NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068965

Metagenome Family F068965

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068965
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 59 residues
Representative Sequence MNERQRIITVLIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHVN
Number of Associated Samples 102
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 39.52 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(29.032 % of family members)
Environment Ontology (ENVO) Unclassified
(39.516 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.548 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 57.95%    β-sheet: 0.00%    Coil/Unstructured: 42.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF07681DoxX 51.61
PF00408PGM_PMM_IV 20.16
PF02880PGM_PMM_III 12.10
PF13442Cytochrome_CBB3 3.23
PF13360PQQ_2 3.23
PF13570PQQ_3 2.42
PF01011PQQ 1.61
PF08241Methyltransf_11 0.81
PF13368Toprim_C_rpt 0.81
PF13460NAD_binding_10 0.81
PF04851ResIII 0.81
PF10043DUF2279 0.81
PF12695Abhydrolase_5 0.81
PF02310B12-binding 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 51.61
COG4270Uncharacterized membrane proteinFunction unknown [S] 51.61
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 32.26
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 32.26

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig62794All Organisms → cellular organisms → Bacteria1068Open in IMG/M
2170459017|G14TP7Y02H1KSBAll Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes560Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101333296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes625Open in IMG/M
3300004114|Ga0062593_101881158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes660Open in IMG/M
3300004157|Ga0062590_101186597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea743Open in IMG/M
3300004157|Ga0062590_101599227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes659Open in IMG/M
3300004463|Ga0063356_106334953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes507Open in IMG/M
3300004480|Ga0062592_101900869All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes585Open in IMG/M
3300004643|Ga0062591_101256583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales725Open in IMG/M
3300004808|Ga0062381_10205020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea686Open in IMG/M
3300005166|Ga0066674_10055353All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1797Open in IMG/M
3300005288|Ga0065714_10481216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes534Open in IMG/M
3300005290|Ga0065712_10365387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes770Open in IMG/M
3300005294|Ga0065705_10418210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales861Open in IMG/M
3300005295|Ga0065707_10757765All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005343|Ga0070687_100082661Not Available1757Open in IMG/M
3300005343|Ga0070687_101291793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes542Open in IMG/M
3300005367|Ga0070667_100393088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1261Open in IMG/M
3300005466|Ga0070685_10265921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1142Open in IMG/M
3300005471|Ga0070698_100002458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes20445Open in IMG/M
3300005544|Ga0070686_100534588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales915Open in IMG/M
3300005546|Ga0070696_100948487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes716Open in IMG/M
3300005615|Ga0070702_100670404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea787Open in IMG/M
3300005618|Ga0068864_101411679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales698Open in IMG/M
3300005718|Ga0068866_10500398All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes804Open in IMG/M
3300005719|Ga0068861_101605365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes641Open in IMG/M
