Basic Information | |
---|---|
Family ID | F068962 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 50 residues |
Representative Sequence | GYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.65 % |
% of genes near scaffold ends (potentially truncated) | 87.10 % |
% of genes from short scaffolds (< 2000 bps) | 82.26 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.484 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.484 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.065 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.032 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 3.75% β-sheet: 22.50% Coil/Unstructured: 73.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF12681 | Glyoxalase_2 | 9.68 |
PF00903 | Glyoxalase | 8.06 |
PF09674 | DUF2400 | 3.23 |
PF02954 | HTH_8 | 2.42 |
PF02661 | Fic | 1.61 |
PF02738 | MoCoBD_1 | 1.61 |
PF07519 | Tannase | 0.81 |
PF12833 | HTH_18 | 0.81 |
PF01425 | Amidase | 0.81 |
PF07040 | DUF1326 | 0.81 |
PF00723 | Glyco_hydro_15 | 0.81 |
PF03972 | MmgE_PrpD | 0.81 |
PF12704 | MacB_PCD | 0.81 |
PF00069 | Pkinase | 0.81 |
PF01613 | Flavin_Reduct | 0.81 |
PF13520 | AA_permease_2 | 0.81 |
PF10162 | G8 | 0.81 |
PF05638 | T6SS_HCP | 0.81 |
PF00248 | Aldo_ket_red | 0.81 |
PF04140 | ICMT | 0.81 |
PF01571 | GCV_T | 0.81 |
PF00180 | Iso_dh | 0.81 |
PF03444 | HrcA_DNA-bdg | 0.81 |
PF14559 | TPR_19 | 0.81 |
PF13620 | CarboxypepD_reg | 0.81 |
PF00535 | Glycos_transf_2 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.81 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.81 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.81 |
COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.81 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.48 % |
Unclassified | root | N/A | 14.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001139|JGI10220J13317_11740260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300004081|Ga0063454_100436619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300005093|Ga0062594_101235821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300005330|Ga0070690_101560008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300005336|Ga0070680_101426176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300005340|Ga0070689_100870193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300005355|Ga0070671_100113745 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
3300005367|Ga0070667_100170251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti | 1922 | Open in IMG/M |
3300005440|Ga0070705_100937670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300005441|Ga0070700_100019367 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
3300005458|Ga0070681_10045417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4395 | Open in IMG/M |
3300005526|Ga0073909_10006564 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
3300005529|Ga0070741_11277677 | Not Available | 615 | Open in IMG/M |
3300005535|Ga0070684_100120002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2365 | Open in IMG/M |
3300005542|Ga0070732_10115982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
3300005543|Ga0070672_101224013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300005549|Ga0070704_101296398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300005557|Ga0066704_10859222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 562 | Open in IMG/M |
3300005558|Ga0066698_10638172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300005568|Ga0066703_10160061 | Not Available | 1355 | Open in IMG/M |
3300005575|Ga0066702_10492659 | Not Available | 747 | Open in IMG/M |
