| Basic Information | |
|---|---|
| Family ID | F068992 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FGNDLPFVRWPRGLALTLLDALPPFKRAFTRAMLFGLR |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.065 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.258 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.097 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.645 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF01207 | Dus | 83.06 |
| PF02954 | HTH_8 | 1.61 |
| PF02142 | MGS | 1.61 |
| PF02844 | GARS_N | 0.81 |
| PF07017 | PagP | 0.81 |
| PF04392 | ABC_sub_bind | 0.81 |
| PF00005 | ABC_tran | 0.81 |
| PF04552 | Sigma54_DBD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 83.06 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.81 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.81 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.68 % |
| Unclassified | root | N/A | 40.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090006|LWSO2_GGWJX9X02G9A7U | Not Available | 513 | Open in IMG/M |
| 2088090009|LWAnN_GIDYKCY01D85KK | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 2170459005|F1BAP7Q01A56JM | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300004074|Ga0055518_10126252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300004156|Ga0062589_102641261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300005187|Ga0066675_10147670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1610 | Open in IMG/M |
| 3300005328|Ga0070676_10504807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 859 | Open in IMG/M |
| 3300005334|Ga0068869_101405364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 618 | Open in IMG/M |
| 3300005347|Ga0070668_100068826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2752 | Open in IMG/M |
| 3300005355|Ga0070671_101299803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300005451|Ga0066681_10406118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 837 | Open in IMG/M |
| 3300005458|Ga0070681_10428489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1235 | Open in IMG/M |
| 3300005539|Ga0068853_100530253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1114 | Open in IMG/M |
| 3300005564|Ga0070664_101735962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300005598|Ga0066706_10756794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 769 | Open in IMG/M |
| 3300005598|Ga0066706_11252941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300005614|Ga0068856_100672779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1056 | Open in IMG/M |
| 3300005616|Ga0068852_100734688 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Opalozoa → Bicosoecida → Cafeteriaceae → Cafeteria → Cafeteria roenbergensis | 999 | Open in IMG/M |
| 3300005616|Ga0068852_102253221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea | 566 | Open in IMG/M |
| 3300005718|Ga0068866_11155171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300005834|Ga0068851_10044044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2251 | Open in IMG/M |
| 3300005842|Ga0068858_102504333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 510 | Open in IMG/M |
| 3300006092|Ga0082021_1179826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4376 | Open in IMG/M |
| 3300006224|Ga0079037_101363384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300006796|Ga0066665_10253974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1393 | Open in IMG/M |
| 3300006953|Ga0074063_14099976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea | 681 | Open in IMG/M |