3300005840|Ga0068870_10360987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales935Open in IMG/M
3300005841|Ga0068863_101032316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales825Open in IMG/M
3300005843|Ga0068860_102476786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes539Open in IMG/M
3300006031|Ga0066651_10257342All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300006046|Ga0066652_100653879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes997Open in IMG/M
3300006237|Ga0097621_100219381All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300006358|Ga0068871_100976929All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300006846|Ga0075430_101805280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes501Open in IMG/M
3300009011|Ga0105251_10485770All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes576Open in IMG/M
3300009094|Ga0111539_10120062All Organisms → cellular organisms → Bacteria3080Open in IMG/M
3300009156|Ga0111538_14094162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300009455|Ga0114939_10081492All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300009610|Ga0105340_1457929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes570Open in IMG/M
3300009678|Ga0105252_10579761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes518Open in IMG/M
3300010036|Ga0126305_10002351All Organisms → cellular organisms → Bacteria8603Open in IMG/M
3300010036|Ga0126305_11107818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes545Open in IMG/M
3300010037|Ga0126304_10695267All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300010403|Ga0134123_10373619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1296Open in IMG/M
3300010403|Ga0134123_13288890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes521Open in IMG/M
3300011119|Ga0105246_11201004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes698Open in IMG/M
3300012883|Ga0157281_1050485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes638Open in IMG/M
3300012883|Ga0157281_1095609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes532Open in IMG/M
3300012883|Ga0157281_1105817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes518Open in IMG/M
3300012885|Ga0157287_1097235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes541Open in IMG/M
3300012892|Ga0157294_10004275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2148Open in IMG/M
3300012895|Ga0157309_10191742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes634Open in IMG/M
3300012899|Ga0157299_10056376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes898Open in IMG/M
3300012902|Ga0157291_10144434All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300012904|Ga0157282_10213329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes632Open in IMG/M
3300012906|Ga0157295_10107786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes775Open in IMG/M
3300012907|Ga0157283_10033713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1073Open in IMG/M
3300012908|Ga0157286_10139762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes760Open in IMG/M
3300012916|Ga0157310_10093955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes953Open in IMG/M
3300012916|Ga0157310_10282441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes643Open in IMG/M
3300012916|Ga0157310_10511781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes525Open in IMG/M
3300012984|Ga0164309_10046673All Organisms → cellular organisms → Bacteria2485Open in IMG/M
3300013306|Ga0163162_10460744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1403Open in IMG/M
3300014325|Ga0163163_12498782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes575Open in IMG/M
3300014326|Ga0157380_10083715All Organisms → cellular organisms → Bacteria2614Open in IMG/M
3300014326|Ga0157380_12537090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes578Open in IMG/M