3300005577|Ga0068857_102123820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300005578|Ga0068854_102277058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300005618|Ga0068864_102657954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 506 | Open in IMG/M |
3300005764|Ga0066903_102424636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300005764|Ga0066903_107623752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005836|Ga0074470_10677227 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300005842|Ga0068858_101327897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300005842|Ga0068858_102364593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300005843|Ga0068860_100448528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
3300005843|Ga0068860_102713195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300006046|Ga0066652_101355607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
3300006237|Ga0097621_100358682 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300006797|Ga0066659_10600545 | Not Available | 893 | Open in IMG/M |
3300006806|Ga0079220_10906097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300006854|Ga0075425_100001998 | All Organisms → cellular organisms → Bacteria | 20151 | Open in IMG/M |
3300006854|Ga0075425_101046600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
3300006854|Ga0075425_101175589 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300006871|Ga0075434_101085227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
3300006880|Ga0075429_100233904 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300006881|Ga0068865_101505279 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300006903|Ga0075426_10000974 | All Organisms → cellular organisms → Bacteria | 20141 | Open in IMG/M |
3300006903|Ga0075426_10038414 | All Organisms → cellular organisms → Bacteria | 3423 | Open in IMG/M |
3300006903|Ga0075426_10448878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
3300006904|Ga0075424_102760737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300006914|Ga0075436_100063978 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
3300006914|Ga0075436_100228888 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300006914|Ga0075436_101377621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300007265|Ga0099794_10799087 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300009012|Ga0066710_102800056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300009092|Ga0105250_10446935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 580 | Open in IMG/M |
3300009100|Ga0075418_11508471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300009177|Ga0105248_10172028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2441 | Open in IMG/M |
3300009177|Ga0105248_12694777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300009239|Ga0103858_10095770 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300009551|Ga0105238_12632413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300010046|Ga0126384_12060405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300010358|Ga0126370_10322414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1236 | Open in IMG/M |
3300010358|Ga0126370_11051473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300010358|Ga0126370_12208132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300010359|Ga0126376_11491126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300010362|Ga0126377_13061445 | Not Available | 540 | Open in IMG/M |
