| Basic Information | |
|---|---|
| Family ID | F068996 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.35 % |
| % of genes near scaffold ends (potentially truncated) | 49.19 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.516 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (30.645 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (37.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF01597 | GCV_H | 37.90 |
| PF02954 | HTH_8 | 22.58 |
| PF10518 | TAT_signal | 2.42 |
| PF08238 | Sel1 | 1.61 |
| PF13247 | Fer4_11 | 1.61 |
| PF00535 | Glycos_transf_2 | 0.81 |
| PF13657 | Couple_hipA | 0.81 |
| PF00501 | AMP-binding | 0.81 |
| PF04101 | Glyco_tran_28_C | 0.81 |
| PF13462 | Thioredoxin_4 | 0.81 |
| PF12797 | Fer4_2 | 0.81 |
| PF12698 | ABC2_membrane_3 | 0.81 |
| PF03480 | DctP | 0.81 |
| PF01613 | Flavin_Reduct | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 37.90 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.52 % |
| Unclassified | root | N/A | 10.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002121|C687J26615_10013884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1950 | Open in IMG/M |
| 3300002220|MLSBCLC_10629118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 685 | Open in IMG/M |
| 3300003861|Ga0031654_10060291 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300003987|Ga0055471_10234114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
| 3300003987|Ga0055471_10296164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 518 | Open in IMG/M |
| 3300004009|Ga0055437_10099831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 854 | Open in IMG/M |
| 3300004062|Ga0055500_10185674 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 506 | Open in IMG/M |
| 3300004779|Ga0062380_10535580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300005205|Ga0068999_10084591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 612 | Open in IMG/M |
| 3300005830|Ga0074473_11132829 | Not Available | 1725 | Open in IMG/M |
| 3300005833|Ga0074472_11361262 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300005880|Ga0075298_1039509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 502 | Open in IMG/M |
| 3300005897|Ga0075281_1033259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 764 | Open in IMG/M |
| 3300005947|Ga0066794_10171595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 652 | Open in IMG/M |
| 3300006055|Ga0097691_1018544 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
| 3300006224|Ga0079037_100496202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1171 | Open in IMG/M |
| 3300006224|Ga0079037_100696955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 991 | Open in IMG/M |
| 3300006224|Ga0079037_101991307 | Not Available | 580 | Open in IMG/M |
| 3300006864|Ga0066797_1275604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 587 | Open in IMG/M |
| 3300006930|Ga0079303_10003320 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Gottesmanbacteria → Candidatus Gottesmanbacteria bacterium GW2011_GWC2_39_8 | 4339 | Open in IMG/M |
| 3300006950|Ga0075524_10302242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 701 | Open in IMG/M |
| 3300006950|Ga0075524_10403386 | Not Available | 603 | Open in IMG/M |
| 3300009029|Ga0066793_10133998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1445 | Open in IMG/M |
| 3300009091|Ga0102851_10621594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1132 | Open in IMG/M |
| 3300009091|Ga0102851_10829488 | Not Available | 991 | Open in IMG/M |
| 3300009111|Ga0115026_10549107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 868 | Open in IMG/M |
| 3300009167|Ga0113563_11348890 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009167|Ga0113563_12721436 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009179|Ga0115028_11043887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
| 3300009582|Ga0115601_1068562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2227 | Open in IMG/M |
| 3300009583|Ga0115598_1037734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300009583|Ga0115598_1102049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2249 | Open in IMG/M |
| 3300009868|Ga0130016_10510004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300011397|Ga0137444_1044073 | Not Available | 680 | Open in IMG/M |