3300014969|Ga0157376_10186089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1901Open in IMG/M
3300015200|Ga0173480_10256629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea955Open in IMG/M
3300015201|Ga0173478_10337439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes698Open in IMG/M
3300015371|Ga0132258_10951986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2169Open in IMG/M
3300015371|Ga0132258_12107375All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300017792|Ga0163161_10140404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1829Open in IMG/M
3300017792|Ga0163161_10998488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes714Open in IMG/M
3300018051|Ga0184620_10150624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes752Open in IMG/M
3300018067|Ga0184611_1059813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1283Open in IMG/M
3300018073|Ga0184624_10036738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1923Open in IMG/M
3300018476|Ga0190274_10168178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1879Open in IMG/M
3300018476|Ga0190274_10334710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1430Open in IMG/M
3300018476|Ga0190274_10782179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1009Open in IMG/M
3300018476|Ga0190274_10786373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1007Open in IMG/M
3300018476|Ga0190274_10973619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes921Open in IMG/M
3300018481|Ga0190271_10442815All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300018481|Ga0190271_13873096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes501Open in IMG/M
3300019356|Ga0173481_10375786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes687Open in IMG/M
3300019361|Ga0173482_10023143Not Available1790Open in IMG/M
3300019361|Ga0173482_10220520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes789Open in IMG/M
3300019361|Ga0173482_10236023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes770Open in IMG/M
3300019884|Ga0193741_1035438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1288Open in IMG/M
3300020000|Ga0193692_1000499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9873Open in IMG/M
3300020016|Ga0193696_1032277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1399Open in IMG/M
3300020016|Ga0193696_1069071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes921Open in IMG/M
3300020020|Ga0193738_1000010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes144622Open in IMG/M
3300020020|Ga0193738_1002863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae6383Open in IMG/M
3300022756|Ga0222622_10547691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes831Open in IMG/M
3300022756|Ga0222622_10676245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes749Open in IMG/M
3300022880|Ga0247792_1053554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes759Open in IMG/M
3300022886|Ga0247746_1011711All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1819Open in IMG/M
3300022899|Ga0247795_1017892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1139Open in IMG/M
3300022906|Ga0247766_1007891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2300Open in IMG/M
3300022911|Ga0247783_1005641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3722Open in IMG/M
3300023071|Ga0247752_1009060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1346Open in IMG/M
3300023168|Ga0247748_1047011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes650Open in IMG/M
3300023260|Ga0247798_1025809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes751Open in IMG/M
3300023270|Ga0247784_1029851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1295Open in IMG/M
3300025918|Ga0207662_10064410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2205Open in IMG/M
