NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069010

Metagenome / Metatranscriptome Family F069010

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069010
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence AKIIQVLFTSGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG
Number of Associated Samples 112
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 96.77 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.129 % of family members)
Environment Ontology (ENVO) Unclassified
(36.290 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(58.871 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.79%    β-sheet: 0.00%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00528BPD_transp_1 52.42
PF01553Acyltransferase 0.81
PF07690MFS_1 0.81
PF00335Tetraspanin 0.81
PF08669GCV_T_C 0.81
PF00848Ring_hydroxyl_A 0.81
PF13607Succ_CoA_lig 0.81
PF08239SH3_3 0.81
PF07676PD40 0.81
PF00903Glyoxalase 0.81
PF01571GCV_T 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS402GCKX4All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14502Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11341172All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300000881|JGI10215J12807_1242731All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300000956|JGI10216J12902_103026531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14505Open in IMG/M
3300000956|JGI10216J12902_104933941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae885Open in IMG/M
3300001213|JGIcombinedJ13530_102580673All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300002568|C688J35102_119158697All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300004156|Ga0062589_102711349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales516Open in IMG/M
3300004157|Ga0062590_102999933All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300004463|Ga0063356_101409697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae1026Open in IMG/M
3300004480|Ga0062592_102492086All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005329|Ga0070683_102245510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales524Open in IMG/M
3300005337|Ga0070682_100377020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae1066Open in IMG/M
3300005345|Ga0070692_10619329All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005367|Ga0070667_101607342All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005436|Ga0070713_101385498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14682Open in IMG/M
3300005444|Ga0070694_101128070All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005445|Ga0070708_100259129All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300005455|Ga0070663_101430238All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005471|Ga0070698_100827171All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300005546|Ga0070696_101392076All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005547|Ga0070693_100837732All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005563|Ga0068855_100389192All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300005563|Ga0068855_101716573All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005577|Ga0068857_100737785All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005578|Ga0068854_100109874All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300005578|Ga0068854_100448774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae1077Open in IMG/M
3300005617|Ga0068859_101444972All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005719|Ga0068861_102178814All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005840|Ga0068870_10495838All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300005842|Ga0068858_102469005All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005843|Ga0068860_101417240All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300006046|Ga0066652_100775081All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300006196|Ga0075422_10548344All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006237|Ga0097621_100735849All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300006358|Ga0068871_101379715All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006576|Ga0074047_11655364All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006580|Ga0074049_12921415All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300006755|Ga0079222_10659384All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300006844|Ga0075428_100545473All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300006844|Ga0075428_100717506All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300006847|Ga0075431_100928815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae839Open in IMG/M
3300006847|Ga0075431_101936676All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006871|Ga0075434_100878617All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006903|Ga0075426_11525743All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006904|Ga0075424_102534124All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006914|Ga0075436_100151850All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300009093|Ga0105240_11784963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14641Open in IMG/M
