NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068992

Metagenome / Metatranscriptome Family F068992

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068992
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence FGNDLPFVRWPRGLALTLLDALPPFKRAFTRAMLFGLR
Number of Associated Samples 109
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.58 %
% of genes from short scaffolds (< 2000 bps) 90.32 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(7.258 % of family members)
Environment Ontology (ENVO) Unclassified
(37.097 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(30.645 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.36%    β-sheet: 0.00%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF01207Dus 83.06
PF02954HTH_8 1.61
PF02142MGS 1.61
PF02844GARS_N 0.81
PF07017PagP 0.81
PF04392ABC_sub_bind 0.81
PF00005ABC_tran 0.81
PF04552Sigma54_DBD 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 83.06
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.81
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 0.81
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.68 %
UnclassifiedrootN/A40.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090006|LWSO2_GGWJX9X02G9A7UNot Available513Open in IMG/M
2088090009|LWAnN_GIDYKCY01D85KKAll Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
2170459005|F1BAP7Q01A56JMAll Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300004074|Ga0055518_10126252All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300004156|Ga0062589_102641261All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300005187|Ga0066675_10147670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1610Open in IMG/M
3300005328|Ga0070676_10504807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae859Open in IMG/M
3300005334|Ga0068869_101405364All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria618Open in IMG/M
3300005347|Ga0070668_100068826All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2752Open in IMG/M
3300005355|Ga0070671_101299803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium641Open in IMG/M
3300005451|Ga0066681_10406118All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria837Open in IMG/M
3300005458|Ga0070681_10428489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1235Open in IMG/M
3300005539|Ga0068853_100530253All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1114Open in IMG/M
3300005564|Ga0070664_101735962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria592Open in IMG/M
3300005598|Ga0066706_10756794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae769Open in IMG/M
3300005598|Ga0066706_11252941All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium562Open in IMG/M
3300005614|Ga0068856_100672779All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1056Open in IMG/M
3300005616|Ga0068852_100734688All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Opalozoa → Bicosoecida → Cafeteriaceae → Cafeteria → Cafeteria roenbergensis999Open in IMG/M
3300005616|Ga0068852_102253221All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea566Open in IMG/M
3300005718|Ga0068866_11155171All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300005834|Ga0068851_10044044All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2251Open in IMG/M
3300005842|Ga0068858_102504333All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria510Open in IMG/M
3300006092|Ga0082021_1179826All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4376Open in IMG/M
3300006224|Ga0079037_101363384All Organisms → cellular organisms → Bacteria → Proteobacteria707Open in IMG/M
3300006796|Ga0066665_10253974All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1393Open in IMG/M
3300006953|Ga0074063_14099976All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea681Open in IMG/M
3300009012|Ga0066710_101327243All Organisms → cellular organisms → Bacteria → Proteobacteria1116Open in IMG/M
3300009111|Ga0115026_11181610Not Available622Open in IMG/M