3300025930|Ga0207701_10750807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes824Open in IMG/M
3300025931|Ga0207644_10486708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1017Open in IMG/M
3300025936|Ga0207670_11841244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes515Open in IMG/M
3300025938|Ga0207704_10423615All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1056Open in IMG/M
3300025941|Ga0207711_11027810All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes764Open in IMG/M
3300025961|Ga0207712_10013972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5153Open in IMG/M
3300026023|Ga0207677_10185815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1639Open in IMG/M
3300026023|Ga0207677_10203001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1577Open in IMG/M
3300026095|Ga0207676_10889282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes873Open in IMG/M
3300027880|Ga0209481_10008764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4316Open in IMG/M
3300028380|Ga0268265_11756022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes627Open in IMG/M
3300031538|Ga0310888_10568861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes685Open in IMG/M
3300031908|Ga0310900_10962820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes700Open in IMG/M
3300031913|Ga0310891_10335540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes540Open in IMG/M
3300031944|Ga0310884_10453861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes746Open in IMG/M
3300032003|Ga0310897_10426758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes632Open in IMG/M
3300032017|Ga0310899_10307178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae738Open in IMG/M
3300032144|Ga0315910_10000040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae229822Open in IMG/M
3300032211|Ga0310896_10330343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes797Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil29.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.23%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.42%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.42%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.42%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009455Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal SpringEnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_131129302124908045SoilIIVVAVYNLVDQFLIRSHRGITIMSVVISMVIAIVLYLALIYFFGKKHLN
4ZMR_027686302170459017Switchgrass, Maize And Mischanthus LitterMKDKGFITVVIVVVVYNLVDQFLVRRHHGIDDWSIGISVVLSLVLYLALIYFFGKKHLN
INPhiseqgaiiFebDRAFT_10133329613300000364SoilMQERERIIAVIIVVVIYNLVDQFLVRRHHGIDDWSVFISIGIAIVLYLALIYFFG
Ga0062593_10188115823300004114SoilFAFIFYELKSTIMQERQRIITVLIVVVVYNLVDQFLFRSHRGLTISSVFISMVIALVLYLLLIYFFGKKHMN*
Ga0062590_10118659723300004157SoilMQERERIIAVIIVVVIYNLVDQFLVRRHHGIDDWSVFISIGIAIVLYLALIYFFGKKHLN
Ga0062590_10159922723300004157SoilGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN*
Ga0063356_10633495313300004463Arabidopsis Thaliana RhizosphereSKLFLLKPITMQEKQRIITVIVVVLLYNLVDQFLLRRNNGIDIWSVGISVVIAFVLYLVLIYFFGKKHMN*
Ga0062592_10190086923300004480SoilMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLA
Ga0062591_10125658313300004643SoilVVVVYNLVDQFLIQQHRGINDTSVIISFVIAVGLYLALIYFFGKKHLN*
Ga0062381_1020502023300004808Wetland SedimentMKEKERILTVIIVVVVYNLVDQFLFRKHRGITDMSVVISIAIALILYLALIYFFGKKHQN
Ga0066674_1005535323300005166SoilMKEKQRIITVLIVVLLYNLVDQFLIQKHRGINDTSVILSFVIAIVLYLALIYFFGKKHLN
Ga0065714_1048121613300005288Miscanthus RhizosphereYTMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN*
Ga0065712_1036538723300005290Miscanthus RhizosphereMQERQRIITVTIVVVVYNLVDQFLVRKHNGIDTWSVGISVIIAFVLYLALIYFFGKKHVN
Ga0065705_1041821013300005294Switchgrass RhizosphereTLKLFFIFTIDYIVLFAFIFYELKSTIMQERQRIITVLIVVVVYNLVDQFLFRSHRGLTISSVFISMVIALVLYLLLIYFFGKKHMN*
Ga0065707_1075776523300005295Switchgrass RhizosphereMQEKQRIISVIIVVAVYNLVDQFLVRRHNGIDIWSVSLSIVIALVLYLGLIYFFGKKHVN