| 3300011407|Ga0137450_1055347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300011419|Ga0137446_1021074 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300011428|Ga0137456_1138618 | Not Available | 651 | Open in IMG/M |
| 3300011431|Ga0137438_1018608 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300011431|Ga0137438_1110906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300011433|Ga0137443_1036863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1303 | Open in IMG/M |
| 3300011435|Ga0137426_1153636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 677 | Open in IMG/M |
| 3300011436|Ga0137458_1014103 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300011437|Ga0137429_1214872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 599 | Open in IMG/M |
| 3300011442|Ga0137437_1038405 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300012143|Ga0137354_1027741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 871 | Open in IMG/M |
| 3300012146|Ga0137322_1044178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
| 3300012152|Ga0137347_1002086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1890 | Open in IMG/M |
| 3300012157|Ga0137353_1051125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 751 | Open in IMG/M |
| 3300012164|Ga0137352_1027325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1086 | Open in IMG/M |
| 3300012164|Ga0137352_1086792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 623 | Open in IMG/M |
| 3300012227|Ga0137449_1039431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 954 | Open in IMG/M |
| 3300012931|Ga0153915_11567164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 771 | Open in IMG/M |
| 3300012964|Ga0153916_10448315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1356 | Open in IMG/M |
| 3300013092|Ga0163199_1000296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 31606 | Open in IMG/M |
| 3300013092|Ga0163199_1167783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 875 | Open in IMG/M |
| 3300013232|Ga0170573_10371112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1071 | Open in IMG/M |
| 3300014259|Ga0075311_1137145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 551 | Open in IMG/M |
| 3300014271|Ga0075326_1182389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300014296|Ga0075344_1001540 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
| 3300014315|Ga0075350_1063768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 815 | Open in IMG/M |
| 3300014861|Ga0180061_1011417 | Not Available | 1230 | Open in IMG/M |
| 3300014863|Ga0180060_1013070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 928 | Open in IMG/M |
| 3300014868|Ga0180088_1048375 | Not Available | 730 | Open in IMG/M |
| 3300014870|Ga0180080_1006715 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300014871|Ga0180095_1064011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 668 | Open in IMG/M |
| 3300014872|Ga0180087_1015545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1333 | Open in IMG/M |
| 3300014875|Ga0180083_1038374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 960 | Open in IMG/M |
| 3300014878|Ga0180065_1047114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 921 | Open in IMG/M |
| 3300014880|Ga0180082_1122047 | Not Available | 597 | Open in IMG/M |
| 3300014881|Ga0180094_1061669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 816 | Open in IMG/M |
| 3300014881|Ga0180094_1074959 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300014883|Ga0180086_1079156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 819 | Open in IMG/M |
| 3300014883|Ga0180086_1132839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 647 | Open in IMG/M |
| 3300014885|Ga0180063_1054102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1161 | Open in IMG/M |
| 3300015255|Ga0180077_1031789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 996 | Open in IMG/M |
| 3300015255|Ga0180077_1067147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 731 | Open in IMG/M |
| 3300015257|Ga0180067_1112443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 618 | Open in IMG/M |
| 3300015259|Ga0180085_1005112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3672 | Open in IMG/M |
| 3300015259|Ga0180085_1043587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1277 | Open in IMG/M |
| 3300015259|Ga0180085_1171461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300018084|Ga0184629_10412356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 709 | Open in IMG/M |