| 3300009012|Ga0066710_101327243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
| 3300009111|Ga0115026_11181610 | Not Available | 622 | Open in IMG/M |
| 3300009137|Ga0066709_100074332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4013 | Open in IMG/M |
| 3300009137|Ga0066709_104649997 | Not Available | 502 | Open in IMG/M |
| 3300009654|Ga0116167_1276551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 538 | Open in IMG/M |
| 3300009664|Ga0116146_1362196 | Not Available | 539 | Open in IMG/M |
| 3300009873|Ga0131077_10079067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4176 | Open in IMG/M |
| 3300010376|Ga0126381_100411930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1886 | Open in IMG/M |
| 3300010401|Ga0134121_11073645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
| 3300010403|Ga0134123_12612900 | Not Available | 572 | Open in IMG/M |
| 3300012208|Ga0137376_10075488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2815 | Open in IMG/M |
| 3300012211|Ga0137377_10354794 | Not Available | 1403 | Open in IMG/M |
| 3300012353|Ga0137367_10627247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300012922|Ga0137394_10994175 | Not Available | 697 | Open in IMG/M |
| 3300012924|Ga0137413_11720211 | Not Available | 516 | Open in IMG/M |
| 3300012971|Ga0126369_13220396 | Not Available | 535 | Open in IMG/M |
| 3300012986|Ga0164304_10160003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1429 | Open in IMG/M |
| 3300013100|Ga0157373_10569065 | Not Available | 823 | Open in IMG/M |
| 3300013306|Ga0163162_13483034 | Not Available | 501 | Open in IMG/M |
| 3300014968|Ga0157379_10002957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14333 | Open in IMG/M |
| 3300015075|Ga0167636_1015008 | Not Available | 1109 | Open in IMG/M |
| 3300015160|Ga0167642_1024243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300015168|Ga0167631_1012594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1281 | Open in IMG/M |
| 3300015254|Ga0180089_1055112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 789 | Open in IMG/M |
| 3300015374|Ga0132255_101644031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 974 | Open in IMG/M |
| 3300015374|Ga0132255_101686042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300015374|Ga0132255_104691397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 579 | Open in IMG/M |
| 3300017944|Ga0187786_10615125 | Not Available | 512 | Open in IMG/M |
| 3300017959|Ga0187779_10701014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
| 3300018089|Ga0187774_10399294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 836 | Open in IMG/M |
| 3300023062|Ga0247791_1069793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 572 | Open in IMG/M |
| 3300025903|Ga0207680_11096455 | Not Available | 569 | Open in IMG/M |
| 3300025906|Ga0207699_10492259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 884 | Open in IMG/M |
| 3300025907|Ga0207645_10428816 | Not Available | 891 | Open in IMG/M |
| 3300025938|Ga0207704_10366008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1127 | Open in IMG/M |
| 3300025944|Ga0207661_11494683 | Not Available | 619 | Open in IMG/M |
| 3300025949|Ga0207667_10576439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1136 | Open in IMG/M |
| 3300025979|Ga0210078_1025253 | Not Available | 781 | Open in IMG/M |
| 3300025986|Ga0207658_12176789 | Not Available | 503 | Open in IMG/M |
| 3300026078|Ga0207702_11899414 | Not Available | 587 | Open in IMG/M |
| 3300026088|Ga0207641_10276018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1579 | Open in IMG/M |