3300009137|Ga0066709_100074332All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4013Open in IMG/M
3300009137|Ga0066709_104649997Not Available502Open in IMG/M
3300009654|Ga0116167_1276551All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila538Open in IMG/M
3300009664|Ga0116146_1362196Not Available539Open in IMG/M
3300009873|Ga0131077_10079067All Organisms → cellular organisms → Bacteria → Proteobacteria4176Open in IMG/M
3300010376|Ga0126381_100411930All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1886Open in IMG/M
3300010401|Ga0134121_11073645All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria796Open in IMG/M
3300010403|Ga0134123_12612900Not Available572Open in IMG/M
3300012208|Ga0137376_10075488All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2815Open in IMG/M
3300012211|Ga0137377_10354794Not Available1403Open in IMG/M
3300012353|Ga0137367_10627247All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300012922|Ga0137394_10994175Not Available697Open in IMG/M
3300012924|Ga0137413_11720211Not Available516Open in IMG/M
3300012971|Ga0126369_13220396Not Available535Open in IMG/M
3300012986|Ga0164304_10160003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1429Open in IMG/M
3300013100|Ga0157373_10569065Not Available823Open in IMG/M
3300013306|Ga0163162_13483034Not Available501Open in IMG/M
3300014968|Ga0157379_10002957All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria14333Open in IMG/M
3300015075|Ga0167636_1015008Not Available1109Open in IMG/M
3300015160|Ga0167642_1024243All Organisms → cellular organisms → Bacteria → Proteobacteria1009Open in IMG/M
3300015168|Ga0167631_1012594All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1281Open in IMG/M
3300015254|Ga0180089_1055112All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria789Open in IMG/M
3300015374|Ga0132255_101644031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium974Open in IMG/M
3300015374|Ga0132255_101686042All Organisms → cellular organisms → Bacteria → Proteobacteria961Open in IMG/M
3300015374|Ga0132255_104691397All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium579Open in IMG/M
3300017944|Ga0187786_10615125Not Available512Open in IMG/M
3300017959|Ga0187779_10701014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria685Open in IMG/M
3300018089|Ga0187774_10399294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria836Open in IMG/M
3300023062|Ga0247791_1069793All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila572Open in IMG/M
3300025903|Ga0207680_11096455Not Available569Open in IMG/M
3300025906|Ga0207699_10492259All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria884Open in IMG/M
3300025907|Ga0207645_10428816Not Available891Open in IMG/M
3300025938|Ga0207704_10366008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1127Open in IMG/M
3300025944|Ga0207661_11494683Not Available619Open in IMG/M
3300025949|Ga0207667_10576439All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1136Open in IMG/M
3300025979|Ga0210078_1025253Not Available781Open in IMG/M
3300025986|Ga0207658_12176789Not Available503Open in IMG/M
3300026078|Ga0207702_11899414Not Available587Open in IMG/M
3300026088|Ga0207641_10276018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1579Open in IMG/M
3300026088|Ga0207641_10739394Not Available970Open in IMG/M
3300026089|Ga0207648_10936902Not Available810Open in IMG/M
3300026118|Ga0207675_102610538Not Available515Open in IMG/M
3300026326|Ga0209801_1230262All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300027775|Ga0209177_10248323Not Available656Open in IMG/M
3300027805|Ga0209229_10485155Not Available529Open in IMG/M
3300027831|Ga0209797_10136378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1059Open in IMG/M
3300027871|Ga0209397_10138288All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila1070Open in IMG/M
3300027902|Ga0209048_10898432Not Available572Open in IMG/M
3300027915|Ga0209069_10427263Not Available731Open in IMG/M
3300027915|Ga0209069_10471140Not Available702Open in IMG/M
3300028587|Ga0247828_10275989Not Available916Open in IMG/M