| 3300019246|Ga0172287_1427616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
| 3300019257|Ga0180115_1172650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300020068|Ga0184649_1601095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 622 | Open in IMG/M |
| 3300021081|Ga0210379_10077825 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300021332|Ga0210339_1346523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 868 | Open in IMG/M |
| 3300021859|Ga0210334_10216471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1105 | Open in IMG/M |
| 3300022185|Ga0079039_1166265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 652 | Open in IMG/M |
| 3300022384|Ga0210321_1009590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1016 | Open in IMG/M |
| 3300022553|Ga0212124_10000190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 56983 | Open in IMG/M |
| 3300024056|Ga0124853_1476203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1695 | Open in IMG/M |
| 3300025308|Ga0209211_10085310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2543 | Open in IMG/M |
| 3300025319|Ga0209520_10216699 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300025322|Ga0209641_10218471 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300025484|Ga0208587_1047916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1048 | Open in IMG/M |
| 3300025956|Ga0210104_1000473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5901 | Open in IMG/M |
| 3300026059|Ga0208540_1024060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 684 | Open in IMG/M |
| 3300027843|Ga0209798_10097665 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300027843|Ga0209798_10398063 | Not Available | 644 | Open in IMG/M |
| 3300027900|Ga0209253_10029930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4566 | Open in IMG/M |
| 3300027900|Ga0209253_10193199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1629 | Open in IMG/M |
| 3300027900|Ga0209253_10849514 | Not Available | 644 | Open in IMG/M |
| 3300027979|Ga0209705_10220544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 989 | Open in IMG/M |
| 3300028803|Ga0307281_10113475 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300031965|Ga0326597_12030671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300031997|Ga0315278_10234336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1893 | Open in IMG/M |
| 3300032173|Ga0315268_10312232 | Not Available | 1524 | Open in IMG/M |
| 3300033233|Ga0334722_10382846 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300033406|Ga0316604_10290320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 890 | Open in IMG/M |
| 3300033408|Ga0316605_10488431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1131 | Open in IMG/M |
| 3300033408|Ga0316605_11315574 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300033408|Ga0316605_11968789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300033416|Ga0316622_101164150 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300033416|Ga0316622_103399950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 501 | Open in IMG/M |
| 3300033419|Ga0316601_100026195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3964 | Open in IMG/M |
| 3300033434|Ga0316613_10874794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300033434|Ga0316613_11163179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 531 | Open in IMG/M |
| 3300033481|Ga0316600_10072332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 2015 | Open in IMG/M |
| 3300033482|Ga0316627_101171138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300033482|Ga0316627_101700896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 645 | Open in IMG/M |
| 3300033487|Ga0316630_10973669 | Not Available | 740 | Open in IMG/M |
| 3300033488|Ga0316621_10044116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2183 | Open in IMG/M |
| 3300034113|Ga0364937_063794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 706 | Open in IMG/M |
