| Basic Information | |
|---|---|
| Family ID | F069010 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AKIIQVLFTSGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.77 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.871 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 52.42 |
| PF01553 | Acyltransferase | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF00335 | Tetraspanin | 0.81 |
| PF08669 | GCV_T_C | 0.81 |
| PF00848 | Ring_hydroxyl_A | 0.81 |
| PF13607 | Succ_CoA_lig | 0.81 |
| PF08239 | SH3_3 | 0.81 |
| PF07676 | PD40 | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF01571 | GCV_T | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402GCKX4 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 502 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11341172 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300000881|JGI10215J12807_1242731 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300000956|JGI10216J12902_103026531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 505 | Open in IMG/M |
| 3300000956|JGI10216J12902_104933941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae | 885 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_102580673 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300002568|C688J35102_119158697 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300004156|Ga0062589_102711349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 516 | Open in IMG/M |
| 3300004157|Ga0062590_102999933 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004463|Ga0063356_101409697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae | 1026 | Open in IMG/M |
| 3300004480|Ga0062592_102492086 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005329|Ga0070683_102245510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 524 | Open in IMG/M |
| 3300005337|Ga0070682_100377020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae | 1066 | Open in IMG/M |
| 3300005345|Ga0070692_10619329 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005367|Ga0070667_101607342 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005436|Ga0070713_101385498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 682 | Open in IMG/M |
| 3300005444|Ga0070694_101128070 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005445|Ga0070708_100259129 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300005455|Ga0070663_101430238 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005471|Ga0070698_100827171 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005546|Ga0070696_101392076 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005547|Ga0070693_100837732 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005563|Ga0068855_100389192 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300005563|Ga0068855_101716573 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005577|Ga0068857_100737785 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005578|Ga0068854_100109874 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300005578|Ga0068854_100448774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae | 1077 | Open in IMG/M |
| 3300005617|Ga0068859_101444972 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005719|Ga0068861_102178814 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005840|Ga0068870_10495838 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005842|Ga0068858_102469005 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005843|Ga0068860_101417240 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006046|Ga0066652_100775081 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006196|Ga0075422_10548344 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006237|Ga0097621_100735849 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300006358|Ga0068871_101379715 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006576|Ga0074047_11655364 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006580|Ga0074049_12921415 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006755|Ga0079222_10659384 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006844|Ga0075428_100545473 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006844|Ga0075428_100717506 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006847|Ga0075431_100928815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae | 839 | Open in IMG/M |