3300028589|Ga0247818_10378533All Organisms → cellular organisms → Bacteria → Proteobacteria951Open in IMG/M
3300028608|Ga0247819_10870453All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila562Open in IMG/M
3300028856|Ga0302295_1136144Not Available560Open in IMG/M
3300028856|Ga0302295_1141840All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria550Open in IMG/M
3300028861|Ga0302259_1109894All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria674Open in IMG/M
3300028869|Ga0302263_10329292Not Available605Open in IMG/M
3300029989|Ga0311365_11000666Not Available722Open in IMG/M
3300030000|Ga0311337_10918672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila761Open in IMG/M
3300030002|Ga0311350_10907658All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria788Open in IMG/M
3300030047|Ga0302286_10422180Not Available673Open in IMG/M
3300030838|Ga0311335_11421797All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300031199|Ga0307495_10089554All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria710Open in IMG/M
3300031740|Ga0307468_101392543Not Available644Open in IMG/M
3300031746|Ga0315293_10959405All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300031768|Ga0318509_10385074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria784Open in IMG/M
3300031859|Ga0318527_10462584Not Available541Open in IMG/M
3300031908|Ga0310900_10224101All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1337Open in IMG/M
3300031908|Ga0310900_10908641Not Available719Open in IMG/M
3300031911|Ga0307412_10307102Not Available1256Open in IMG/M
3300031942|Ga0310916_11573997Not Available534Open in IMG/M
3300031995|Ga0307409_102902652Not Available506Open in IMG/M
3300032002|Ga0307416_101757851All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Opalozoa → Bicosoecida → Cafeteriaceae → Cafeteria → Cafeteria roenbergensis724Open in IMG/M
3300032064|Ga0318510_10133443All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria970Open in IMG/M
3300032064|Ga0318510_10428783Not Available566Open in IMG/M
3300032091|Ga0318577_10573366Not Available537Open in IMG/M
3300032092|Ga0315905_11613753Not Available503Open in IMG/M
3300032164|Ga0315283_10847170All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria977Open in IMG/M
3300032164|Ga0315283_12299141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila527Open in IMG/M
3300032177|Ga0315276_12196696Not Available559Open in IMG/M
3300032256|Ga0315271_10851089All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria786Open in IMG/M
3300032275|Ga0315270_10063794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2092Open in IMG/M
3300032275|Ga0315270_10835663Not Available607Open in IMG/M
3300032397|Ga0315287_10459079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1512Open in IMG/M
3300033004|Ga0335084_10461717All Organisms → cellular organisms → Bacteria → Proteobacteria1306Open in IMG/M
3300033413|Ga0316603_10452765Not Available1170Open in IMG/M
3300033419|Ga0316601_101857511All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300033419|Ga0316601_102341687All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300033433|Ga0326726_11624841Not Available629Open in IMG/M
3300033482|Ga0316627_101683472All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila648Open in IMG/M
3300033551|Ga0247830_10047753All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2789Open in IMG/M
3300033551|Ga0247830_10540859Not Available919Open in IMG/M
3300033803|Ga0314862_0043185Not Available957Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.26%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.23%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.42%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.61%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.61%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.61%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge1.61%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.81%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.81%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Glacier Forefield SoilsEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.81%