| 3300034165|Ga0364942_0180674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 30.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 11.29% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.26% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.03% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.23% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.23% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.42% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.61% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.81% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.81% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.81% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011407 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022384 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025308 | Soil microbial communities from Rifle, Colorado, USA - Groundwater A2 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26615_100138844 | 3300002121 | Soil | ASPRREVGTMGYIIFGIAYVVLGVIAAVRPHAGPT* |
| MLSBCLC_106291182 | 3300002220 | Hydrocarbon Resource Environments | VRGQWFPRKEVGTMGYLIIGIAFIVLTVIAAVRTRPGHA* |
| Ga0031654_100602911 | 3300003861 | Freshwater Lake Sediment | VRGKLAPRREVGTMAYLVMGIAFIVLVVIAAVRGRTWHA* |
| Ga0055471_102341141 | 3300003987 | Natural And Restored Wetlands | VRGKWTPRKEVGKMGYLMVGIAFIVLAVIAAMRTRTGHA* |
| Ga0055471_102961641 | 3300003987 | Natural And Restored Wetlands | VRGKHAPRKEVGTMGYLVMGVAYIVLAVLAAVRPRARQA* |
| Ga0055437_100998311 | 3300004009 | Natural And Restored Wetlands | VRGNGSPRKEVGTMGYLVIGIAFIVLAIVAAVRTRAEHV* |
| Ga0055500_101856741 | 3300004062 | Natural And Restored Wetlands | VRGKWAPRREVGTMGYLVMGIALIVLVVIAAVRARTGHV* |
| Ga0062380_105355802 | 3300004779 | Wetland Sediment | VRGKWAPRREVGTMAYLVMGIAFIVLAVIAAVRGRTWHA* |
| Ga0068999_100845911 | 3300005205 | Natural And Restored Wetlands | VVRGQKFPREEVGTMGYLVIGIAYIVLAVAAVVKPHAGHA* |
| Ga0074473_111328292 | 3300005830 | Sediment (Intertidal) | MQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA* |
| Ga0074472_113612623 | 3300005833 | Sediment (Intertidal) | KPVRGTTSPRKEVGTMGYILFGIAYLVLGVIAAVRPHAGTM* |
| Ga0075298_10395091 | 3300005880 | Rice Paddy Soil | SPRKEVGTMGYLVFGIAYIVLAVIAAVKPRAGDA* |
| Ga0075281_10332592 | 3300005897 | Rice Paddy Soil | VRGRRSPRREVGTMGYMMIGIGFIVLAVIAAFRARTGHV* |
| Ga0066794_101715952 | 3300005947 | Soil | GAGRAPQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA* |
| Ga0097691_10185441 | 3300006055 | Arctic Peat Soil | MADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLAVAAAVKPRAGHA* |
| Ga0079037_1004962021 | 3300006224 | Freshwater Wetlands | AGRTLRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0079037_1006969551 | 3300006224 | Freshwater Wetlands | MSDALDIVAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0079037_1019913072 | 3300006224 | Freshwater Wetlands | MADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPR |
| Ga0066797_12756042 | 3300006864 | Soil | APQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA* |
| Ga0079303_100033201 | 3300006930 | Deep Subsurface | RGQQYPREEVGTMGYLVIGIAFIVLAIVAAVRPRTGHA* |
| Ga0075524_103022422 | 3300006950 | Arctic Peat Soil | DIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAVVKPRTGHA* |
| Ga0075524_104033861 | 3300006950 | Arctic Peat Soil | MADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAVVKP |
| Ga0066793_101339983 | 3300009029 | Prmafrost Soil | MVDAVDIGAGRAPQKEVGTMGYMVIGIAYIVLAVMAVVKPRAGHA* |
| Ga0102851_106215941 | 3300009091 | Freshwater Wetlands | GAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0102851_108294882 | 3300009091 | Freshwater Wetlands | MADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0115026_105491072 | 3300009111 | Wetland | MADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0113563_113488902 | 3300009167 | Freshwater Wetlands | MADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0113563_127214361 | 3300009167 | Freshwater Wetlands | MADALYIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKP |
| Ga0115028_110438872 | 3300009179 | Wetland | MADAVDIVAGSDSRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0115601_10685624 | 3300009582 | Wetland | RHPRKEVGTMAYLVIGIGFIVLEVVAAVRMRAGHA* |
| Ga0115598_10377342 | 3300009583 | Wetland | GPPRKEVGTMGYLVIGIAYIVLAVVTAVKPRAGHA* |
| Ga0115598_11020491 | 3300009583 | Wetland | HPRKEVGTMAYLVIGLGFTVLEVVAATRMRTGHA* |
| Ga0130016_105100042 | 3300009868 | Wastewater | VRGKWSPREEVGTMAYLAMGIAFVVLEIIAAVKTRTGHA* |
| Ga0137444_10440731 | 3300011397 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAPMKPRARHA* |
| Ga0137450_10553471 | 3300011407 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0137446_10210741 | 3300011419 | Soil | MADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA* |