| 3300006847|Ga0075431_101936676 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006871|Ga0075434_100878617 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006903|Ga0075426_11525743 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006904|Ga0075424_102534124 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006914|Ga0075436_100151850 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300009093|Ga0105240_11784963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 641 | Open in IMG/M |
| 3300009094|Ga0111539_10374044 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300009098|Ga0105245_11251849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 790 | Open in IMG/M |
| 3300009100|Ga0075418_10011063 | All Organisms → cellular organisms → Bacteria | 10084 | Open in IMG/M |
| 3300009101|Ga0105247_11605976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 534 | Open in IMG/M |
| 3300009148|Ga0105243_13092658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 504 | Open in IMG/M |
| 3300009156|Ga0111538_13109237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 579 | Open in IMG/M |
| 3300009162|Ga0075423_10360301 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300009162|Ga0075423_11049386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 867 | Open in IMG/M |
| 3300009162|Ga0075423_12778361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 536 | Open in IMG/M |
| 3300009177|Ga0105248_11867525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 682 | Open in IMG/M |
| 3300009553|Ga0105249_10424298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1364 | Open in IMG/M |
| 3300010358|Ga0126370_12209286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 542 | Open in IMG/M |
| 3300010375|Ga0105239_10282741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1868 | Open in IMG/M |
| 3300010397|Ga0134124_11583567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 685 | Open in IMG/M |
| 3300010401|Ga0134121_12074061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 603 | Open in IMG/M |
| 3300011119|Ga0105246_11638194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 609 | Open in IMG/M |
| 3300011119|Ga0105246_11756052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 591 | Open in IMG/M |
| 3300011415|Ga0137325_1013402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1609 | Open in IMG/M |
| 3300012469|Ga0150984_120792615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 510 | Open in IMG/M |
| 3300012896|Ga0157303_10191233 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012939|Ga0162650_100095135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 522 | Open in IMG/M |
| 3300012951|Ga0164300_10146239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1101 | Open in IMG/M |
| 3300012951|Ga0164300_10476530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 707 | Open in IMG/M |
| 3300012957|Ga0164303_10365537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 878 | Open in IMG/M |
| 3300012958|Ga0164299_10387383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 893 | Open in IMG/M |
| 3300012961|Ga0164302_10390882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 945 | Open in IMG/M |
| 3300012984|Ga0164309_11061016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 671 | Open in IMG/M |
| 3300012988|Ga0164306_11156250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP8922 | 647 | Open in IMG/M |
| 3300012989|Ga0164305_10460004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 991 | Open in IMG/M |
| 3300013296|Ga0157374_12320375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300013297|Ga0157378_10255999 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300014166|Ga0134079_10618662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 541 | Open in IMG/M |
| 3300014325|Ga0163163_10474639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1312 | Open in IMG/M |
| 3300014497|Ga0182008_10908004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 519 | Open in IMG/M |
| 3300015373|Ga0132257_103504058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 571 | Open in IMG/M |
| 3300015374|Ga0132255_104504024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 590 | Open in IMG/M |
| 3300015374|Ga0132255_106072207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 511 | Open in IMG/M |
| 3300016319|Ga0182033_10661130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 912 | Open in IMG/M |
| 3300018079|Ga0184627_10454044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 665 | Open in IMG/M |