3300012207|Ga0137381_11804285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300012210|Ga0137378_11092266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300012469|Ga0150984_123660272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300012896|Ga0157303_10104773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300012912|Ga0157306_10075075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300012917|Ga0137395_10785741 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012960|Ga0164301_11767230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300012971|Ga0126369_10621614 | Not Available | 1152 | Open in IMG/M |
3300012972|Ga0134077_10293365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300012988|Ga0164306_11172302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300012989|Ga0164305_11241800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300013296|Ga0157374_11157806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300013297|Ga0157378_12932370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300014269|Ga0075302_1166608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 544 | Open in IMG/M |
3300014968|Ga0157379_12391004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 527 | Open in IMG/M |
3300014969|Ga0157376_11359961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 741 | Open in IMG/M |
3300015371|Ga0132258_12630416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
3300015373|Ga0132257_100976196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
3300016404|Ga0182037_11810721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300017792|Ga0163161_11526571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 587 | Open in IMG/M |
3300025905|Ga0207685_10380746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300025906|Ga0207699_10342770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300025911|Ga0207654_10340337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
3300025912|Ga0207707_11334288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300025917|Ga0207660_11286674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300025920|Ga0207649_10123805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
3300025938|Ga0207704_11671972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 547 | Open in IMG/M |
3300025940|Ga0207691_10982425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300025981|Ga0207640_12190520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300026035|Ga0207703_10308673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
3300026035|Ga0207703_11093632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300026067|Ga0207678_11835631 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300026116|Ga0207674_11239651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 715 | Open in IMG/M |
3300026332|Ga0209803_1314896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300026530|Ga0209807_1236808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300026550|Ga0209474_10474607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300027775|Ga0209177_10089059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
3300027821|Ga0209811_10129562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
3300027903|Ga0209488_10358906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
3300028799|Ga0307284_10393222 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300031226|Ga0307497_10273994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300031226|Ga0307497_10485517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
3300031719|Ga0306917_11492925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300031720|Ga0307469_10910318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300031820|Ga0307473_10870220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 648 | Open in IMG/M |
3300031862|Ga0315280_10022408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6668 | Open in IMG/M |
3300031938|Ga0308175_102914433 | Not Available | 533 | Open in IMG/M |