| Ga0137456_11386182 | 3300011428 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKP |
| Ga0137438_10186083 | 3300011431 | Soil | MADAVYISAGRAPRKEVGTMGYLVIVIAYIVLAVVAVVKPRAGHA* |
| Ga0137438_11109061 | 3300011431 | Soil | VRGKWAPREEVGKMGYLMVGIAFIVLEVIAAVRTRTGHA* |
| Ga0137443_10368632 | 3300011433 | Soil | MADAVYIGAGSAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA* |
| Ga0137426_11536362 | 3300011435 | Soil | MADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA* |
| Ga0137458_10141032 | 3300011436 | Soil | MADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA* |
| Ga0137429_12148722 | 3300011437 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAAMKPREGHA* |
| Ga0137437_10384053 | 3300011442 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAGHA* |
| Ga0137354_10277412 | 3300012143 | Soil | MADAVDIGAGSDPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0137322_10441782 | 3300012146 | Soil | MADAVNIGAGRAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAEHA* |
| Ga0137347_10020862 | 3300012152 | Soil | MPDAIYIGAGRDPRKEVGTMGYLVIGIAFIVLEVVAAVKMRTGHA* |
| Ga0137353_10511252 | 3300012157 | Soil | MADALDIGAGMDPRKGVGTMGYLVLGLAYIVLTVVAAVKPRAGHA* |
| Ga0137352_10273251 | 3300012164 | Soil | MADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVVAAVKPRAGHA* |
| Ga0137352_10867922 | 3300012164 | Soil | MADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPHAGHA* |
| Ga0137449_10394312 | 3300012227 | Soil | MADAVYISAGRVPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAVHA* |
| Ga0153915_115671641 | 3300012931 | Freshwater Wetlands | HCGRKVRGKWTPRREVGKMGYLIIGIAFLVLAVIAAVRTRAGHA* |
| Ga0153916_104483152 | 3300012964 | Freshwater Wetlands | MRGKWFPRREVGKMGYLIIGIAFIVLAVIAAVRTRPGHA* |
| Ga0163199_100029612 | 3300013092 | Freshwater | MWYPRKEVGTMGYMVIGIAYIVLAVVAAMKPRAGNA* |
| Ga0163199_11677831 | 3300013092 | Freshwater | APHDRDGWEVRGKWARREEVGTMGYLVMGIALLVLAVIAAMRARARHA* |
| Ga0170573_103711122 | 3300013232 | Sediment | MAPRKEVGTMGYLVIGIAYIVLAVVAVAKPRAEHA* |
| Ga0075311_11371452 | 3300014259 | Natural And Restored Wetlands | MPAWIAIGMADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRTGHA* |
| Ga0075326_11823892 | 3300014271 | Natural And Restored Wetlands | MADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0075344_10015404 | 3300014296 | Natural And Restored Wetlands | MQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPREGHA* |
| Ga0075350_10637681 | 3300014315 | Natural And Restored Wetlands | SPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA* |
| Ga0180061_10114171 | 3300014861 | Soil | MADALDIGAGKDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA* |
| Ga0180060_10130701 | 3300014863 | Soil | MADAVYIGAGSAPRKEVGTMGYLVIGIAYIVLAVVAVVKPRAVHA* |
| Ga0180088_10483751 | 3300014868 | Soil | MADAVDIGAGSDPRKEVGKMGFLIFAATYIVLGIIAVTKPRTDHA* |
| Ga0180080_10067153 | 3300014870 | Soil | CGSEVRGEWAPRREVGKMVYLAMGIAFIVLEVITAVKARTGHA* |
| Ga0180095_10640112 | 3300014871 | Soil | MADAVDIGAGSAPRKEVGTMGYLVIGIAFIVLAILAAARTRAGHA* |
| Ga0180087_10155451 | 3300014872 | Soil | RVWNAAGMADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA* |
| Ga0180083_10383742 | 3300014875 | Soil | AWNAAGMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLAVVAAVKPRAGHA* |
| Ga0180065_10471142 | 3300014878 | Soil | VAGLADAVDIGAGSDPRKEVGTMGYLMIGIAYIVLTVVAVVKPRAGHA* |
| Ga0180082_11220472 | 3300014880 | Soil | MADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPSTG |
| Ga0180094_10616692 | 3300014881 | Soil | MADALDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA* |
| Ga0180094_10749592 | 3300014881 | Soil | MADALDIGAGRAPRKEVGTMGYLVIGIAYIVLTVAAVVKPRAGHA* |
| Ga0180086_10791562 | 3300014883 | Soil | APRKEVGTMGYLVIGIAYIVLTVAAVVKPRAGHA* |
| Ga0180086_11328391 | 3300014883 | Soil | GTPRKEVGTMGYLVIGIAYIVLTVVAAVKPREGHA* |
| Ga0180063_10541022 | 3300014885 | Soil | VRGEWAPRREVGKMVYLAMGIAFIVLEVITAVKARTGHA* |
| Ga0180077_10317892 | 3300015255 | Soil | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPSTGHA* |
| Ga0180077_10671472 | 3300015255 | Soil | MAPRREVGKMGYLAIGIAFIVLAVIAAVRTRTGHA* |
| Ga0180067_11124432 | 3300015257 | Soil | MADAVDIGAGSAPRKEVGTMGYLVIGIAYIVLTVVAAMKPREGHA* |
| Ga0180085_10051125 | 3300015259 | Soil | MADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVV |
| Ga0180085_10435873 | 3300015259 | Soil | AWNAVGMADALDIGAGMDPRKGVGTMGYLVIGLAYIVLTVVAAVKPRAGHA* |