| 3300018432|Ga0190275_10021987 | All Organisms → cellular organisms → Bacteria | 4968 | Open in IMG/M |
| 3300018469|Ga0190270_13003724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 533 | Open in IMG/M |
| 3300018476|Ga0190274_11459038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 775 | Open in IMG/M |
| 3300018481|Ga0190271_10349914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1558 | Open in IMG/M |
| 3300019361|Ga0173482_10739365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 514 | Open in IMG/M |
| 3300019767|Ga0190267_11595590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 510 | Open in IMG/M |
| 3300020005|Ga0193697_1105916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 667 | Open in IMG/M |
| 3300021075|Ga0194063_10344001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 569 | Open in IMG/M |
| 3300022889|Ga0247785_1007035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1125 | Open in IMG/M |
| 3300025899|Ga0207642_10306956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 922 | Open in IMG/M |
| 3300025899|Ga0207642_11098210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 514 | Open in IMG/M |
| 3300025900|Ga0207710_10208187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 968 | Open in IMG/M |
| 3300025903|Ga0207680_10317960 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300025927|Ga0207687_10055183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 2783 | Open in IMG/M |
| 3300025927|Ga0207687_11518113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 575 | Open in IMG/M |
| 3300025931|Ga0207644_11555430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 555 | Open in IMG/M |
| 3300025934|Ga0207686_10449451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 991 | Open in IMG/M |
| 3300025944|Ga0207661_10861962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 834 | Open in IMG/M |
| 3300026089|Ga0207648_11990309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 542 | Open in IMG/M |
| 3300026116|Ga0207674_10631909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1034 | Open in IMG/M |
| 3300026142|Ga0207698_10586968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1097 | Open in IMG/M |
| 3300028138|Ga0247684_1084447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 527 | Open in IMG/M |
| 3300028771|Ga0307320_10220292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 744 | Open in IMG/M |
| 3300028807|Ga0307305_10165629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1020 | Open in IMG/M |
| 3300028824|Ga0307310_10223975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 895 | Open in IMG/M |
| 3300028881|Ga0307277_10112657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 1161 | Open in IMG/M |
| 3300031680|Ga0318574_10692815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 597 | Open in IMG/M |
| 3300031765|Ga0318554_10595535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 623 | Open in IMG/M |
| 3300031892|Ga0310893_10276341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 704 | Open in IMG/M |
| 3300031902|Ga0302322_102946236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 586 | Open in IMG/M |
| 3300031908|Ga0310900_11386026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 590 | Open in IMG/M |
| 3300032009|Ga0318563_10626938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 579 | Open in IMG/M |
| 3300032180|Ga0307471_103788595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 535 | Open in IMG/M |
| 3300033551|Ga0247830_10583141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 884 | Open in IMG/M |
| 3300034115|Ga0364945_0085861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 911 | Open in IMG/M |
| 3300034194|Ga0370499_0102384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 716 | Open in IMG/M |
| 3300034195|Ga0370501_0372044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14 | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08553280 | 2189573004 | Grass Soil | GRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA |
| ICChiseqgaiiFebDRAFT_113411721 | 3300000363 | Soil | GRDWPYGAALGFVLMVITLVGTLLALRTLRREVVGSST* |
| JGI10215J12807_12427312 | 3300000881 | Soil | AGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD* |
| JGI10216J12902_1030265311 | 3300000956 | Soil | GAQTTTAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA* |