3300031962|Ga0307479_10713521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
3300032163|Ga0315281_11537176 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300032205|Ga0307472_102463954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300033486|Ga0316624_12202975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.03% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.61% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.61% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.81% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.81% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026492 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5 | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10220J13317_117402602 | 3300001139 | Soil | YDAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGSTMYPGPGCVVPNR* |
Ga0063454_1004366191 | 3300004081 | Soil | GDNGVNAWYDASGYEADDKCAWHNLYQMTNGGFWVQPEFSNGGTVTASGFTATYPRVSSAVGGCVVPNR* |
Ga0062594_1012358211 | 3300005093 | Soil | YEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP* |
Ga0070690_1015600082 | 3300005330 | Switchgrass Rhizosphere | WYDSAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0070680_1014261761 | 3300005336 | Corn Rhizosphere | MISKRRAWHNLYQMTNGGFWVQPEYSNSGTVGSTTYPGPGCVVPNR* |
Ga0070689_1008701932 | 3300005340 | Switchgrass Rhizosphere | VTDPMLNAWFDNAGYEADDKCAWHHLYQMANGGFYVQPEFSNGVLVGGVSYPTPAGCVVP |
Ga0070671_1001137451 | 3300005355 | Switchgrass Rhizosphere | DDAGYEADDKCAWHNLYRMANGGFMVQPEFSNGGVAPYPGPGCVVP* |
Ga0070673_1009132822 | 3300005364 | Switchgrass Rhizosphere | DDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP* |
Ga0070667_1001702513 | 3300005367 | Switchgrass Rhizosphere | SGYEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP* |
Ga0070705_1009376702 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0070700_1000193674 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDPQLNAWYDSQGYEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP* |
Ga0070700_1010709182 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | CAWHNLYRMAEGGFAVQPEYSNGGGTALGGGSYPGPGCVVPILQP* |
Ga0070681_100454171 | 3300005458 | Corn Rhizosphere | YDNAGYEADDKCAWHNLYRMANGGFVVQPEFSNGGGSSPVGVAYPGPGCVVP* |
Ga0073909_100065647 | 3300005526 | Surface Soil | CAWHNLYQTAGSGAWVQPEFSNGNGANPYPGPGCVVPNQ* |
Ga0070741_112776771 | 3300005529 | Surface Soil | ADDKCAWHNLYQITGISAGGFWMQPEFSNGGSAAASGFTATYPGPGCVVPNR* |
Ga0070684_1001200022 | 3300005535 | Corn Rhizosphere | GYEADDKCAWHNLYQMTGGGFWVQPEYSNGGTKNGTSYPGPGCVVPNR* |
Ga0070732_101159823 | 3300005542 | Surface Soil | TDPGDNNVNAWYDAAGDEADDKCAWHNLYQMTNGGFWVQPEYSNGGGSTPSGPYPGPGCVVPNQP* |
Ga0070672_1012240131 | 3300005543 | Miscanthus Rhizosphere | GYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGVVGSSTYPGPGCVKP* |
Ga0070704_1012963982 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DDKCAWHNLYQMTIGGFWVQPEYSNGGTVNRSGFTARYPGPGCVVPSK* |
Ga0066704_108592222 | 3300005557 | Soil | DDKCAWHNLYQMTNGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNR* |
Ga0066698_106381722 | 3300005558 | Soil | ADDKCAWHNLYQTARGHFWVQPEYSNGGGIYPGPGCVVPK* |
Ga0066703_101600612 | 3300005568 | Soil | DGIGYEADDKCAWHNLYQMTRGGFWVQPEYSNGGPNLQYGVIFPGPGCIVPNR* |
Ga0066702_104926592 | 3300005575 | Soil | EADDKCAWHNLYQTAAGNFWVQPEYSNGSPGGVPYPGPGCVVPR* |
Ga0068857_1021238201 | 3300005577 | Corn Rhizosphere | DKCAWHNLYQMTNGGFTVQPEYSNGGTVNGVPYPGPGCVVPNQQP* |
Ga0068854_1022770581 | 3300005578 | Corn Rhizosphere | KCAWHNLYQTSSGHFWVQPEYSNGLAGTPGPGCVVP* |
Ga0068864_1026579542 | 3300005618 | Switchgrass Rhizosphere | DDKCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP* |
Ga0066903_1002051371 | 3300005764 | Tropical Forest Soil | GGFWVQPEYSNGGTTSNSGFTATYPGPGCVVPNR* |