Ga0070687_10008266113300005343Switchgrass RhizosphereMNEKGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHLN
Ga0070687_10129179313300005343Switchgrass RhizosphereMHERQRIITVVIVVVVYNLVDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN
Ga0070667_10039308813300005367Switchgrass RhizosphereSPKPIAMHERQRIITVVIVVVVYNLVDQFLVRRHHGIDDWSIGISVVLSLVLYLALIYFFGKKHLN*
Ga0070685_1026592123300005466Switchgrass RhizosphereMHERQRIITVIIVVVVYNLVDQFLVRRHHGIDDWSIGISVVLSLVLYLALIYFFGKKHLN
Ga0070698_10000245823300005471Corn, Switchgrass And Miscanthus RhizosphereMKERERIITVIIVVVVYNLVDQFLIRKHRGITDTSVLISFVIALVLYLALIFFFGKKHLN
Ga0070686_10053458833300005544Switchgrass RhizosphereVPLSKLISPKPIAMHERQRIITVVIVEVVYNLVDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN*
Ga0070696_10094848723300005546Corn, Switchgrass And Miscanthus RhizosphereMKEKERIITVIIVVVVYNLVDQFLIRKHRGITDTSVLISFAIALVLYLALIYFFGKKHLN
Ga0070702_10067040423300005615Corn, Switchgrass And Miscanthus RhizosphereMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISITLAVVLYLALIYFFGKKHLN
Ga0068864_10141167913300005618Switchgrass RhizosphereELKSTIMQERQRIITVLIVVVVYNLVDQFLFRSHRGLTISSVFISMVIALVLYLLLIYFFGKKHMN*
Ga0068866_1050039813300005718Miscanthus RhizosphereMNERGRIITVLSVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHLN
Ga0068861_10160536523300005719Switchgrass RhizosphereMNERKRIITVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKH
Ga0068870_1036098713300005840Miscanthus RhizosphereRIITVIIVVVVYNLVDQFLLRKHNGIDIWSVGISVVIAFVLYLALIYFFGKKHMN*
Ga0068863_10103231613300005841Switchgrass RhizosphereVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGKKHLN*
Ga0068860_10247678613300005843Switchgrass RhizosphereVVVVYNLVDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN*
Ga0066651_1025734223300006031SoilMKEKQRIITALIVVLLYNLVDQFLIQKHRGINDTSVILSFVIAIVLYLALIYFFGKKHLN
Ga0066652_10065387923300006046SoilMKERQRIITVIIVLIVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0097621_10021938133300006237Miscanthus RhizosphereKPIAMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGKKHLN*
Ga0068871_10097692923300006358Miscanthus RhizosphereMHERQRIITVVIVVVVYNLIDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN
Ga0075430_10180528023300006846Populus RhizosphereTVIIVVAVYNLVDQFLVRRHNGIDIWSVGISVVIAFVLYLALIYFFGKKHVN*
Ga0105251_1048577013300009011Switchgrass RhizosphereMHERQRIITVIIVVLVYNLVDQFLVRRHNGIDDWSVGISVVLSLVLYLALIYFFGKKHVN
Ga0111539_1012006223300009094Populus RhizosphereMQERQRIITVIIVVVVYNLVDQFLVRKHNGIDIWSVGISVVISIVLYLALIYFFGKKHLN
Ga0111538_1409416213300009156Populus RhizosphereMQEKERIIAVIIVVVIYNLVDQLLVRRHHGLDDSSVFISIAIALVLYLALIYFFGKKHLN
Ga0114939_1008149223300009455GroundwaterMKEKQRIYTVLIVVVIYNLIDQFLIRSKRGITDSSVYVSMGIAIVLYIALIYFFGRKHMN
Ga0105340_145792923300009610SoilMQERGRIITVIILVAFYNLVDQFLLRKHNGIDIWSVGISVVIALVLYLVLI
Ga0105252_1057976113300009678SoilMQEKQRIITVIIVVVIYNLIDQFFIKKQRGITDSSVLISIGIAIAVYLGLIYFFGKKHMN
Ga0126305_1000235193300010036Serpentine SoilMQERERIIAVIIGVVVYNLVDQFLVRRHHGIDDWSVFISIAIALVLYLALIYFFGKKHLN
Ga0126305_1110781813300010036Serpentine SoilMKEKERIILVIMVVIVYNLADQFLVRKHHGIDIWSVGISVVIAFVLYLVFIYFFGKKHVN
Ga0126304_1069526713300010037Serpentine SoilERERIIAVIIGVVVYNLVDQFLVRRHHGIDDWSVFISIAIALVLYLALIYFFGKKHMN*
Ga0134123_1037361933300010403Terrestrial SoilMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDISVIISFVIAVGLYLALIYFFGKKHVN
Ga0134123_1328889023300010403Terrestrial SoilMQEKQRIITVLIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0105246_1120100413300011119Miscanthus RhizosphereMHERQRIITVIIVVVVYNLVDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN
Ga0157281_105048523300012883SoilFTTMNEKQRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKHMN*
Ga0157281_109560923300012883SoilMQERQRIVTVIIVVFVYNLVDQFLVRKHNGIDTWSVGISVIIAFVLYL
Ga0157281_110581723300012883SoilVILTYTMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN*