| JGI10216J12902_1049339411 | 3300000956 | Soil | KNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVVGGD* |
| JGIcombinedJ13530_1025806732 | 3300001213 | Wetland | AQTTTVAKVVQTLFLSGRDWPQGAALGFILMAVTIIGTFAAIRSLRTEVLS* |
| C688J35102_1191586971 | 3300002568 | Soil | IQVIFTSGRDWPYGSALGFLLMIVTLGGTIVALRTLRREVLA* |
| Ga0062589_1027113492 | 3300004156 | Soil | TTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD* |
| Ga0062590_1029999332 | 3300004157 | Soil | KIVQIIFTSGRDWPYGSALGFVLMAITIAGTMLALRSLRREVIGAPA* |
| Ga0063356_1014096971 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0062592_1024920862 | 3300004480 | Soil | KNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0070683_1022455102 | 3300005329 | Corn Rhizosphere | AKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGAD* |
| Ga0070682_1003770202 | 3300005337 | Corn Rhizosphere | KNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD* |
| Ga0070692_106193291 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TTIANLIQVIFTTGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGVSA* |
| Ga0070667_1016073422 | 3300005367 | Switchgrass Rhizosphere | TTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD* |
| Ga0070713_1013854982 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KVVQVIFTSGRDWPYGSALGFLLMVVTLGGTLLALRSLRQETFAA* |
| Ga0070694_1011280701 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TIAKIVQVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA* |
| Ga0070708_1002591291 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IIQVIFTSGRDWPYGSALGFLLMIVTLAGTLLALRTLRREVLA* |
| Ga0070663_1014302382 | 3300005455 | Corn Rhizosphere | TTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD* |
| Ga0070698_1008271712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GTDTTTIAKLIQVIFTSGRDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG* |
| Ga0070696_1013920762 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GAQTTTIAKIVQVLFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRRETFA* |
| Ga0070693_1008377321 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GTTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD* |
| Ga0068855_1003891923 | 3300005563 | Corn Rhizosphere | TGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGVSA* |
| Ga0068855_1017165731 | 3300005563 | Corn Rhizosphere | TIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGANA* |
| Ga0068857_1007377851 | 3300005577 | Corn Rhizosphere | QELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD* |
| Ga0068854_1001098743 | 3300005578 | Corn Rhizosphere | VQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG* |
| Ga0068854_1004487742 | 3300005578 | Corn Rhizosphere | AKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD* |
| Ga0068859_1014449721 | 3300005617 | Switchgrass Rhizosphere | RDWPYGSALGFILMVLTLGGTLLALRSLRRETFG* |
| Ga0068861_1021788142 | 3300005719 | Switchgrass Rhizosphere | GRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA* |
| Ga0068870_104958382 | 3300005840 | Miscanthus Rhizosphere | LFLEGRDWPYGAALGFVLMLVTLIGTLAALRTLRREVVAG* |
| Ga0068858_1024690051 | 3300005842 | Switchgrass Rhizosphere | ELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD* |
| Ga0068860_1014172402 | 3300005843 | Switchgrass Rhizosphere | AQTTTIAKLVQTIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA* |
| Ga0066652_1007750811 | 3300006046 | Soil | VQVIFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIG* |
| Ga0075422_105483442 | 3300006196 | Populus Rhizosphere | LLGGPGTTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0097621_1007358492 | 3300006237 | Miscanthus Rhizosphere | TTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE* |
| Ga0068871_1013797152 | 3300006358 | Miscanthus Rhizosphere | LFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD* |
| Ga0074047_116553641 | 3300006576 | Soil | GRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG* |
| Ga0074049_129214152 | 3300006580 | Soil | AQTSTIAKIVQVLFTSGRDWPYGSALGFMLMVITLAGTLFAIRALRQETFG* |
| Ga0079222_106593841 | 3300006755 | Agricultural Soil | IVQVIFTSGRNWPSGSALGFLLMVVTMIGTLTALRTFRREVLAG* |
| Ga0075428_1005454733 | 3300006844 | Populus Rhizosphere | TTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0075428_1007175062 | 3300006844 | Populus Rhizosphere | PQTTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLVGTLIALRTLRREVIGAD* |
| Ga0075431_1009288152 | 3300006847 | Populus Rhizosphere | IAKNIQELFLAGRDWPYGAALGFVLMIVTLSGTLVALRTLRREVIGGD* |