Ga0066903_1024246362 | 3300005764 | Tropical Forest Soil | DKCAWHNLYQMTSGGFWVQPEYSNGGNGYPGPGCVVPNR* |
Ga0066903_1076237521 | 3300005764 | Tropical Forest Soil | LYQTQNGNYWVQPEFSNGGTVNGTSYPGTGCVVPR* |
Ga0074470_106772271 | 3300005836 | Sediment (Intertidal) | PGDSNINAWYDASGYEADDKCAWHNLYQMTKGSFWVQPEFSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0068858_1013278972 | 3300005842 | Switchgrass Rhizosphere | DKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFAATYPAGCIVPNR* |
Ga0068858_1023645931 | 3300005842 | Switchgrass Rhizosphere | GYEADDKCAWHNLYQMTRGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNR* |
Ga0068860_1004485283 | 3300005843 | Switchgrass Rhizosphere | GTAWYDSAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR |
Ga0068860_1027131951 | 3300005843 | Switchgrass Rhizosphere | KCAWHNLYQMTAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH* |
Ga0066652_1013556072 | 3300006046 | Soil | DDKCAWHNLYQTANGGFWVQPEYSNGGNGFPGPGCVVPR* |
Ga0097621_1003586822 | 3300006237 | Miscanthus Rhizosphere | TDPQLNAWYDRSGYEADDKCAWHNLYQMAAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH* |
Ga0066659_106005451 | 3300006797 | Soil | TRGGFWVQPEYSNGGPNLQYGVIFPGPGCIVPNR* |
Ga0079220_109060972 | 3300006806 | Agricultural Soil | WYDSSGYEADDKCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP* |
Ga0075425_10000199819 | 3300006854 | Populus Rhizosphere | TDPGDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGITTFPHGCVVPNR* |
Ga0075425_1010466001 | 3300006854 | Populus Rhizosphere | VNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR* |
Ga0075425_1011755891 | 3300006854 | Populus Rhizosphere | EAVTDPDLDAWYDGAGYEADDKCAWHNLYQTTSGYWVQPEYSNGNSATPYPGPGCVVANK |
Ga0075434_1010852271 | 3300006871 | Populus Rhizosphere | AGYEADDKCAWHNLYQMTRGGYWVQPEYSNGGNSTYPGPGCVVPQ* |
Ga0075429_1002339041 | 3300006880 | Populus Rhizosphere | EADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP* |
Ga0068865_1015052792 | 3300006881 | Miscanthus Rhizosphere | PDLNAWYDSAGYEADDKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFTATYPAGCIVPNR* |
Ga0075426_100009741 | 3300006903 | Populus Rhizosphere | GDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGITTFPHGCVVPNR* |
Ga0075426_100384144 | 3300006903 | Populus Rhizosphere | DAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR* |
Ga0075426_104488781 | 3300006903 | Populus Rhizosphere | GYEADDKCAWHNLYQTANGFWVQPEFSNKDNGCVVP* |
Ga0075424_1027607371 | 3300006904 | Populus Rhizosphere | EADDKCAWHNLYQLNRSAGLNFWVQPEYSNGGGVYPGPGCVKP* |
Ga0075436_1000639783 | 3300006914 | Populus Rhizosphere | DNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR* |
Ga0075436_1002288883 | 3300006914 | Populus Rhizosphere | NAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR* |
Ga0075436_1013776211 | 3300006914 | Populus Rhizosphere | EADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0099794_107990872 | 3300007265 | Vadose Zone Soil | AWYDSQGYEADDKCAWHNLYQMTKGGFWVQPEYSNGTSSPYPGPGCIVPNK* |
Ga0066710_1028000562 | 3300009012 | Grasslands Soil | SHEIREAVTDPGDNNVNAWYDAVGYEADDKCAWHNLYQMTHGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR |
Ga0105250_104469351 | 3300009092 | Switchgrass Rhizosphere | AWYDDQGYEADDKCAWHNLYQMAEGGFRVQPEYSNGGGQAPGDGLPYPGAGCVVPPQ* |
Ga0075418_115084712 | 3300009100 | Populus Rhizosphere | DPQLNAWYDSDGYEADDKCAWHNLYRMAEGGFAVQPEYSNGGGKYPGPGCVVP* |
Ga0105248_101720281 | 3300009177 | Switchgrass Rhizosphere | LGTAWYDSSGYEADDKYAWHNLYQMTNDGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0105248_126947771 | 3300009177 | Switchgrass Rhizosphere | KCAWHNLYQMSGGGYWVQPEYSNGGTKNGTTYPGPGCVVPNR* |