Wastewater Treatment PlantEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090006Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2EnvironmentalOpen in IMG/M
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300004074Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006092Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, SingaporeEngineeredOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009654Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaGEngineeredOpen in IMG/M
3300009664Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaGEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015075Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015160Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028856Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWSO2_074098502088090006Freshwater SedimentLVNVFGNDLPFLRWPRGLALTLLDTVLPAKRAFTRAMLFGLR
LWAnN_068292002088090009Freshwater SedimentAFTHGLVNVFGNDLPFFRWPRGLALTMLDAIPVAKRVFTAAMLFGLR
E41_021839902170459005Grass SoilGLFGTDVSLLRWPRGLALTLLDALPPVKRMFTRAMLYGLH
Ga0055518_1012625213300004074Natural And Restored WetlandsVGVFGSDLALLRWPRGLALTLLDTLPVAKRAFTRAMLFGLG*
Ga0062589_10264126113300004156SoilLGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLR*
Ga0066675_1014767033300005187SoilVFGTDAPLLSWPRGLALTLLDSLPAVKHAFTRAMLFGIHQGTL*
Ga0070676_1050480713300005328Miscanthus RhizosphereIFALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGVS*
Ga0068869_10140536423300005334Miscanthus RhizosphereAAFGNDVPLLRWPRGLALTLLDAFPPAKRAFTRAMLFGLR*
Ga0070668_10006882613300005347Switchgrass RhizosphereGLTHIFALDGAIFAWPRGIALAALDALPFAKRAFTRAMLFGLS*
Ga0070671_10129980323300005355Switchgrass RhizosphereHGLVQVFGNDLPFVRWSRGVALTALDAMPPAKRAFARAMLFGIH*
Ga0066681_1040611823300005451SoilVKLFGNDAAFVRWPRGLALALLDALPPAKRAFTRTMLFGMR*
Ga0070681_1042848913300005458Corn RhizosphereRMFGSGLPLFAWPRGIGLAALDALPIGKRAFTRAMLYGF*
Ga0068853_10053025313300005539Corn RhizosphereFTHGLTRIFATDSMFLRWPRGLALALLDAIPPAKKAFTRAMLFGMS*
Ga0070664_10173596223300005564Corn RhizosphereGLTHIFALDGAIFAWPRGLALAALDALPFAKRAFTRAMMFGMS*
Ga0066706_1075679423300005598SoilFTHGLLGIFGSDAPLLRWPRGLALTMLDALPAAKRAFTRAMTFGMH*
Ga0066706_1125294123300005598SoilLVHLFGSDLPFIRWPRGFALTALDAMPAAKRVFARAMLFGIH*
Ga0068856_10067277923300005614Corn RhizosphereLLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH*
Ga0068852_10073468823300005616Corn RhizosphereFALDGAIFAWPRGLALAALDALPFVKRAFTRAMLFGLS*
Ga0068852_10225322113300005616Corn RhizosphereDSMFLRWPRGLALALLDAIPPAKKAFTRAMLFGMS*
Ga0068866_1115517113300005718Miscanthus RhizosphereGLTQLFASQSPLLRWPRGLALTLLDALPPSKKAFTRAMLYGLS*
Ga0068851_1004404443300005834Corn RhizosphereFALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGVS*
Ga0068858_10142043923300005842Switchgrass RhizosphereFTHGLARIFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS*
Ga0068858_10250433313300005842Switchgrass RhizosphereLFGSELPFVAWPRGIALAMLDALPAAKRAFTRAMIFGMR*
Ga0082021_117982653300006092Wastewater Treatment PlantHLFGTDLPFVRWPRGLGLALLDAAPPLKRSFTRAMLFGA*
Ga0079037_10136338413300006224Freshwater WetlandsAFTHGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH*
Ga0066665_1025397413300006796SoilLGVFGTDAPLLSWPRGLALTLLDSLPAMKHAFTRAMLFGIHQATL*
Ga0074063_1409997613300006953SoilLTRIFATDSMFLRWPRGLALALLDAIPPAKRAFTRAMLFGMS*
Ga0066710_10132724313300009012Grasslands SoilNDSPLLRWPRGLALTLLDARPPLKRAFANAMLYGVH
Ga0115026_1118161023300009111WetlandFGNAAALLRWPRGLALTLLDALPPAKRAFTRAMLFGLH*
Ga0066709_10007433213300009137Grasslands SoilSDAPLLRWPRGLALTMLDALPAAKRAFTHAMSYGIH*
Ga0066709_10464999713300009137Grasslands SoilGADASLLRWPRGLALTLLDALPPVKRAFTRAMLYGLH*
Ga0116167_127655123300009654Anaerobic Digestor SludgeVHLFGTDLPFVRWPRGLGLALLDAAPPLKRSFTRAMLFGA*
Ga0116146_136219613300009664Anaerobic Digestor SludgeDLPFVRWPRGVGLAMLDAVPPLKRSFTRAMLFGA*
Ga0131077_1007906713300009873WastewaterLVGVFGADLPLLRLSRGVGLALLDVFPPAKRAFAQAMMFGLR*