Ga0157287_109723523300012885SoilMNERKRIITVIVVVVVYNLVDQFLIQKHRGLNDTSVIISFVIAVVLYLALIYFFGKKHVN
Ga0157294_1000427523300012892SoilMKERQRIITVIIVLIVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHMN
Ga0157309_1019174213300012895SoilMKERQRIITVIIVLIVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGK
Ga0157299_1005637613300012899SoilMQERQRIITVVIVVVVYNLIDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN
Ga0157291_1014443413300012902SoilVIIAVVIYNLVDQFLVRRHHGIDIWSVGISVVIAFVLYLVLIYFFGKKHVN*
Ga0157282_1021332923300012904SoilMNERKRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0157295_1010778623300012906SoilMQERQRIITVVIVVVVYNLVDQFLVRKHNGIDTWSVGISVIIAFVLYLALIYFFGKKHVN
Ga0157283_1003371333300012907SoilMQERQRIITVIVVVVVYNLVDQFLIQKDRGLNDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0157286_1013976233300012908SoilIIAVIIVVVIYNLVDQFLVRRHHGIDDWSVFISIGIAIVLYLALIYFFGKKHLN*
Ga0157310_1009395533300012916SoilGRIITVLSVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHLN*
Ga0157310_1028244113300012916SoilMQERERIITVIIVVVVYNLVDQFLLRKHNGIDIWSVGISVVIAFVLYLALIYF
Ga0157310_1051178123300012916SoilMQERERIITVIIVVVVYNLVDQFLVRRHSGIDDWSVGISVVIAFVLYLALIYFFGKKHMN
Ga0164309_1004667333300012984SoilMKEKQRIITVLIVVLLYNLVDHFLIHKHGGINDTSVIISFVIAVLLYLALIYFFGKKHLN
Ga0163162_1046074433300013306Switchgrass RhizosphereVIVVVVYNLIDQFLVRRHHGIDDWSVGISVVLSLVLYLALIYFFGKKHLN*
Ga0163163_1249878223300014325Switchgrass RhizosphereIVVAVYNLVDQFLIRKHRGITDMSVVISIVIAIVLYLVLIYFFGKKHLN*
Ga0157380_1008371533300014326Switchgrass RhizosphereMQERDRIITVIIVVAVYNLIDQFLVRRHHGIDIWSVGISVVISIVLYLALIYFFGKKHLN
Ga0157380_1253709023300014326Switchgrass RhizosphereMQERQRIITVIIVVAVYNLVDQFLVRRHNGIDIWSVGISVVIAFVLYLLLIYFFGKKHMN
Ga0157376_1018608933300014969Miscanthus RhizosphereLKPIAMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGKKHLN*
Ga0173480_1025662923300015200SoilMKEKQRIITVLIVVLLYNLIDQYLIQKHRGINDTSVIISFVIAVGLYLALIYFFGKKHLN
Ga0173478_1033743923300015201SoilMQERQRIITVTIVVVVYNLVDQFLVRKHNGIDIWSVGISVIIAFVLYLVLIYFFGKKHMN
Ga0132258_1095198623300015371Arabidopsis RhizosphereMNEKGRIITVLIVVVVYNLVDQFLIQKQRGLNDTSVVISFVIAVVLYLALIYFFGKKHLN
Ga0132258_1210737523300015371Arabidopsis RhizosphereMQEKTRILTVIIVVVVYNIIDQLLIQKHRGINDTSVFISFVIAIVLYLALIYFFGKKHLN
Ga0163161_1014040423300017792Switchgrass RhizosphereMNERQRIITVIIVLIVYNLVDQFLIQKQRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0163161_1099848823300017792Switchgrass RhizosphereMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN
Ga0184620_1015062433300018051Groundwater SedimentRIITVIIVVVAYNLVDQFLIQKHRGINDTSVLISFVIAVVLYLALIYFFGKKHLN
Ga0184611_105981313300018067Groundwater SedimentMNERQRIITVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLA
Ga0184624_1003673813300018073Groundwater SedimentMNERQRIITVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVTAVVLYLALIYFFGKKHVN
Ga0190274_1016817833300018476SoilMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIADGLYLALIYFFGKKHVN
Ga0190274_1033471023300018476SoilMQEKDRIITVIIVVAVYNLVDQLLVRRHNGIDIWSVGISVVIAIVLYLALIYFFGKKHLN
Ga0190274_1078217923300018476SoilMQEKQRIISVIIVVAVYNLVDQFLVRRNNGIDIWSVGISVVIAFVLYLALIYFFGKKHVN
Ga0190274_1078637323300018476SoilMQEKDRIITVIIVVAVYNIVDQFLIRRHNGIDIWSVGISVVISIVLYLALIYFFGKKHLN
Ga0190274_1097361933300018476SoilMSDPYQNYYSLKPIAMHERQRIITVIIVVVVYNLVDQFLVRRHNGIDDWSVGISIVIALVLYLILIYFFGKKHLN
Ga0190271_1044281513300018481SoilLMQERERIISVIIVVAVYNLVDQFLIRRHNGIDIWSVGISIVIALVLYLALIYFFGKKHV
Ga0190271_1387309623300018481SoilAMQERQRLITVIIVVAIYNLVDQFLVRKHNGIDIWSVGISVVIAFVLYLVLIYFFGKKHM
Ga0173481_1037578623300019356SoilMQERERIIAVIIFVVIYNLVDQFLVRRHHGIDDWSVFISIGIAIVLYLALIYFFGKKHMN
Ga0173482_1002314313300019361SoilMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIY
Ga0173482_1022052013300019361SoilMQERQRIITVIVVVVVYNLVDQFLIQKHRGLNDTSVIISFVIAVVLYLALIYFFGKKHVN
Ga0173482_1023602323300019361SoilMQERERIIAVIIVVVIYNLVDQFLVRRHSGIDDWSVGISVVIALVLYLVLIYFFGKKHMN