Ga0103858_100957702 | 3300009239 | River Water | PDLNAWYDASGYEADDKCAWHNLYRTTNGSFWVQPEYSNGGGTRPGASGSYPGPGCVVPNR* |
Ga0105238_126324132 | 3300009551 | Corn Rhizosphere | YEADDKCAWHNLYQTANGFWVQPEFSNKDNGCVVP* |
Ga0126384_120604052 | 3300010046 | Tropical Forest Soil | WFDAAGYEADDKCAWHNLYQTASGHFWVQPEYSNGLSGNPGPGCIVP* |
Ga0126321_14728731 | 3300010145 | Soil | GGFWVQPEYSNGGTVNRSGFTATYPGPGCVVPNR* |
Ga0126370_103224142 | 3300010358 | Tropical Forest Soil | DAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGSATYPGPGCVVPNR* |
Ga0126370_110514731 | 3300010358 | Tropical Forest Soil | DAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGNVTYPGQGCIVPNR* |
Ga0126370_122081321 | 3300010358 | Tropical Forest Soil | DKCAWQHLYQTANGNYWVQPEFSNGGTVGGKTYPGPGCVVPR* |
Ga0126376_114911262 | 3300010359 | Tropical Forest Soil | WHNLYQMTNGGFLGQSEYSNGGTVGSATYPAPGCVVPNR* |
Ga0126377_130614452 | 3300010362 | Tropical Forest Soil | YEADDKCAWHNLYQTTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNP* |
Ga0134125_100479221 | 3300010371 | Terrestrial Soil | NLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0137381_118042851 | 3300012207 | Vadose Zone Soil | IREAVSDSLGTAWFDASGYEADDKCAWHNLYQMTSGGFWVQPEFSNGGTRTASGFTATYPGPGCIVPNR* |
Ga0137378_110922661 | 3300012210 | Vadose Zone Soil | DNGVNAWYDAAGYEADDKCAWHNLYQMSNGGFWVQPEYSNGGTVTASGFSATYPGPGCVVPNR* |
Ga0150985_1037061873 | 3300012212 | Avena Fatua Rhizosphere | LYQMSNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0150984_1236602722 | 3300012469 | Avena Fatua Rhizosphere | WYDSTGREADDKCAWHNLYQMSNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0157303_101047731 | 3300012896 | Soil | KCAWHNLYQMSNGGFWVQPEYSNGGIVTASGFTATYKKGCVVPNR* |
Ga0157306_100750751 | 3300012912 | Soil | DALGTAWYDAAGYEADDKCAWHNLYQMTTGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0137395_107857411 | 3300012917 | Vadose Zone Soil | SNANAWYDRRGYEADDKCAWHNLYQLNRPAGLNFWVQPEYSNGGTVGTTTYPGSGCVVP* |
Ga0153915_126317031 | 3300012931 | Freshwater Wetlands | LYQMANGAFWVQPEYSNGGSANAVSTASYPGPGCVKP* |
Ga0164301_117672302 | 3300012960 | Soil | TDPDLNAWYDSVGYEADDKCAWHNLYQMSSGGFWVQPEYSNGLSGKPGPGCIVP* |
Ga0153916_102096671 | 3300012964 | Freshwater Wetlands | QMTNGGFWVQPEYSNGGTTTASGFTATYPGPGCVVPNK* |
Ga0126369_106216141 | 3300012971 | Tropical Forest Soil | AWYDASGYEADDKCAWHNLYQMTTGGFWVQPEYSNGGTVTRSGFKATYPGPGCVVPNR* |
Ga0134077_102933652 | 3300012972 | Grasslands Soil | VYDAAGYEADDKCAWHNLYRTTNGGFWVQPEYSNGGNSTYPGPGCVVPQ* |
Ga0164306_111723022 | 3300012988 | Soil | GYEADDKCAWHNLYQMTAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH* |
Ga0164305_112418001 | 3300012989 | Soil | ADDKCAWHNLYQMSSGGFWVQPEYSNGLSGKPGPGCIVP* |
Ga0157374_111578062 | 3300013296 | Miscanthus Rhizosphere | YDDQGYEADDKCAWLNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP* |
Ga0157378_129323701 | 3300013297 | Miscanthus Rhizosphere | DKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0075302_11666082 | 3300014269 | Natural And Restored Wetlands | EADDKCAWHNLYRMSDGGFAVQPEYSNGGTVGGVSYPGPGCAVPIQ* |
Ga0163163_119315852 | 3300014325 | Switchgrass Rhizosphere | GGFWVQPEFSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0157379_123910041 | 3300014968 | Switchgrass Rhizosphere | QGYEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP* |
Ga0157376_113599612 | 3300014969 | Miscanthus Rhizosphere | AWFDIQGYEADDKCAWHNLYQTTTGGYWVQPEYSNGNGNNPYPGPGCVVPN* |
Ga0132258_126304161 | 3300015371 | Arabidopsis Rhizosphere | WHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR* |
Ga0132257_1009761962 | 3300015373 | Arabidopsis Rhizosphere | CAWHNLYQTATGNYWVQPEYSNGGNSTYPGPGCVVPR* |
Ga0182037_118107211 | 3300016404 | Soil | AGYEADDKCAWHNLYQTANGGFWVQPEFSNGTAAPYPGPGCVVPK |