| 3300026088|Ga0207641_10739394 | Not Available | 970 | Open in IMG/M |
| 3300026089|Ga0207648_10936902 | Not Available | 810 | Open in IMG/M |
| 3300026118|Ga0207675_102610538 | Not Available | 515 | Open in IMG/M |
| 3300026326|Ga0209801_1230262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300027775|Ga0209177_10248323 | Not Available | 656 | Open in IMG/M |
| 3300027805|Ga0209229_10485155 | Not Available | 529 | Open in IMG/M |
| 3300027831|Ga0209797_10136378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1059 | Open in IMG/M |
| 3300027871|Ga0209397_10138288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 1070 | Open in IMG/M |
| 3300027902|Ga0209048_10898432 | Not Available | 572 | Open in IMG/M |
| 3300027915|Ga0209069_10427263 | Not Available | 731 | Open in IMG/M |
| 3300027915|Ga0209069_10471140 | Not Available | 702 | Open in IMG/M |
| 3300028587|Ga0247828_10275989 | Not Available | 916 | Open in IMG/M |
| 3300028589|Ga0247818_10378533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300028608|Ga0247819_10870453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 562 | Open in IMG/M |
| 3300028856|Ga0302295_1136144 | Not Available | 560 | Open in IMG/M |
| 3300028856|Ga0302295_1141840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 550 | Open in IMG/M |
| 3300028861|Ga0302259_1109894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 674 | Open in IMG/M |
| 3300028869|Ga0302263_10329292 | Not Available | 605 | Open in IMG/M |
| 3300029989|Ga0311365_11000666 | Not Available | 722 | Open in IMG/M |
| 3300030000|Ga0311337_10918672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 761 | Open in IMG/M |
| 3300030002|Ga0311350_10907658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 788 | Open in IMG/M |
| 3300030047|Ga0302286_10422180 | Not Available | 673 | Open in IMG/M |
| 3300030838|Ga0311335_11421797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300031199|Ga0307495_10089554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 710 | Open in IMG/M |
| 3300031740|Ga0307468_101392543 | Not Available | 644 | Open in IMG/M |
| 3300031746|Ga0315293_10959405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300031768|Ga0318509_10385074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 784 | Open in IMG/M |
| 3300031859|Ga0318527_10462584 | Not Available | 541 | Open in IMG/M |
| 3300031908|Ga0310900_10224101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1337 | Open in IMG/M |
| 3300031908|Ga0310900_10908641 | Not Available | 719 | Open in IMG/M |
| 3300031911|Ga0307412_10307102 | Not Available | 1256 | Open in IMG/M |
| 3300031942|Ga0310916_11573997 | Not Available | 534 | Open in IMG/M |
| 3300031995|Ga0307409_102902652 | Not Available | 506 | Open in IMG/M |
| 3300032002|Ga0307416_101757851 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Bigyra → Opalozoa → Bicosoecida → Cafeteriaceae → Cafeteria → Cafeteria roenbergensis | 724 | Open in IMG/M |
| 3300032064|Ga0318510_10133443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 970 | Open in IMG/M |
| 3300032064|Ga0318510_10428783 | Not Available | 566 | Open in IMG/M |
| 3300032091|Ga0318577_10573366 | Not Available | 537 | Open in IMG/M |
| 3300032092|Ga0315905_11613753 | Not Available | 503 | Open in IMG/M |
| 3300032164|Ga0315283_10847170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 977 | Open in IMG/M |
| 3300032164|Ga0315283_12299141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 527 | Open in IMG/M |
| 3300032177|Ga0315276_12196696 | Not Available | 559 | Open in IMG/M |