| Ga0180085_11714612 | 3300015259 | Soil | VRGKWAPRREVGKMGYLMMGIALVVLAVIAAVRTRTGQA* |
| Ga0184629_104123562 | 3300018084 | Groundwater Sediment | MADAVDIGAGRAPRKEVGTMGYLVIGIAYIVLTVVAVVKPRAGHA |
| Ga0172287_14276162 | 3300019246 | Wetland | GPPRKEVGTMGYLVIGIAYIVLAVVTAVKPRAGHA |
| Ga0180115_11726501 | 3300019257 | Groundwater Sediment | GPPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA |
| Ga0184649_16010951 | 3300020068 | Groundwater Sediment | WTPRKEVGKMGYLMMGIAYIALAVIAAVRPRTGHT |
| Ga0210379_100778251 | 3300021081 | Groundwater Sediment | RGAGRVATRREVGKMGYLVMGIAFIVLAVIAAVRTRTGHA |
| Ga0210339_13465231 | 3300021332 | Estuarine | EVRGMQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA |
| Ga0210334_102164712 | 3300021859 | Estuarine | MQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPREGHA |
| Ga0079039_11662651 | 3300022185 | Freshwater Wetlands | RDPRKEVGTMGYLVFGIAYIVLAVVAVVKPRAGHA |
| Ga0210321_10095901 | 3300022384 | Estuarine | MQSPRKEVGTMGYLVIGIAYIVLAVVAVVKPRADHA |
| Ga0212124_1000019023 | 3300022553 | Freshwater | MWYPRKEVGTMGYMVIGIAYIVLAVVAAMKPRAGNA |
| Ga0124853_14762033 | 3300024056 | Freshwater Wetlands | MADAVDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0209211_100853102 | 3300025308 | Soil | VRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRAGHA |
| Ga0209520_102166993 | 3300025319 | Soil | RCGSEVRGKGSPRGEVGTMGYLVIGIAFIVLAVIAAVRTRAGHA |
| Ga0209641_102184713 | 3300025322 | Soil | SEVRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRTGHA |
| Ga0208587_10479163 | 3300025484 | Arctic Peat Soil | KKPPQKEVGTMGYLVIGIAYIVLAVAAAVKPRAGHA |
| Ga0210104_10004731 | 3300025956 | Natural And Restored Wetlands | MQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA |
| Ga0208540_10240602 | 3300026059 | Natural And Restored Wetlands | GMQSPRKEVGTMGYLVIGISYIVLAVIAVVKPREGHA |
| Ga0209798_100976651 | 3300027843 | Wetland Sediment | AGSSPLRKEVGTMGYLVIGIAFIVLAIVAAVRTRAGHA |
| Ga0209798_103980632 | 3300027843 | Wetland Sediment | MADAVDIGAGSSPLRKEVGTMGYLVIGIAFIVLAIVAAVR |
| Ga0209253_100299301 | 3300027900 | Freshwater Lake Sediment | QTPRREVGTMAYLVIGIAFIVLEIIAAVRMRTGHA |
| Ga0209253_101931991 | 3300027900 | Freshwater Lake Sediment | HNRGCCSPREEVGKMGYLVIGMAYIVLVLSAVMKPHTGHA |
| Ga0209253_108495141 | 3300027900 | Freshwater Lake Sediment | MDIGAGSSPPRKEVGTMGYLVIGIAFIVLAVVAAVR |
| Ga0209705_102205442 | 3300027979 | Freshwater Sediment | IAVIEVRGKWTPRREVGTMGYLVMGIALIVLVVIAAVKARTGHA |
| Ga0307281_101134752 | 3300028803 | Soil | MADAVDIVAGSDPRKEVGTMGYLVIGIAYIVLAVVAAVNPRAGHA |
| Ga0326597_120306711 | 3300031965 | Soil | VRGKWAPRKEVREMGYLMIGIAFIVLAVIAAVRVRT |
| Ga0315278_102343361 | 3300031997 | Sediment | AAGTADAVDIGAGSSPPRKEVGTMGYLVIGIAFIVLAIIAAMRTRAGHA |
| Ga0315268_103122322 | 3300032173 | Sediment | VVCGKRAPRREVGTMGYLVMGIVLIVLVVIAAVRARTEHA |
| Ga0334722_103828461 | 3300033233 | Sediment | VRGKWAPRREVGTMGYLVMGVAYVVLAVLSAVRPRARHA |
| Ga0316604_102903202 | 3300033406 | Soil | MADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316605_104884311 | 3300033408 | Soil | RGRHPRKEVGTMAYLVIGIGFIVLEVVAAVRMRAGHA |
| Ga0316605_113155742 | 3300033408 | Soil | MADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316605_119687892 | 3300033408 | Soil | MADAVDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKP |
| Ga0316622_1011641502 | 3300033416 | Soil | MADALDIGAGRTLRKEVGTMGYLVIGIAYIVLTVVAVVKPRA |
| Ga0316622_1033999502 | 3300033416 | Soil | AVGMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316601_1000261957 | 3300033419 | Soil | SRGGLPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316613_108747941 | 3300033434 | Soil | NAVGMADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316613_111631792 | 3300033434 | Soil | WSPRKEVGTMAYLVMGIAFLVLMVVSAVRTRTGHA |
| Ga0316600_100723321 | 3300033481 | Soil | GMADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0316627_1011711381 | 3300033482 | Soil | MADALDIGAGRDPRKEVGTMGYLVIGIAYIVLTVVAAVK |
| Ga0316627_1017008961 | 3300033482 | Soil | SRGRHPRKEVGTMAYLVIGIGFIVLEVVAAMRLRAGHA |
| Ga0316630_109736691 | 3300033487 | Soil | MADAVDIGAGRTPRKEVGTMGYLVIGIAYIVLTVVAAVKPRTGHA |
| Ga0316621_100441161 | 3300033488 | Soil | KESRGGLPRKEVGTMGYLVIGIAYIVLTVVAAVKPRAGHA |
| Ga0364937_063794_2_130 | 3300034113 | Sediment | GSEVRGKWAPRREVGKMGYLMMGIALVVLAVIAAVRTRTGHA |
| Ga0364942_0180674_276_386 | 3300034165 | Sediment | MWTPRREVGTMGYLVMGIAFIVLEVIAAVKTRTGHA |
| ⦗Top⦘ |