Ga0163161_115265712 | 3300017792 | Switchgrass Rhizosphere | FDNAGYEADDKCAWHHLYQMANGGFYVQPEFSNGGLVGGVSYPTPAGCVVP |
Ga0182022_10124021 | 3300019785 | Fen | TICMYQTTRGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNK |
Ga0207685_103807462 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGGTVTRGGVTATYPGPGCVVPNR |
Ga0207699_103427702 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ITDPVNAWWESSSGYEADDKCAWHNLYQQTGGAWVQPEYSNGLTRNGSTFPQHGCVVPNR |
Ga0207654_103403371 | 3300025911 | Corn Rhizosphere | MISKRRAWHNLYQMTNGGFWVQPEYSNSGTVGSTTYPGPGCVVPNR |
Ga0207707_113342882 | 3300025912 | Corn Rhizosphere | YEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP |
Ga0207660_112866741 | 3300025917 | Corn Rhizosphere | DDKCAWHNLYRMADGGFAVQPEYSNGGGTAPGGGSYPGPGCIVPVPQP |
Ga0207649_101238051 | 3300025920 | Corn Rhizosphere | TDSLGTAWYDAQGYEADDKCAWHNLYQMTGGGFWVQPEYSNGGTKNGTSYPGPGCVVPNR |
Ga0207704_116719721 | 3300025938 | Miscanthus Rhizosphere | DDKCVWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP |
Ga0207691_109824252 | 3300025940 | Miscanthus Rhizosphere | GEFNKNAWYDKVGYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGVVGSSTYPGPGCVK |
Ga0207640_121905201 | 3300025981 | Corn Rhizosphere | KCAWHNLYQTSSGHFWVQPEYSNGLAGTPGPGCVVP |
Ga0207703_103086732 | 3300026035 | Switchgrass Rhizosphere | VTDPQLNAWYDSQGYEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPL |
Ga0207703_110936321 | 3300026035 | Switchgrass Rhizosphere | ADDKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFAATYPAGCIVPNR |
Ga0207678_118356311 | 3300026067 | Corn Rhizosphere | GYEADDKCAWHNLYRTTGTGYWVQPEYSNGSADGKYPGPGCVVPNQ |
Ga0207674_112396511 | 3300026116 | Corn Rhizosphere | DKCAWHNLYQMTNGGFTVQPEYSNGGTVNGVPYPGPGCVVPNQQP |
Ga0209803_13148961 | 3300026332 | Soil | DDKCAWHNLYQMTRGNYWVQPEYSNGGNSTYPGPGCVVPQ |
Ga0256802_10167712 | 3300026492 | Sediment | NLYRTNNGGFWVQPEYSNGGSVKASGFTATYPGPGCVVP |
Ga0209807_12368081 | 3300026530 | Soil | EIREAVTDPGDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR |
Ga0209474_104746072 | 3300026550 | Soil | DDKCAWHNLYQMTRGGFWVQPEYSNGGGGYPGPGCFVPNR |
Ga0209177_100890592 | 3300027775 | Agricultural Soil | KCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP |
Ga0209811_101295621 | 3300027821 | Surface Soil | DPDLNAWYDSAGYEADDKCAWHNLYQTAGSGAWVQPEFSNGNGANPYPGPGCVVPNQ |
Ga0209488_103589063 | 3300027903 | Vadose Zone Soil | AWYDAAGYEADDKCVWHNLYQMTTGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR |
Ga0307284_103932221 | 3300028799 | Soil | WHNLYQMTRGGFWVQPEYSNGGGKYPGPGCFVPNR |
Ga0307497_102739942 | 3300031226 | Soil | GYEADDKCAWHNLYRMANGGFVVQPEFSNSGAAPYPGSGCVVANPPPLP |
Ga0307497_104855172 | 3300031226 | Soil | PDLNAWFDSSGYEADDKCAWHNLYQTGSGFWVQPEFSNGNGAKPYPGPGCVVPNQ |
Ga0306917_114929251 | 3300031719 | Soil | CAWQNLYRTTSGGYWVQPEFSNGGTKNGTSYPGPGCVVPR |
Ga0307469_109103181 | 3300031720 | Hardwood Forest Soil | YEADDKCAWHNLYRMAEGGFAVQPEYSNGGGTAPGGGSYPGAGCVVPIPQP |
Ga0307473_108702202 | 3300031820 | Hardwood Forest Soil | DPGESNKSTWYDQSGYEADDKCAWHNLYQLNRTTGLNFWVQPEYSNGGNGYPGPGCVKP |
Ga0315280_100224082 | 3300031862 | Sediment | MLTIVSSHEIREAVTDPGDNNANGWYDAAGYEGDDKCVWHNLYQMTRGGFWVQPEFSNGGTVTASGFTTTYPSASPGVGGCVVPNR |
Ga0308175_1029144332 | 3300031938 | Soil | DEADDKCVWHNLYKMANGGFWVQPEYSNGGQVTASGFTTTYPGPGCIVP |
Ga0307479_107135211 | 3300031962 | Hardwood Forest Soil | ESNKNAWYDQSGYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGSGYPGPGCVRP |
Ga0315281_115371762 | 3300032163 | Sediment | GYEADDKCAWHNLYQMTTGGFWVQPEFSNGGTVTRSGFTATYPGPGCIVPNR |
Ga0307472_1024639542 | 3300032205 | Hardwood Forest Soil | AVGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR |
Ga0316624_122029751 | 3300033486 | Soil | AWYDSAGYEADDKCAWHFLYQMTNSMFWVQPEYSNGGNTSASGFNATYPGPGCVVPNK |
⦗Top⦘ |