| 3300032256|Ga0315271_10851089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 786 | Open in IMG/M |
| 3300032275|Ga0315270_10063794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2092 | Open in IMG/M |
| 3300032275|Ga0315270_10835663 | Not Available | 607 | Open in IMG/M |
| 3300032397|Ga0315287_10459079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1512 | Open in IMG/M |
| 3300033004|Ga0335084_10461717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1306 | Open in IMG/M |
| 3300033413|Ga0316603_10452765 | Not Available | 1170 | Open in IMG/M |
| 3300033419|Ga0316601_101857511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300033419|Ga0316601_102341687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
| 3300033433|Ga0326726_11624841 | Not Available | 629 | Open in IMG/M |
| 3300033482|Ga0316627_101683472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 648 | Open in IMG/M |
| 3300033551|Ga0247830_10047753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2789 | Open in IMG/M |
| 3300033551|Ga0247830_10540859 | Not Available | 919 | Open in IMG/M |
| 3300033803|Ga0314862_0043185 | Not Available | 957 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.42% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.61% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.81% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.81% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090006 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2 | Environmental | Open in IMG/M |
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300004074 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009654 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028856 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWSO2_07409850 | 2088090006 | Freshwater Sediment | LVNVFGNDLPFLRWPRGLALTLLDTVLPAKRAFTRAMLFGLR |
| LWAnN_06829200 | 2088090009 | Freshwater Sediment | AFTHGLVNVFGNDLPFFRWPRGLALTMLDAIPVAKRVFTAAMLFGLR |
| E41_02183990 | 2170459005 | Grass Soil | GLFGTDVSLLRWPRGLALTLLDALPPVKRMFTRAMLYGLH |
| Ga0055518_101262521 | 3300004074 | Natural And Restored Wetlands | VGVFGSDLALLRWPRGLALTLLDTLPVAKRAFTRAMLFGLG* |
| Ga0062589_1026412611 | 3300004156 | Soil | LGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLR* |
| Ga0066675_101476703 | 3300005187 | Soil | VFGTDAPLLSWPRGLALTLLDSLPAVKHAFTRAMLFGIHQGTL* |
| Ga0070676_105048071 | 3300005328 | Miscanthus Rhizosphere | IFALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGVS* |
| Ga0068869_1014053642 | 3300005334 | Miscanthus Rhizosphere | AAFGNDVPLLRWPRGLALTLLDAFPPAKRAFTRAMLFGLR* |
| Ga0070668_1000688261 | 3300005347 | Switchgrass Rhizosphere | GLTHIFALDGAIFAWPRGIALAALDALPFAKRAFTRAMLFGLS* |
| Ga0070671_1012998032 | 3300005355 | Switchgrass Rhizosphere | HGLVQVFGNDLPFVRWSRGVALTALDAMPPAKRAFARAMLFGIH* |
| Ga0066681_104061182 | 3300005451 | Soil | VKLFGNDAAFVRWPRGLALALLDALPPAKRAFTRTMLFGMR* |
| Ga0070681_104284891 | 3300005458 | Corn Rhizosphere | RMFGSGLPLFAWPRGIGLAALDALPIGKRAFTRAMLYGF* |
| Ga0068853_1005302531 | 3300005539 | Corn Rhizosphere | FTHGLTRIFATDSMFLRWPRGLALALLDAIPPAKKAFTRAMLFGMS* |
| Ga0070664_1017359622 | 3300005564 | Corn Rhizosphere | GLTHIFALDGAIFAWPRGLALAALDALPFAKRAFTRAMMFGMS* |
| Ga0066706_107567942 | 3300005598 | Soil | FTHGLLGIFGSDAPLLRWPRGLALTMLDALPAAKRAFTRAMTFGMH* |
| Ga0066706_112529412 | 3300005598 | Soil | LVHLFGSDLPFIRWPRGFALTALDAMPAAKRVFARAMLFGIH* |
| Ga0068856_1006727792 | 3300005614 | Corn Rhizosphere | LLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH* |
| Ga0068852_1007346882 | 3300005616 | Corn Rhizosphere | FALDGAIFAWPRGLALAALDALPFVKRAFTRAMLFGLS* |