3300009094|Ga0111539_10374044All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300009098|Ga0105245_11251849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14790Open in IMG/M
3300009100|Ga0075418_10011063All Organisms → cellular organisms → Bacteria10084Open in IMG/M
3300009101|Ga0105247_11605976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14534Open in IMG/M
3300009148|Ga0105243_13092658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14504Open in IMG/M
3300009156|Ga0111538_13109237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14579Open in IMG/M
3300009162|Ga0075423_10360301All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300009162|Ga0075423_11049386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14867Open in IMG/M
3300009162|Ga0075423_12778361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14536Open in IMG/M
3300009177|Ga0105248_11867525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14682Open in IMG/M
3300009553|Ga0105249_10424298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141364Open in IMG/M
3300010358|Ga0126370_12209286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14542Open in IMG/M
3300010375|Ga0105239_10282741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141868Open in IMG/M
3300010397|Ga0134124_11583567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14685Open in IMG/M
3300010401|Ga0134121_12074061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14603Open in IMG/M
3300011119|Ga0105246_11638194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14609Open in IMG/M
3300011119|Ga0105246_11756052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14591Open in IMG/M
3300011415|Ga0137325_1013402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141609Open in IMG/M
3300012469|Ga0150984_120792615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14510Open in IMG/M
3300012896|Ga0157303_10191233All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012939|Ga0162650_100095135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14522Open in IMG/M
3300012951|Ga0164300_10146239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141101Open in IMG/M
3300012951|Ga0164300_10476530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14707Open in IMG/M
3300012957|Ga0164303_10365537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14878Open in IMG/M
3300012958|Ga0164299_10387383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14893Open in IMG/M
3300012961|Ga0164302_10390882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14945Open in IMG/M
3300012984|Ga0164309_11061016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14671Open in IMG/M
3300012988|Ga0164306_11156250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP8922647Open in IMG/M
3300012989|Ga0164305_10460004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14991Open in IMG/M
3300013296|Ga0157374_12320375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300013297|Ga0157378_10255999All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300014166|Ga0134079_10618662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14541Open in IMG/M
3300014325|Ga0163163_10474639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141312Open in IMG/M
3300014497|Ga0182008_10908004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14519Open in IMG/M
3300015373|Ga0132257_103504058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14571Open in IMG/M
3300015374|Ga0132255_104504024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14590Open in IMG/M
3300015374|Ga0132255_106072207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14511Open in IMG/M
3300016319|Ga0182033_10661130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14912Open in IMG/M
3300018079|Ga0184627_10454044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14665Open in IMG/M
3300018432|Ga0190275_10021987All Organisms → cellular organisms → Bacteria4968Open in IMG/M
3300018469|Ga0190270_13003724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14533Open in IMG/M
3300018476|Ga0190274_11459038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14775Open in IMG/M
3300018481|Ga0190271_10349914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141558Open in IMG/M
3300019361|Ga0173482_10739365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14514Open in IMG/M
3300019767|Ga0190267_11595590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14510Open in IMG/M
3300020005|Ga0193697_1105916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14667Open in IMG/M
3300021075|Ga0194063_10344001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14569Open in IMG/M
3300022889|Ga0247785_1007035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141125Open in IMG/M
3300025899|Ga0207642_10306956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14922Open in IMG/M