| Ga0075431_1019366762 | 3300006847 | Populus Rhizosphere | QELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0075434_1008786171 | 3300006871 | Populus Rhizosphere | TTIAKLIQVIFTSGRDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG* |
| Ga0075426_115257431 | 3300006903 | Populus Rhizosphere | TIAKNIQEIFLAGRDWPYGAALGFVLMIVTLVGTLVALRTLRREVIGSD* |
| Ga0075424_1025341242 | 3300006904 | Populus Rhizosphere | TTIAKNIQELFLAGRDWPYGAALGFVLMIVTLAGTLIALRTLRREVVGGD* |
| Ga0075436_1001518503 | 3300006914 | Populus Rhizosphere | FLAGRDWPYGAALGFVLMIVTLVGTLVALRTLRREVIGSD* |
| Ga0105240_117849631 | 3300009093 | Corn Rhizosphere | VLFTSGRDWPYGSALGFILMIATLGGTLLALRSLRRETFA* |
| Ga0111539_103740441 | 3300009094 | Populus Rhizosphere | TTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVAGGD* |
| Ga0105245_112518491 | 3300009098 | Miscanthus Rhizosphere | LLGGPATTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE* |
| Ga0075418_100110631 | 3300009100 | Populus Rhizosphere | EGRDWPYGAALGFVLMILTLAGTLLALRTLRREVVAG* |
| Ga0105247_116059762 | 3300009101 | Switchgrass Rhizosphere | DWPYGAALGFVLMLVTLIGTLAALRTLRREVVAG* |
| Ga0105243_130926582 | 3300009148 | Miscanthus Rhizosphere | LGGAQTTTAAKLVQVLFTSGRDWPYGSALGFLLMIVTMGGTLVALRSLRRETFG* |
| Ga0111538_131092372 | 3300009156 | Populus Rhizosphere | AAKLVQVLFTTGNNWPYGSALAFILMVITLAGTLLALRSLRRETFA* |
| Ga0075423_103603011 | 3300009162 | Populus Rhizosphere | GGPGTTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD* |
| Ga0075423_110493861 | 3300009162 | Populus Rhizosphere | TTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD* |
| Ga0075423_127783612 | 3300009162 | Populus Rhizosphere | SGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIGTPA* |
| Ga0105248_118675252 | 3300009177 | Switchgrass Rhizosphere | LFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG* |
| Ga0105249_104242981 | 3300009553 | Switchgrass Rhizosphere | GRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD* |
| Ga0126370_122092861 | 3300010358 | Tropical Forest Soil | QVIFTSGRDWPYGSALGFLLMVITLGGTLLALRSLRRETFAS* |
| Ga0105239_102827411 | 3300010375 | Corn Rhizosphere | TTTIAKLVQTIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA* |
| Ga0134124_115835672 | 3300010397 | Terrestrial Soil | FTTGRDWPYGSALGFMLMVITIAGTLLAIRALRQETLG* |
| Ga0134121_120740611 | 3300010401 | Terrestrial Soil | KVVQVLFTSGRDWPYGSALGFMLIVITLAGTFLALRALRQETFG* |
| Ga0105246_116381942 | 3300011119 | Miscanthus Rhizosphere | IAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD* |
| Ga0105246_117560522 | 3300011119 | Miscanthus Rhizosphere | STTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE* |
| Ga0137325_10134021 | 3300011415 | Soil | PQTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD* |
| Ga0150984_1207926151 | 3300012469 | Avena Fatua Rhizosphere | RDWPYGSALGFLLMVLTLGGTLLALRSLRREAFA* |
| Ga0157303_101912331 | 3300012896 | Soil | KVVQVLFTTGRDWPDGSALGFMLMVITLAGTLLAIRALRQETLG* |
| Ga0162650_1000951351 | 3300012939 | Soil | ELFLEGRDWPYGSALGFMLMLITLAGTFIALRTLRREVVGA* |
| Ga0164300_101462391 | 3300012951 | Soil | VQVLFTSGRDWPYGSALGFMLLVITLAGTLLAIRALRQETLG* |
| Ga0164300_104765302 | 3300012951 | Soil | AKIIQVLFTSGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG* |
| Ga0164303_103655371 | 3300012957 | Soil | GHDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG* |
| Ga0164299_103873831 | 3300012958 | Soil | KVVQVLFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG* |
| Ga0164302_103908822 | 3300012961 | Soil | VQTLFLSGRDWPQGAALGFILMAVTIIGTFAAIRSLRTEVL* |
| Ga0164309_110610162 | 3300012984 | Soil | QVLFTSGRDWPYGSSLGFLLMVITLGGPLLALRSLRRETFS* |
| Ga0164306_111562502 | 3300012988 | Soil | GRDWPYGSSLGFLLMVITLGGTLLALRSLRRETFS* |
| Ga0164305_104600042 | 3300012989 | Soil | DWPTESALGFMLMVITLAGTLLALRWVRRETLAA* |
| Ga0157374_123203752 | 3300013296 | Miscanthus Rhizosphere | GGPSTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD* |
| Ga0157378_102559993 | 3300013297 | Miscanthus Rhizosphere | VQVLFTSGRDWPYGSALGFMLMVITLAGTLFAIRALRQETFG* |
| Ga0134079_106186621 | 3300014166 | Grasslands Soil | IAKVVQVLFTSGRDWPYGSALGFLLMVITLAGTLFAIRSLRQETFG* |
| Ga0163163_104746391 | 3300014325 | Switchgrass Rhizosphere | KNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE* |
| Ga0182008_109080041 | 3300014497 | Rhizosphere | GRDWPYGSALAFILMVLTLAGTFLSIRSLRQETFG* |
| Ga0132257_1035040582 | 3300015373 | Arabidopsis Rhizosphere | TTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD* |