Ga0105239_1072463323300010375Corn RhizosphereTHGLTQLFALDFPLARWPRGLAFTLLDALPPAKKAFTRAMLFGLS*
Ga0126381_10041193043300010376Tropical Forest SoilFASAVPLVSWPRGLALTLLDCIPPIKRAFTRAMLFGL*
Ga0134121_1107364523300010401Terrestrial SoilGNDLPLVRWPRGLALTLLDSVPAAKRAFTHAMLFGIR*
Ga0134123_1261290023300010403Terrestrial SoilHGLVGIFGNDLALVSWPRGLALTLLGAVPAAKRAFARAMLFGLR*
Ga0137376_1007548813300012208Vadose Zone SoilGIAFTHGLVQLFGTDLPFVRWPRGLALTMLDALPSAKRVFARAMLFGIH*
Ga0137377_1035479413300012211Vadose Zone SoilHGLLGIFGSDAPLLRWPRGLALTMLDALPAVKRAFARAMTFGLH*
Ga0137367_1062724713300012353Vadose Zone SoilPLLSWPRGLALTLLDSLPAAKHAFTRAMLFGVHQGIL*
Ga0137394_1099417533300012922Vadose Zone SoilGTDAPFVRWPRGLALTLLDAMPAAKRAFTRAMLFGVR*
Ga0137413_1172021123300012924Vadose Zone SoilFGTDLPFVRWPRGVALTLMDALPPVKRAFTRAMLFGLK*
Ga0126369_1322039623300012971Tropical Forest SoilAFTHGLLRIFGNDHALLRWPRGLALTLLDALPPFKRVFTQAMLFGVH*
Ga0164304_1016000323300012986SoilRWSGIALTHGLLGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTHAMLYGLH*
Ga0157373_1056906523300013100Corn RhizosphereVHAFGSNRPLLRIPRGAGLALLDSVPVAKHAFTRAMLFGVR*
Ga0163162_1348303423300013306Switchgrass RhizosphereVHLFGTDLPLVRWPRGVGLALLGAIPPLKRSFTRAMLFGA*
Ga0157379_10002957153300014968Switchgrass RhizosphereTHGLLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH*
Ga0167636_101500813300015075Glacier Forefield SoilsFGADVSMLRWPRGLALTLLDALPPVKRLFTRAMLYGLH*
Ga0167642_102424323300015160Glacier Forefield SoilLFGADVSLLRWPRGLALTLLDALPPVKRLFTRAMLYGLH*
Ga0167631_101259423300015168Glacier Forefield SoilLTHGLLGVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH*
Ga0180089_105511213300015254SoilAPLLRWPRGLALTMLDALPAVKRAFTRAMSYGMH*
Ga0132255_10164403113300015374Arabidopsis RhizosphereTEQALLRVPRGLGMTLLDTFPLAKRAFTRAMLFGVR*
Ga0132255_10168604213300015374Arabidopsis RhizosphereHGLVRVFGNDVPFVRWPRGIALTLLDALPPAKRAFTRAMLFGLR*
Ga0132255_10469139713300015374Arabidopsis RhizosphereDLRFVRWPRGLALTLLDAVPPAKRAFTRAMLFGIR*
Ga0187786_1061512513300017944Tropical PeatlandGLVGIFGNDMPLVGWPRGLALTLLGAVPAAKRAFARAVLFGLH
Ga0187779_1070101413300017959Tropical PeatlandIFGVDAPWLSWPRGLALTLLDALPTAKRMFARTMLFGVR
Ga0187774_1039929423300018089Tropical PeatlandPLVSWPRGLALTMLDCLPALKRTFTRAMLFGVQAVIG
Ga0247791_106979313300023062SoilTDLALVRWPRGVGLALLGAIPPLRRSFTRAMLYGA
Ga0207680_1109645523300025903Switchgrass RhizosphereLLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH
Ga0207699_1049225933300025906Corn, Switchgrass And Miscanthus RhizosphereHGLLGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLH
Ga0207645_1042881613300025907Miscanthus RhizosphereRLAGIALTHGLVGIFGNDHALLSWPRGLALTLLGAVPVAKRAFTRAMLFGMR
Ga0207704_1036600823300025938Miscanthus RhizosphereFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH
Ga0207661_1149468313300025944Corn RhizosphereGSDSALVAWPRGLGLALLDVLPPARRAFTRAMLFGVH
Ga0207667_1057643923300025949Corn RhizosphereSDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLR
Ga0210078_102525313300025979Natural And Restored WetlandsNVFGTHRPFVRWPRGLALTMLDAVPAAKRAFTHAMLFGLR
Ga0207658_1217678913300025986Switchgrass RhizosphereIFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS
Ga0207702_1189941423300026078Corn RhizosphereLEVCGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH
Ga0207641_1027601813300026088Switchgrass RhizosphereFALDAAIFRWPRGIGLAMLDAFPPAKRAFTRAMLFGLS
Ga0207641_1073939423300026088Switchgrass RhizosphereHGLVKIFGNDVGFVRWPRGLALTLLDAIPPAKRAFTRAMLFGMR
Ga0207648_1093690223300026089Miscanthus RhizosphereGIALTHGLVGIFGNDHALLSWPRGLALTLLGAVPVAKRAFTRAMLFGMR
Ga0207675_10261053823300026118Switchgrass RhizosphereRIFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS
Ga0209801_123026213300026326SoilGIFGSDAPLLRWPRGLALTMLDALPAVKRAFAHAMTFGLH
Ga0209177_1024832313300027775Agricultural SoilGLLGIFGTDAALLRWPRGLALTLLDALPPLKRIFTHSMLYGIH
Ga0209229_1048515513300027805Freshwater And SedimentTHGLVRIFGNDVPLARWSRGLALVLLDVVPPAKRAFTRAMLHGMH
Ga0209797_1013637813300027831Wetland SedimentVSVFGNDLPFVRWPRGLALTMLDAVPVAKRAFTRAVLFGLH
Ga0209397_1013828813300027871WetlandFTHGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH
Ga0209048_1089843213300027902Freshwater Lake SedimentATDLSIVRWPRGIALMLLDAMPPVKRAFTRTMLFGLS
Ga0209069_1042726323300027915WatershedsDLALFRWPRGLALTLLDALPPAKRAFTRAMLFGMR
Ga0209069_1047114013300027915WatershedsLVGVFGNDLPFVRWPRGLALTLLGAIPVAKRAFVRTMLFGLR
Ga0247828_1027598913300028587SoilELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR
Ga0247818_1037853313300028589SoilFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA
Ga0247819_1087045313300028608SoilVQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA
Ga0302295_113614423300028856FenATDAAVVRWPRGMALTLLDAVPPMKKAFTRAMLFGLS
Ga0302295_114184023300028856FenLFATDSLILRWPRGLALTLLDAVPPMKKAFTRAMLFGIS
Ga0302259_110989413300028861FenSIAFTHGLARIFAMDAPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS
Ga0302263_1032929213300028869FenIAFTHGLARIFATDAPLLRWPRGLALTLLDAVPPVKKAFTRAMLFGIS
Ga0311365_1100066623300029989FenTHGLVNLFGNDLALFRWPRGLALTLLDALPPAKRAFTRAMLFGMR
Ga0311337_1091867223300030000FenTHGLTQLFASDRPFLRWPRGAALTLLDAVPAAKKAFTRAMLFGLS
Ga0311350_1090765823300030002FenGLTQLFATDSLILRWPRGLALTLLDAVPPMKKAFTRAMLFGIS
Ga0302286_1042218023300030047FenGLARIFAMDAPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS
Ga0311335_1142179713300030838FenGVFSNDRTALRWPRGLALTLLDAFPPMKRSFTRAMLFGLR
Ga0307495_1008955413300031199SoilGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH
Ga0307468_10139254313300031740Hardwood Forest SoilLLGIFGSDAPLLRWPRGLALTMLDALPAVKRAFTRVMSYGMH
Ga0315293_1095940523300031746SedimentFGNDLPFVRWPRGFALTLLDAVPAAKRAFTHAMLFGLR
Ga0318509_1038507413300031768SoilVFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR
Ga0318527_1046258423300031859SoilDVALVRWPRGLALTLLGAVPPAKRAFARAMLFGLH
Ga0310900_1022410113300031908SoilFTHGLVQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA
Ga0310900_1090864123300031908SoilLFGTELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR
Ga0307412_1030710223300031911RhizosphereHGLLRIFGTDHAAARWPRGIALALMDSTPPLKRWFTRSMLFGLRH
Ga0310916_1157399713300031942SoilIFGNDMPFVRWPRGLALTLLGAVPAAKRAFARAMLFGLH
Ga0307409_10290265213300031995RhizosphereALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGLS
Ga0307416_10175785123300032002RhizosphereDGALFAWPRGIALAALDALPFAKRAFTRAMLFGLS
Ga0318510_1013344313300032064SoilDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR
Ga0318510_1042878313300032064SoilGDLELVRWPRGLALSALDAFPQARRAFTRAMLFGLR
Ga0318553_1064805213300032068SoilQPDRIAGIALTHGLLGVFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR
Ga0318577_1057336613300032091SoilAGIALTHGLLGVFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR
Ga0315905_1161375313300032092FreshwaterHGLVHLFGNDSALLRWPRGLALTLLDALPPVKRGFTRTMLFGLR
Ga0315283_1084717013300032164SedimentGIAFTHGLVGLFGNDLPFLRWPRGLALTLLDTVPLAKHTFTRAMLFGLR
Ga0315283_1229914123300032164SedimentGLVSIFGNDLPVVRWPRGLALTMLDAVPAAKRAFAHAMLFGLR
Ga0315276_1219669613300032177SedimentHGLTRIFATDMPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS
Ga0315271_1085108913300032256SedimentLFGNDLPFVRWPRGLALMLLDAVPPLKRAFTSAMLFGLR
Ga0315270_1006379443300032275SedimentGLVSVFGNDLPFVRWPRGLALALLGAVPLAKRAFTRAMLFGFR
Ga0315270_1083566323300032275SedimentHGLVSIFGNDLPFVRWPRGFALTVLDAVPAAKRAFTHAMLFGLR
Ga0315287_1045907933300032397SedimentATDAAAVRWPRGLALSLLDAVPPLKKAFTRAMLFGLS
Ga0335084_1046171723300033004SoilDASGISWPRGLALVALDVLPVAKRAFTRAMLFGLR
Ga0316603_1045276523300033413SoilFGNDLPFVRWPRGLALTLLDALPPFKRAFTRAMLFGLR
Ga0316601_10185751113300033419SoilTHGLTRLFSSSVPLVSWPRGLALTLLDTVPPAKNAFTRAMLFGLS
Ga0316601_10234168723300033419SoilVFGSDLPWLRWPRGLALTLLDTLPVAKRAFTRAMMFGLR
Ga0326726_1162484113300033433Peat SoilHGLVNVFGTNRPFVRWPRGLALTMLDAVPAAKRAFTHAMLFGMR
Ga0316627_10168347223300033482SoilHGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH
Ga0247830_1004775343300033551SoilGLVQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA
Ga0247830_1054085913300033551SoilLVHLFGTELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR
Ga0314862_0043185_846_9563300033803PeatlandAGASWLRWPRGLALTLLDASPVAKRMFTRAMLFGVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.