3300025899|Ga0207642_11098210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14514Open in IMG/M
3300025900|Ga0207710_10208187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14968Open in IMG/M
3300025903|Ga0207680_10317960All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300025927|Ga0207687_10055183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_142783Open in IMG/M
3300025927|Ga0207687_11518113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14575Open in IMG/M
3300025931|Ga0207644_11555430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14555Open in IMG/M
3300025934|Ga0207686_10449451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14991Open in IMG/M
3300025944|Ga0207661_10861962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14834Open in IMG/M
3300026089|Ga0207648_11990309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14542Open in IMG/M
3300026116|Ga0207674_10631909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141034Open in IMG/M
3300026142|Ga0207698_10586968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141097Open in IMG/M
3300028138|Ga0247684_1084447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14527Open in IMG/M
3300028771|Ga0307320_10220292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14744Open in IMG/M
3300028807|Ga0307305_10165629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141020Open in IMG/M
3300028824|Ga0307310_10223975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14895Open in IMG/M
3300028881|Ga0307277_10112657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_141161Open in IMG/M
3300031680|Ga0318574_10692815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14597Open in IMG/M
3300031765|Ga0318554_10595535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14623Open in IMG/M
3300031892|Ga0310893_10276341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14704Open in IMG/M
3300031902|Ga0302322_102946236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14586Open in IMG/M
3300031908|Ga0310900_11386026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14590Open in IMG/M
3300032009|Ga0318563_10626938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14579Open in IMG/M
3300032180|Ga0307471_103788595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14535Open in IMG/M
3300033551|Ga0247830_10583141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14884Open in IMG/M
3300034115|Ga0364945_0085861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14911Open in IMG/M
3300034194|Ga0370499_0102384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14716Open in IMG/M
3300034195|Ga0370501_0372044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14521Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.61%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.81%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021075Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20mEnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_085532802189573004Grass SoilGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA
ICChiseqgaiiFebDRAFT_1134117213300000363SoilGRDWPYGAALGFVLMVITLVGTLLALRTLRREVVGSST*
JGI10215J12807_124273123300000881SoilAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD*
JGI10216J12902_10302653113300000956SoilGAQTTTAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA*
JGI10216J12902_10493394113300000956SoilKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVVGGD*
JGIcombinedJ13530_10258067323300001213WetlandAQTTTVAKVVQTLFLSGRDWPQGAALGFILMAVTIIGTFAAIRSLRTEVLS*
C688J35102_11915869713300002568SoilIQVIFTSGRDWPYGSALGFLLMIVTLGGTIVALRTLRREVLA*
Ga0062589_10271134923300004156SoilTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD*
Ga0062590_10299993323300004157SoilKIVQIIFTSGRDWPYGSALGFVLMAITIAGTMLALRSLRREVIGAPA*
Ga0063356_10140969713300004463Arabidopsis Thaliana RhizosphereTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0062592_10249208623300004480SoilKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0070683_10224551023300005329Corn RhizosphereAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGAD*
Ga0070682_10037702023300005337Corn RhizosphereKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD*
Ga0070692_1061932913300005345Corn, Switchgrass And Miscanthus RhizosphereTTIANLIQVIFTTGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGVSA*
Ga0070667_10160734223300005367Switchgrass RhizosphereTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD*
Ga0070713_10138549823300005436Corn, Switchgrass And Miscanthus RhizosphereKVVQVIFTSGRDWPYGSALGFLLMVVTLGGTLLALRSLRQETFAA*
Ga0070694_10112807013300005444Corn, Switchgrass And Miscanthus RhizosphereTIAKIVQVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA*
Ga0070708_10025912913300005445Corn, Switchgrass And Miscanthus RhizosphereIIQVIFTSGRDWPYGSALGFLLMIVTLAGTLLALRTLRREVLA*
Ga0070663_10143023823300005455Corn RhizosphereTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD*
Ga0070698_10082717123300005471Corn, Switchgrass And Miscanthus RhizosphereGTDTTTIAKLIQVIFTSGRDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG*