| Ga0132255_1045040241 | 3300015374 | Arabidopsis Rhizosphere | ANLIQVIFTTGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA* |
| Ga0132255_1060722071 | 3300015374 | Arabidopsis Rhizosphere | TIAKVVQVVFQSGRDWPYGSALGFLLMVITLAGTFLALRTLRRETLGGG* |
| Ga0182033_106611302 | 3300016319 | Soil | TIAKVVQVIFTSGRDWPSGSALGFLLMIATLVGTLLALRWVRRETLGAA |
| Ga0184627_104540441 | 3300018079 | Groundwater Sediment | NIQELFLEGRDWPYGAALGFILMIVTLGGTLLALRTLRREVVGS |
| Ga0190275_100219871 | 3300018432 | Soil | AKIVQIIFTTGRDWPYGSALGFVLMAITIAGTLVALRSLRREVVGTAA |
| Ga0190270_130037242 | 3300018469 | Soil | TIAKVVQELFLEGRDWPYGAALGFLLMVVTLGGTLFALRPLRSEVVGT |
| Ga0190274_114590382 | 3300018476 | Soil | GGAQTTTAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA |
| Ga0190271_103499141 | 3300018481 | Soil | KVVQELFLEGRDWPYGSALGFFLMLITLVGTFIALRTLRREVVGA |
| Ga0173482_107393651 | 3300019361 | Soil | AKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD |
| Ga0190267_115955901 | 3300019767 | Soil | LLGGAQTTTAAKLVQTLFTTGRDWPYGSALGFVLMVVTLGGTLLALRSLRRETFA |
| Ga0193697_11059161 | 3300020005 | Soil | FAKVVQVLFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG |
| Ga0194063_103440011 | 3300021075 | Anoxic Zone Freshwater | QNLFLSSRDWPYGAALGFVLIALTIGGTVAALGPLRREVIG |
| Ga0247785_10070351 | 3300022889 | Soil | TIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD |
| Ga0207642_103069561 | 3300025899 | Miscanthus Rhizosphere | TIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD |
| Ga0207642_110982101 | 3300025899 | Miscanthus Rhizosphere | KTTTAAKLVQVLFTSGRDWPYGSALGFLLMIVTMGGTLVALRSLRRETFG |
| Ga0207710_102081871 | 3300025900 | Switchgrass Rhizosphere | GPATTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE |
| Ga0207680_103179602 | 3300025903 | Switchgrass Rhizosphere | LGGPSTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD |
| Ga0207687_100551831 | 3300025927 | Miscanthus Rhizosphere | IFTTVRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA |
| Ga0207687_115181131 | 3300025927 | Miscanthus Rhizosphere | IFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIG |
| Ga0207644_115554302 | 3300025931 | Switchgrass Rhizosphere | TTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE |
| Ga0207686_104494512 | 3300025934 | Miscanthus Rhizosphere | NIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD |
| Ga0207661_108619622 | 3300025944 | Corn Rhizosphere | DWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD |
| Ga0207648_119903091 | 3300026089 | Miscanthus Rhizosphere | KVVQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG |
| Ga0207674_106319091 | 3300026116 | Corn Rhizosphere | FLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD |
| Ga0207698_105869683 | 3300026142 | Corn Rhizosphere | GRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG |
| Ga0247684_10844472 | 3300028138 | Soil | QVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA |
| Ga0307320_102202921 | 3300028771 | Soil | RDWPYGAALGFVLMIVTLGGTLIALRTLRREVIGSD |
| Ga0307305_101656291 | 3300028807 | Soil | QTTTIAKIVQVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLG |
| Ga0307310_102239752 | 3300028824 | Soil | LFTAGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVLA |
| Ga0307277_101126571 | 3300028881 | Soil | TIAKIVQVIFTSGRDWPYGSALGFLLMAVTLVGTLLALRSLRREVIG |
| Ga0318574_106928151 | 3300031680 | Soil | VVQILFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG |
| Ga0318554_105955352 | 3300031765 | Soil | GRDWPYGSALGFMLMVITLAGTFLALRALRQETFG |
| Ga0310893_102763411 | 3300031892 | Soil | GNDWPYGSALAFILMVITLDGTLLALRSLRRETFA |
| Ga0302322_1029462361 | 3300031902 | Fen | QTLFTTGRNWPYGSALGFMLMLVTMVGTLAALRFVRRETLGG |
| Ga0310900_113860261 | 3300031908 | Soil | TIAKNIQELFLAGRDWPYGAALGFILMAVTLLGTLVALRTLRREVVGGD |
| Ga0318563_106269381 | 3300032009 | Soil | VQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG |
| Ga0307471_1037885951 | 3300032180 | Hardwood Forest Soil | TIAKIVQVLFTSGRDWPYGSALGFLLMVVTLGGTLVALRTLRRQVLA |
| Ga0247830_105831411 | 3300033551 | Soil | TAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA |
| Ga0364945_0085861_794_910 | 3300034115 | Sediment | LQGRDWPYGAALGFLVMIVTLGGTLLALGPLRREVAGS |
| Ga0370499_0102384_555_716 | 3300034194 | Untreated Peat Soil | GPQTTTIAKNIQELFLEGRDWPYGAALGFLLMIVTLSGTLIALRTLRREVIGS |
| Ga0370501_0372044_1_111 | 3300034195 | Untreated Peat Soil | GRNWPYGSALGFILMLVTMVGTLAALRFVRRETLGG |
| ⦗Top⦘ |