLKDGGETVRMRIGEGWDVDIYKAMILAVEQDAMALLPA |
| Ga0137417_10201282 | 3300024330 | Vadose Zone Soil | RLLKEGGETVRMRIGDGWDVDIYKTMILAVEEDAMVLLPA |
| Ga0137417_12026233 | 3300024330 | Vadose Zone Soil | GKLLKDGGETIRMRIGEGWDVDIYKAMILAVEEDSMVMLPA |
| Ga0207693_108880613 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GRVMKDGGDTVRMRIGDGWDVDIYKAMILAVEEDAMALIPA |
| Ga0207700_100383695 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GKLLKDKGETVRIRIDGSDIDIYKTMILAVEEDAMVLLPA |
| Ga0209839_102309242 | 3300026294 | Soil | VALGDIKVPLRGTLLRDGVESVRMRIGEGYDVDIYKEMIMAVEQDAMVALPA |
| Ga0209688_10470623 | 3300026305 | Soil | RGKLLKDGDDTVRMRIGDGWDVDIYKAMILAVEEDSMVLLPA |
| Ga0209470_13414861 | 3300026324 | Soil | RGRLLMDGGETLRVRIGDGWDVDIFKNMVLAVEEDAMALIPA |
| Ga0257168_10775953 | 3300026514 | Soil | LKDSGETLRMRIGDGWDVDIYKNMVLAVEEDAMALIPA |
| Ga0179587_102375443 | 3300026557 | Vadose Zone Soil | GKLLKDGSDTIRMRIGEGWDVDIYKAMILAVEADSMVMLPA |
| Ga0179587_110775132 | 3300026557 | Vadose Zone Soil | KEGGDTLRVRIGDRWDVDIYKTMVLAVEEDSMATVAA |
| Ga0209116_11408801 | 3300027590 | Forest Soil | DIKVPLRGKLLKDKGETVRIRIDGSDIDIYKTMILAVEEDAMVMLPA |
| Ga0209422_11113321 | 3300027629 | Forest Soil | KDGSETIRMRIGEGWDVDIYKSMIMTVERDSMVLLSA |
| Ga0209736_10392541 | 3300027660 | Forest Soil | KEGGETVRMRIGEGWDVDIYKAMILAVEHDAMALVTV |
| Ga0209118_10347431 | 3300027674 | Forest Soil | EGGETVRMRIGDGWDVDIYKAMILAVEQDAMVLLPA |
| Ga0209626_11475533 | 3300027684 | Forest Soil | SGETLRMRIGEGWDVDIYKAMVLAVEQDSMSTTLPA |
| Ga0209038_102377282 | 3300027737 | Bog Forest Soil | ALGDINVPLRGKMLKDGGDTVRMRIDGWDIDIYKSMILAVEEDAMVLLPA |
| Ga0208989_102029242 | 3300027738 | Forest Soil | LRGTLLKDGSETVRMRIGEGWDVDIYKSMIMTVERDSMVLLSA |
| Ga0209908_101668981 | 3300027745 | Thawing Permafrost | SEETVRMRIGDGWDVDIYKVMILAVEQDGMALRPA |
| Ga0209039_102530171 | 3300027825 | Bog Forest Soil | RGKLLKENGETVRVRIGEGWDVDIYKTMILDVQEDLMAMIPT |
| Ga0209180_104220253 | 3300027846 | Vadose Zone Soil | DSGMALRMRIGDAWDVDIFKTMILAIEEDALAYQAA |
| Ga0209274_104486051 | 3300027853 | Soil | LLKDGGETVRMRIGEGWDVDIYKAMILAVEQDAMALLPA |
| Ga0209517_101639981 | 3300027854 | Peatlands Soil | KLLKENPETVRMRIGEGWDVDIYKTMILDVQEDLMAMFPA |
| Ga0209465_103948333 | 3300027874 | Tropical Forest Soil | LKENSDSVRLRIGEGWDVDIYKAMIQAVEEDKMAMIRA |
| Ga0209283_102179153 | 3300027875 | Vadose Zone Soil | GRLLKDGDDTVRMRIGDGWDVDIYKAMILAVEEDSMVLLPA |
| Ga0209590_103234981 | 3300027882 | Vadose Zone Soil | GKLLKVGGETVRMRIGDAWDVDIYKAMILAVEEDSMVLLPA |
| Ga0209590_103692743 | 3300027882 | Vadose Zone Soil | LRGKLLKDSGETLRMRIGEKWDVDIYKAMVMAVEEDSMATLPA |
| Ga0209275_103737731 | 3300027884 | Soil | RLLKEGGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA |
| Ga0209006_104792051 | 3300027908 | Forest Soil | GTLLKNGSETIRMRIGEGWDVDIYKSMIMTVERDSTVLLSA |
| Ga0209583_107139901 | 3300027910 | Watersheds | LLKEGGETVRMRIGEGWDVDIYKTMILAVEEDSLVHLPA |
| Ga0222749_104786773 | 3300029636 | Soil | LKEGGDTVRMRIGDGWDVDIYKTMILAVEQDGMVLLPAQSR |
| Ga0302314_106090283 | 3300030906 | Palsa | RLLKDGDETIRMRIGEGWDVDIYKAMIVTVDQDVMALHPA |
| Ga0170822_148071073 | 3300031122 | Forest Soil | LKEGGETVRMRVGDGWDIDIYKAMILTVEKDGMALIPA |
| Ga0307468_1000765193 | 3300031740 | Hardwood Forest Soil | LKVGGETVRMRIGDGWDVDIYKTMILAVEEDAMVLLPA |
| Ga0307475_102707501 | 3300031754 | Hardwood Forest Soil | KLLKENSDSVRLRIGEGWDVDIYKAMIQAVEEDKMALIPA |
| Ga0307475_104696451 | 3300031754 | Hardwood Forest Soil | LRGRLLKDGGETLRMRIGEGWDVDIYKTMVLAVEEDAMALIPA |
| Ga0307475_106098203 | 3300031754 | Hardwood Forest Soil | GSETIRMRIGEGWDVDIYKSMIMTVERDSMVLLSA |
| Ga0307478_101971091 | 3300031823 | Hardwood Forest Soil | VALGDINVPLRGKMLKDGGDTVRMRIDGWDIDIYKTMILAVEEDAMVLLPA |
| Ga0307479_102945371 | 3300031962 | Hardwood Forest Soil | RLLKDGGETLRMRIGDGWDVDIYKSMVLAVEEDAMALIPA |
| Ga0310911_109040511 | 3300032035 | Soil | KLLKENSDTVRMRIGEGWDVDIYKTMIRGVEEDGLAMVPA |
| Ga0307472_1004029633 | 3300032205 | Hardwood Forest Soil | KDGGETVRMRIGDGWDVDIYKAMILAVEEDTMVHLPA |
| Ga0307472_1004909921 | 3300032205 | Hardwood Forest Soil | MLKDGGDTVRMRIDGWDIDIYKSMILAVEEDAMVLFSV |
| Ga0335083_110504212 | 3300032954 | Soil | DGGETLRMRIGDGWDVDIYKAMILAVEEDAMALIPA |
| ⦗Top⦘ |