Ga0070696_10139207623300005546Corn, Switchgrass And Miscanthus RhizosphereGAQTTTIAKIVQVLFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRRETFA*
Ga0070693_10083773213300005547Corn, Switchgrass And Miscanthus RhizosphereGTTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD*
Ga0068855_10038919233300005563Corn RhizosphereTGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGVSA*
Ga0068855_10171657313300005563Corn RhizosphereTIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGANA*
Ga0068857_10073778513300005577Corn RhizosphereQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD*
Ga0068854_10010987433300005578Corn RhizosphereVQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG*
Ga0068854_10044877423300005578Corn RhizosphereAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD*
Ga0068859_10144497213300005617Switchgrass RhizosphereRDWPYGSALGFILMVLTLGGTLLALRSLRRETFG*
Ga0068861_10217881423300005719Switchgrass RhizosphereGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA*
Ga0068870_1049583823300005840Miscanthus RhizosphereLFLEGRDWPYGAALGFVLMLVTLIGTLAALRTLRREVVAG*
Ga0068858_10246900513300005842Switchgrass RhizosphereELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD*
Ga0068860_10141724023300005843Switchgrass RhizosphereAQTTTIAKLVQTIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA*
Ga0066652_10077508113300006046SoilVQVIFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIG*
Ga0075422_1054834423300006196Populus RhizosphereLLGGPGTTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0097621_10073584923300006237Miscanthus RhizosphereTTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE*
Ga0068871_10137971523300006358Miscanthus RhizosphereLFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD*
Ga0074047_1165536413300006576SoilGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG*
Ga0074049_1292141523300006580SoilAQTSTIAKIVQVLFTSGRDWPYGSALGFMLMVITLAGTLFAIRALRQETFG*
Ga0079222_1065938413300006755Agricultural SoilIVQVIFTSGRNWPSGSALGFLLMVVTMIGTLTALRTFRREVLAG*
Ga0075428_10054547333300006844Populus RhizosphereTTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0075428_10071750623300006844Populus RhizospherePQTTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLVGTLIALRTLRREVIGAD*
Ga0075431_10092881523300006847Populus RhizosphereIAKNIQELFLAGRDWPYGAALGFVLMIVTLSGTLVALRTLRREVIGGD*
Ga0075431_10193667623300006847Populus RhizosphereQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0075434_10087861713300006871Populus RhizosphereTTIAKLIQVIFTSGRDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG*
Ga0075426_1152574313300006903Populus RhizosphereTIAKNIQEIFLAGRDWPYGAALGFVLMIVTLVGTLVALRTLRREVIGSD*
Ga0075424_10253412423300006904Populus RhizosphereTTIAKNIQELFLAGRDWPYGAALGFVLMIVTLAGTLIALRTLRREVVGGD*
Ga0075436_10015185033300006914Populus RhizosphereFLAGRDWPYGAALGFVLMIVTLVGTLVALRTLRREVIGSD*
Ga0105240_1178496313300009093Corn RhizosphereVLFTSGRDWPYGSALGFILMIATLGGTLLALRSLRRETFA*
Ga0111539_1037404413300009094Populus RhizosphereTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVAGGD*
Ga0105245_1125184913300009098Miscanthus RhizosphereLLGGPATTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE*
Ga0075418_1001106313300009100Populus RhizosphereEGRDWPYGAALGFVLMILTLAGTLLALRTLRREVVAG*
Ga0105247_1160597623300009101Switchgrass RhizosphereDWPYGAALGFVLMLVTLIGTLAALRTLRREVVAG*
Ga0105243_1309265823300009148Miscanthus RhizosphereLGGAQTTTAAKLVQVLFTSGRDWPYGSALGFLLMIVTMGGTLVALRSLRRETFG*
Ga0111538_1310923723300009156Populus RhizosphereAAKLVQVLFTTGNNWPYGSALAFILMVITLAGTLLALRSLRRETFA*
Ga0075423_1036030113300009162Populus RhizosphereGGPGTTTIAKNIQELFLAGRDWPYGAALGFVLMVVTLTGTLVALRTLRREVVGGD*
Ga0075423_1104938613300009162Populus RhizosphereTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD*
Ga0075423_1277836123300009162Populus RhizosphereSGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIGTPA*
Ga0105248_1186752523300009177Switchgrass RhizosphereLFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG*
Ga0105249_1042429813300009553Switchgrass RhizosphereGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD*
Ga0126370_1220928613300010358Tropical Forest SoilQVIFTSGRDWPYGSALGFLLMVITLGGTLLALRSLRRETFAS*
Ga0105239_1028274113300010375Corn RhizosphereTTTIAKLVQTIFTAGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA*
Ga0134124_1158356723300010397Terrestrial SoilFTTGRDWPYGSALGFMLMVITIAGTLLAIRALRQETLG*
Ga0134121_1207406113300010401Terrestrial SoilKVVQVLFTSGRDWPYGSALGFMLIVITLAGTFLALRALRQETFG*
Ga0105246_1163819423300011119Miscanthus RhizosphereIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD*
Ga0105246_1175605223300011119Miscanthus RhizosphereSTTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE*
Ga0137325_101340213300011415SoilPQTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD*
Ga0150984_12079261513300012469Avena Fatua RhizosphereRDWPYGSALGFLLMVLTLGGTLLALRSLRREAFA*
Ga0157303_1019123313300012896SoilKVVQVLFTTGRDWPDGSALGFMLMVITLAGTLLAIRALRQETLG*