| Ga0068852_1022532211 | 3300005616 | Corn Rhizosphere | DSMFLRWPRGLALALLDAIPPAKKAFTRAMLFGMS* |
| Ga0068866_111551711 | 3300005718 | Miscanthus Rhizosphere | GLTQLFASQSPLLRWPRGLALTLLDALPPSKKAFTRAMLYGLS* |
| Ga0068851_100440444 | 3300005834 | Corn Rhizosphere | FALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGVS* |
| Ga0068858_1014204392 | 3300005842 | Switchgrass Rhizosphere | FTHGLARIFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS* |
| Ga0068858_1025043331 | 3300005842 | Switchgrass Rhizosphere | LFGSELPFVAWPRGIALAMLDALPAAKRAFTRAMIFGMR* |
| Ga0082021_11798265 | 3300006092 | Wastewater Treatment Plant | HLFGTDLPFVRWPRGLGLALLDAAPPLKRSFTRAMLFGA* |
| Ga0079037_1013633841 | 3300006224 | Freshwater Wetlands | AFTHGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH* |
| Ga0066665_102539741 | 3300006796 | Soil | LGVFGTDAPLLSWPRGLALTLLDSLPAMKHAFTRAMLFGIHQATL* |
| Ga0074063_140999761 | 3300006953 | Soil | LTRIFATDSMFLRWPRGLALALLDAIPPAKRAFTRAMLFGMS* |
| Ga0066710_1013272431 | 3300009012 | Grasslands Soil | NDSPLLRWPRGLALTLLDARPPLKRAFANAMLYGVH |
| Ga0115026_111816102 | 3300009111 | Wetland | FGNAAALLRWPRGLALTLLDALPPAKRAFTRAMLFGLH* |
| Ga0066709_1000743321 | 3300009137 | Grasslands Soil | SDAPLLRWPRGLALTMLDALPAAKRAFTHAMSYGIH* |
| Ga0066709_1046499971 | 3300009137 | Grasslands Soil | GADASLLRWPRGLALTLLDALPPVKRAFTRAMLYGLH* |
| Ga0116167_12765512 | 3300009654 | Anaerobic Digestor Sludge | VHLFGTDLPFVRWPRGLGLALLDAAPPLKRSFTRAMLFGA* |
| Ga0116146_13621961 | 3300009664 | Anaerobic Digestor Sludge | DLPFVRWPRGVGLAMLDAVPPLKRSFTRAMLFGA* |
| Ga0131077_100790671 | 3300009873 | Wastewater | LVGVFGADLPLLRLSRGVGLALLDVFPPAKRAFAQAMMFGLR* |
| Ga0105239_107246332 | 3300010375 | Corn Rhizosphere | THGLTQLFALDFPLARWPRGLAFTLLDALPPAKKAFTRAMLFGLS* |
| Ga0126381_1004119304 | 3300010376 | Tropical Forest Soil | FASAVPLVSWPRGLALTLLDCIPPIKRAFTRAMLFGL* |
| Ga0134121_110736452 | 3300010401 | Terrestrial Soil | GNDLPLVRWPRGLALTLLDSVPAAKRAFTHAMLFGIR* |
| Ga0134123_126129002 | 3300010403 | Terrestrial Soil | HGLVGIFGNDLALVSWPRGLALTLLGAVPAAKRAFARAMLFGLR* |
| Ga0137376_100754881 | 3300012208 | Vadose Zone Soil | GIAFTHGLVQLFGTDLPFVRWPRGLALTMLDALPSAKRVFARAMLFGIH* |
| Ga0137377_103547941 | 3300012211 | Vadose Zone Soil | HGLLGIFGSDAPLLRWPRGLALTMLDALPAVKRAFARAMTFGLH* |
| Ga0137367_106272471 | 3300012353 | Vadose Zone Soil | PLLSWPRGLALTLLDSLPAAKHAFTRAMLFGVHQGIL* |
| Ga0137394_109941753 | 3300012922 | Vadose Zone Soil | GTDAPFVRWPRGLALTLLDAMPAAKRAFTRAMLFGVR* |
| Ga0137413_117202112 | 3300012924 | Vadose Zone Soil | FGTDLPFVRWPRGVALTLMDALPPVKRAFTRAMLFGLK* |
| Ga0126369_132203962 | 3300012971 | Tropical Forest Soil | AFTHGLLRIFGNDHALLRWPRGLALTLLDALPPFKRVFTQAMLFGVH* |
| Ga0164304_101600032 | 3300012986 | Soil | RWSGIALTHGLLGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTHAMLYGLH* |
| Ga0157373_105690652 | 3300013100 | Corn Rhizosphere | VHAFGSNRPLLRIPRGAGLALLDSVPVAKHAFTRAMLFGVR* |
| Ga0163162_134830342 | 3300013306 | Switchgrass Rhizosphere | VHLFGTDLPLVRWPRGVGLALLGAIPPLKRSFTRAMLFGA* |
| Ga0157379_1000295715 | 3300014968 | Switchgrass Rhizosphere | THGLLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH* |
| Ga0167636_10150081 | 3300015075 | Glacier Forefield Soils | FGADVSMLRWPRGLALTLLDALPPVKRLFTRAMLYGLH* |
| Ga0167642_10242432 | 3300015160 | Glacier Forefield Soil | LFGADVSLLRWPRGLALTLLDALPPVKRLFTRAMLYGLH* |
| Ga0167631_10125942 | 3300015168 | Glacier Forefield Soil | LTHGLLGVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH* |
| Ga0180089_10551121 | 3300015254 | Soil | APLLRWPRGLALTMLDALPAVKRAFTRAMSYGMH* |