Ga0193741_103543823300019884SoilMQERERIISVIIVVAVYNLVDQFLVRRHNGIDIWSVGISIVIALVLYLALIYFFGKKHVN
Ga0193692_1000499113300020000SoilMNERRRIITVIVVVVVYNLVDQFLIQKHRGFNDTSVIISFVIAVVLYLALIYFFGKKHVN
Ga0193696_103227713300020016SoilMNERGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHV
Ga0193696_106907113300020016SoilVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN
Ga0193738_1000010633300020020SoilMSGPYQNYYSLKPIAMHERQRIITVIIVVVVYNLVDQFLVRRHNGIDDWSVGISIVIALVLYLILIYFFGKKHLN
Ga0193738_100286333300020020SoilMQERERIISVIIVVAVYNLVDQFLIRRHNGIDIWSVGISIVIALVLYLALIYFFGKKHVN
Ga0222622_1054769113300022756Groundwater SedimentMKERQRIFTVIIVVIVYNLVDQFLIRKHRGINDMSVIISIAIALILYLALIYFFGKKHLN
Ga0222622_1067624523300022756Groundwater SedimentMNEKGRIITVLIVVVVYNLVDQFLIQQHRGINDTSVIISFVIAVGLYLALIYFFGKKHLN
Ga0247792_105355413300022880SoilMNEKQRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKHMN
Ga0247746_101171133300022886SoilMQERQRIITVVIVVVVYNLVDQFLVRKHNGIDIWSVGISVIIAFVLYLALIYFFGKKHVN
Ga0247795_101789223300022899SoilMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGKKHLN
Ga0247766_100789123300022906Plant LitterMQERERIITVIIVVVVYNLVDQFLLRKHNGIDIWSVGISVVIAFVLYLALIYFFGKKHMN
Ga0247783_100564133300022911Plant LitterMNERQRIITVIIVLIVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0247752_100906023300023071SoilMQERQRIITVVIVVVVYNLVDQFLVRRHHGIDDWSVFISIGIAIVLYLALIYFFGKKHMN
Ga0247748_104701113300023168SoilMQEKQRIISVIIVVAVYNLVDQFLVRRHNGIDIWSVGISVVIAFVLYLALIYFFGKKHVN
Ga0247798_102580923300023260SoilMQEKERIIAVIIAVVIYNLVDQFLVRRHHGIDDWSVFISIAIALVLYLALIYFFGKKHLN
Ga0247784_102985133300023270Plant LitterIITVVIVVVVYNLVDQFLVRKHNGIDIWSVGISVIIAFVLYLALIYFFGKKHMN
Ga0207662_1006441023300025918Switchgrass RhizosphereMNERGRIITVLSVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN
Ga0207701_1075080723300025930Corn, Switchgrass And Miscanthus RhizosphereMHERQRIITVVIVVVVYNLVDQFLVRRHHGIDDWSIGISVVLSLVLYLALIYFFGKKHLN
Ga0207644_1048670823300025931Switchgrass RhizosphereMNERQRIIAVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVGLYLALIYFFGKKHLN
Ga0207670_1184124423300025936Switchgrass RhizosphereEKQRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKHMN
Ga0207704_1042361533300025938Miscanthus RhizosphereFATMNERQRIITVIIVLIVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHLN
Ga0207711_1102781023300025941Switchgrass RhizosphereMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGK
Ga0207712_1001397223300025961Switchgrass RhizosphereMKEKQRIITVIIVVVAYNLVDQFLIRKHRGITDTSVFISFAIALVLYLALIYFFGKKHLN
Ga0207677_1018581513300026023Miscanthus RhizosphereKLFSPKPIAMHERERIITVIIVVIVYNLIDQFLVRRHNGIDDWSVFISIILAVVLYLALIYFFGKKHLN
Ga0207677_1020300123300026023Miscanthus RhizosphereMNEKGRIITVLIVVVVYNLVDQFLIQKQRGINDTSVIISFVIAVGLYLALIYFFGKKHVN
Ga0207676_1088928213300026095Switchgrass RhizosphereTVVIVVVVYNLVDQFLFRSHRGLTISSVFISMVIALVLYLLLIYFFGKKHMN
Ga0209481_1000876423300027880Populus RhizosphereMQERQRIITVVIVVLLFNLVDQFILKFNHGITIWSVIISIVIAGGLYLALIYFFGKKHLN
Ga0268265_1175602213300028380Switchgrass RhizosphereMNEKQRIITVIIVVAVYNLIDQFLIQKYSGINDTSVIISFVIAAVLYLALIYFFGKKHMN
Ga0310888_1056886113300031538SoilMNERQRIITVLIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALI
Ga0310900_1096282013300031908SoilMNEKQRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFF
Ga0310891_1033554013300031913SoilMNERQRIITVLIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAVVLYLALIYFFGKKHVN
Ga0310884_1045386133300031944SoilMQEKQRIITVIIVVLLYNLTDQFLLRRHNGIDIWSVGISVVIAFVLYLILIYFFGKKHMN
Ga0310897_1042675813300032003SoilMNEKQRIITVIIVVAVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKHLN
Ga0310899_1030717813300032017SoilERKRIITVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVTAVVLYLALIYFFGKKHVN
Ga0315910_100000401263300032144SoilMQEKQRLITVVIVVVVYHLVDQFFFRSHRGLTVSSVAISIVLGMVVYLALIYFFGKKHLN
Ga0310896_1033034323300032211SoilMNERKRIITVIIVVVVYNLVDQFLIQKHRGINDTSVIISFVIAAVLYLALIYFFGKKHMN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.