Ga0162650_10009513513300012939SoilELFLEGRDWPYGSALGFMLMLITLAGTFIALRTLRREVVGA*
Ga0164300_1014623913300012951SoilVQVLFTSGRDWPYGSALGFMLLVITLAGTLLAIRALRQETLG*
Ga0164300_1047653023300012951SoilAKIIQVLFTSGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG*
Ga0164303_1036553713300012957SoilGHDWPYGSALGFLLMAVTIAGTLLALRSLRREVIG*
Ga0164299_1038738313300012958SoilKVVQVLFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG*
Ga0164302_1039088223300012961SoilVQTLFLSGRDWPQGAALGFILMAVTIIGTFAAIRSLRTEVL*
Ga0164309_1106101623300012984SoilQVLFTSGRDWPYGSSLGFLLMVITLGGPLLALRSLRRETFS*
Ga0164306_1115625023300012988SoilGRDWPYGSSLGFLLMVITLGGTLLALRSLRRETFS*
Ga0164305_1046000423300012989SoilDWPTESALGFMLMVITLAGTLLALRWVRRETLAA*
Ga0157374_1232037523300013296Miscanthus RhizosphereGGPSTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD*
Ga0157378_1025599933300013297Miscanthus RhizosphereVQVLFTSGRDWPYGSALGFMLMVITLAGTLFAIRALRQETFG*
Ga0134079_1061866213300014166Grasslands SoilIAKVVQVLFTSGRDWPYGSALGFLLMVITLAGTLFAIRSLRQETFG*
Ga0163163_1047463913300014325Switchgrass RhizosphereKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE*
Ga0182008_1090800413300014497RhizosphereGRDWPYGSALAFILMVLTLAGTFLSIRSLRQETFG*
Ga0132257_10350405823300015373Arabidopsis RhizosphereTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD*
Ga0132255_10450402413300015374Arabidopsis RhizosphereANLIQVIFTTGRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA*
Ga0132255_10607220713300015374Arabidopsis RhizosphereTIAKVVQVVFQSGRDWPYGSALGFLLMVITLAGTFLALRTLRRETLGGG*
Ga0182033_1066113023300016319SoilTIAKVVQVIFTSGRDWPSGSALGFLLMIATLVGTLLALRWVRRETLGAA
Ga0184627_1045404413300018079Groundwater SedimentNIQELFLEGRDWPYGAALGFILMIVTLGGTLLALRTLRREVVGS
Ga0190275_1002198713300018432SoilAKIVQIIFTTGRDWPYGSALGFVLMAITIAGTLVALRSLRREVVGTAA
Ga0190270_1300372423300018469SoilTIAKVVQELFLEGRDWPYGAALGFLLMVVTLGGTLFALRPLRSEVVGT
Ga0190274_1145903823300018476SoilGGAQTTTAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA
Ga0190271_1034991413300018481SoilKVVQELFLEGRDWPYGSALGFFLMLITLVGTFIALRTLRREVVGA
Ga0173482_1073936513300019361SoilAKNIQELFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD
Ga0190267_1159559013300019767SoilLLGGAQTTTAAKLVQTLFTTGRDWPYGSALGFVLMVVTLGGTLLALRSLRRETFA
Ga0193697_110591613300020005SoilFAKVVQVLFTTGRDWPYGSALGFMLMVITLAGTLLAIRALRQETLG
Ga0194063_1034400113300021075Anoxic Zone FreshwaterQNLFLSSRDWPYGAALGFVLIALTIGGTVAALGPLRREVIG
Ga0247785_100703513300022889SoilTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD
Ga0207642_1030695613300025899Miscanthus RhizosphereTIAKNIQELFLAGRDWPYGAALGFVLMIVTLTGTLLALRTLRREVVGAD
Ga0207642_1109821013300025899Miscanthus RhizosphereKTTTAAKLVQVLFTSGRDWPYGSALGFLLMIVTMGGTLVALRSLRRETFG
Ga0207710_1020818713300025900Switchgrass RhizosphereGPATTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE
Ga0207680_1031796023300025903Switchgrass RhizosphereLGGPSTTTIAKNIQELFLAGRDWPYGAALGFILMAVTLIGTLVALRTLRREVVGAD
Ga0207687_1005518313300025927Miscanthus RhizosphereIFTTVRDWPYGSALGFLLMGVTIVGTLIALRSLRREVIGASA
Ga0207687_1151811313300025927Miscanthus RhizosphereIFTSGRDWPYGSALGFLLMVITLGGTLIALRTLRREVIG
Ga0207644_1155543023300025931Switchgrass RhizosphereTTTIAKNIQELFLAGRDWPYGASLGFILMAVTLIGTLVALRTLRREVVGGE
Ga0207686_1044945123300025934Miscanthus RhizosphereNIQELFLAGRDWPYGAALGFVLMIVTLTGTLVALRTLRREVAGGD
Ga0207661_1086196223300025944Corn RhizosphereDWPYGAALGFILMAVTLVGTLVALRTLRREVVGAD
Ga0207648_1199030913300026089Miscanthus RhizosphereKVVQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG
Ga0207674_1063190913300026116Corn RhizosphereFLAGRDWPYGAALGFILMAVTLVGTLVALRTLRREVVGGD
Ga0207698_1058696833300026142Corn RhizosphereGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVIG
Ga0247684_108444723300028138SoilQVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLA
Ga0307320_1022029213300028771SoilRDWPYGAALGFVLMIVTLGGTLIALRTLRREVIGSD
Ga0307305_1016562913300028807SoilQTTTIAKIVQVLFTSGRDWPYGSALGFLLMVVTLAGTLLALRTLRREVLG
Ga0307310_1022397523300028824SoilLFTAGRDWPYGSALGFLLMVVTLGGTLLALRTLRREVLA
Ga0307277_1011265713300028881SoilTIAKIVQVIFTSGRDWPYGSALGFLLMAVTLVGTLLALRSLRREVIG
Ga0318574_1069281513300031680SoilVVQILFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG
Ga0318554_1059553523300031765SoilGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG
Ga0310893_1027634113300031892SoilGNDWPYGSALAFILMVITLDGTLLALRSLRRETFA
Ga0302322_10294623613300031902FenQTLFTTGRNWPYGSALGFMLMLVTMVGTLAALRFVRRETLGG
Ga0310900_1138602613300031908SoilTIAKNIQELFLAGRDWPYGAALGFILMAVTLLGTLVALRTLRREVVGGD
Ga0318563_1062693813300032009SoilVQVLFTSGRDWPYGSALGFMLMVITLAGTFLALRALRQETFG
Ga0307471_10378859513300032180Hardwood Forest SoilTIAKIVQVLFTSGRDWPYGSALGFLLMVVTLGGTLVALRTLRRQVLA
Ga0247830_1058314113300033551SoilTAAKLVQVLFTTGNDWPYGSALAFILMVITLAGTLLALRSLRRETFA
Ga0364945_0085861_794_9103300034115SedimentLQGRDWPYGAALGFLVMIVTLGGTLLALGPLRREVAGS
Ga0370499_0102384_555_7163300034194Untreated Peat SoilGPQTTTIAKNIQELFLEGRDWPYGAALGFLLMIVTLSGTLIALRTLRREVIGS
Ga0370501_0372044_1_1113300034195Untreated Peat SoilGRNWPYGSALGFILMLVTMVGTLAALRFVRRETLGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.