| Ga0132255_1016440311 | 3300015374 | Arabidopsis Rhizosphere | TEQALLRVPRGLGMTLLDTFPLAKRAFTRAMLFGVR* |
| Ga0132255_1016860421 | 3300015374 | Arabidopsis Rhizosphere | HGLVRVFGNDVPFVRWPRGIALTLLDALPPAKRAFTRAMLFGLR* |
| Ga0132255_1046913971 | 3300015374 | Arabidopsis Rhizosphere | DLRFVRWPRGLALTLLDAVPPAKRAFTRAMLFGIR* |
| Ga0187786_106151251 | 3300017944 | Tropical Peatland | GLVGIFGNDMPLVGWPRGLALTLLGAVPAAKRAFARAVLFGLH |
| Ga0187779_107010141 | 3300017959 | Tropical Peatland | IFGVDAPWLSWPRGLALTLLDALPTAKRMFARTMLFGVR |
| Ga0187774_103992942 | 3300018089 | Tropical Peatland | PLVSWPRGLALTMLDCLPALKRTFTRAMLFGVQAVIG |
| Ga0247791_10697931 | 3300023062 | Soil | TDLALVRWPRGVGLALLGAIPPLRRSFTRAMLYGA |
| Ga0207680_110964552 | 3300025903 | Switchgrass Rhizosphere | LLEVFGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH |
| Ga0207699_104922593 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HGLLGVFGSDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLH |
| Ga0207645_104288161 | 3300025907 | Miscanthus Rhizosphere | RLAGIALTHGLVGIFGNDHALLSWPRGLALTLLGAVPVAKRAFTRAMLFGMR |
| Ga0207704_103660082 | 3300025938 | Miscanthus Rhizosphere | FGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH |
| Ga0207661_114946831 | 3300025944 | Corn Rhizosphere | GSDSALVAWPRGLGLALLDVLPPARRAFTRAMLFGVH |
| Ga0207667_105764392 | 3300025949 | Corn Rhizosphere | SDAALLRWPRGLALTLLDSLPPLKRIFTRAMLYGLR |
| Ga0210078_10252531 | 3300025979 | Natural And Restored Wetlands | NVFGTHRPFVRWPRGLALTMLDAVPAAKRAFTHAMLFGLR |
| Ga0207658_121767891 | 3300025986 | Switchgrass Rhizosphere | IFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS |
| Ga0207702_118994142 | 3300026078 | Corn Rhizosphere | LEVCGSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH |
| Ga0207641_102760181 | 3300026088 | Switchgrass Rhizosphere | FALDAAIFRWPRGIGLAMLDAFPPAKRAFTRAMLFGLS |
| Ga0207641_107393942 | 3300026088 | Switchgrass Rhizosphere | HGLVKIFGNDVGFVRWPRGLALTLLDAIPPAKRAFTRAMLFGMR |
| Ga0207648_109369022 | 3300026089 | Miscanthus Rhizosphere | GIALTHGLVGIFGNDHALLSWPRGLALTLLGAVPVAKRAFTRAMLFGMR |
| Ga0207675_1026105382 | 3300026118 | Switchgrass Rhizosphere | RIFALDAAIFRWPRGIGLALLDALPPAKRAFTRAMLFGLS |
| Ga0209801_12302621 | 3300026326 | Soil | GIFGSDAPLLRWPRGLALTMLDALPAVKRAFAHAMTFGLH |
| Ga0209177_102483231 | 3300027775 | Agricultural Soil | GLLGIFGTDAALLRWPRGLALTLLDALPPLKRIFTHSMLYGIH |
| Ga0209229_104851551 | 3300027805 | Freshwater And Sediment | THGLVRIFGNDVPLARWSRGLALVLLDVVPPAKRAFTRAMLHGMH |
| Ga0209797_101363781 | 3300027831 | Wetland Sediment | VSVFGNDLPFVRWPRGLALTMLDAVPVAKRAFTRAVLFGLH |
| Ga0209397_101382881 | 3300027871 | Wetland | FTHGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH |
| Ga0209048_108984321 | 3300027902 | Freshwater Lake Sediment | ATDLSIVRWPRGIALMLLDAMPPVKRAFTRTMLFGLS |
| Ga0209069_104272632 | 3300027915 | Watersheds | DLALFRWPRGLALTLLDALPPAKRAFTRAMLFGMR |
| Ga0209069_104711401 | 3300027915 | Watersheds | LVGVFGNDLPFVRWPRGLALTLLGAIPVAKRAFVRTMLFGLR |
| Ga0247828_102759891 | 3300028587 | Soil | ELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR |
| Ga0247818_103785331 | 3300028589 | Soil | FGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA |
| Ga0247819_108704531 | 3300028608 | Soil | VQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA |
| Ga0302295_11361442 | 3300028856 | Fen | ATDAAVVRWPRGMALTLLDAVPPMKKAFTRAMLFGLS |
| Ga0302295_11418402 | 3300028856 | Fen | LFATDSLILRWPRGLALTLLDAVPPMKKAFTRAMLFGIS |
| Ga0302259_11098941 | 3300028861 | Fen | SIAFTHGLARIFAMDAPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS |
| Ga0302263_103292921 | 3300028869 | Fen | IAFTHGLARIFATDAPLLRWPRGLALTLLDAVPPVKKAFTRAMLFGIS |
| Ga0311365_110006662 | 3300029989 | Fen | THGLVNLFGNDLALFRWPRGLALTLLDALPPAKRAFTRAMLFGMR |
| Ga0311337_109186722 | 3300030000 | Fen | THGLTQLFASDRPFLRWPRGAALTLLDAVPAAKKAFTRAMLFGLS |
| Ga0311350_109076582 | 3300030002 | Fen | GLTQLFATDSLILRWPRGLALTLLDAVPPMKKAFTRAMLFGIS |
| Ga0302286_104221802 | 3300030047 | Fen | GLARIFAMDAPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS |
| Ga0311335_114217971 | 3300030838 | Fen | GVFSNDRTALRWPRGLALTLLDAFPPMKRSFTRAMLFGLR |
| Ga0307495_100895541 | 3300031199 | Soil | GSDAALLRWPRGLALTLLDALPPLKRIFTHAMLYGLH |
| Ga0307468_1013925431 | 3300031740 | Hardwood Forest Soil | LLGIFGSDAPLLRWPRGLALTMLDALPAVKRAFTRVMSYGMH |
| Ga0315293_109594052 | 3300031746 | Sediment | FGNDLPFVRWPRGFALTLLDAVPAAKRAFTHAMLFGLR |
| Ga0318509_103850741 | 3300031768 | Soil | VFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR |
| Ga0318527_104625842 | 3300031859 | Soil | DVALVRWPRGLALTLLGAVPPAKRAFARAMLFGLH |
| Ga0310900_102241011 | 3300031908 | Soil | FTHGLVQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA |
| Ga0310900_109086412 | 3300031908 | Soil | LFGTELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR |
| Ga0307412_103071022 | 3300031911 | Rhizosphere | HGLLRIFGTDHAAARWPRGIALALMDSTPPLKRWFTRSMLFGLRH |
| Ga0310916_115739971 | 3300031942 | Soil | IFGNDMPFVRWPRGLALTLLGAVPAAKRAFARAMLFGLH |
| Ga0307409_1029026521 | 3300031995 | Rhizosphere | ALDGAIFAWPRGLALAALDALPFAKRAFTRAMLFGLS |
| Ga0307416_1017578512 | 3300032002 | Rhizosphere | DGALFAWPRGIALAALDALPFAKRAFTRAMLFGLS |
| Ga0318510_101334431 | 3300032064 | Soil | DAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR |
| Ga0318510_104287831 | 3300032064 | Soil | GDLELVRWPRGLALSALDAFPQARRAFTRAMLFGLR |
| Ga0318553_106480521 | 3300032068 | Soil | QPDRIAGIALTHGLLGVFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR |
| Ga0318577_105733661 | 3300032091 | Soil | AGIALTHGLLGVFGTDAEWLAWPRGLALTLLDALPTAKRMFARAMLFGVR |
| Ga0315905_116137531 | 3300032092 | Freshwater | HGLVHLFGNDSALLRWPRGLALTLLDALPPVKRGFTRTMLFGLR |
| Ga0315283_108471701 | 3300032164 | Sediment | GIAFTHGLVGLFGNDLPFLRWPRGLALTLLDTVPLAKHTFTRAMLFGLR |
| Ga0315283_122991412 | 3300032164 | Sediment | GLVSIFGNDLPVVRWPRGLALTMLDAVPAAKRAFAHAMLFGLR |
| Ga0315276_121966961 | 3300032177 | Sediment | HGLTRIFATDMPLVRWPRGLALTLLDAVPPMKKAFTRAMLFGIS |
| Ga0315271_108510891 | 3300032256 | Sediment | LFGNDLPFVRWPRGLALMLLDAVPPLKRAFTSAMLFGLR |
| Ga0315270_100637944 | 3300032275 | Sediment | GLVSVFGNDLPFVRWPRGLALALLGAVPLAKRAFTRAMLFGFR |
| Ga0315270_108356632 | 3300032275 | Sediment | HGLVSIFGNDLPFVRWPRGFALTVLDAVPAAKRAFTHAMLFGLR |
| Ga0315287_104590793 | 3300032397 | Sediment | ATDAAAVRWPRGLALSLLDAVPPLKKAFTRAMLFGLS |
| Ga0335084_104617172 | 3300033004 | Soil | DASGISWPRGLALVALDVLPVAKRAFTRAMLFGLR |
| Ga0316603_104527652 | 3300033413 | Soil | FGNDLPFVRWPRGLALTLLDALPPFKRAFTRAMLFGLR |
| Ga0316601_1018575111 | 3300033419 | Soil | THGLTRLFSSSVPLVSWPRGLALTLLDTVPPAKNAFTRAMLFGLS |
| Ga0316601_1023416872 | 3300033419 | Soil | VFGSDLPWLRWPRGLALTLLDTLPVAKRAFTRAMMFGLR |
| Ga0326726_116248411 | 3300033433 | Peat Soil | HGLVNVFGTNRPFVRWPRGLALTMLDAVPAAKRAFTHAMLFGMR |
| Ga0316627_1016834722 | 3300033482 | Soil | HGLVRIFGNDAAFARWPRGLALAALDLVPPAKRAFTRVMLHGMH |
| Ga0247830_100477534 | 3300033551 | Soil | GLVQLFGTDLPLARWPRGLGLALLDAIPPLKRSFTRAMLHGA |
| Ga0247830_105408591 | 3300033551 | Soil | LVHLFGTELPFVRWPRGIALALLDALPPAKRAFTRAMLFGVR |
| Ga0314862_0043185_846_956 | 3300033803 | Peatland | AGASWLRWPRGLALTLLDASPVAKRMFTRAMLFGVR |
| ⦗Top⦘ |