NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068962

Metagenome / Metatranscriptome Family F068962

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068962
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 50 residues
Representative Sequence GYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR
Number of Associated Samples 108
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.65 %
% of genes near scaffold ends (potentially truncated) 87.10 %
% of genes from short scaffolds (< 2000 bps) 82.26 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.484 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.484 % of family members)
Environment Ontology (ENVO) Unclassified
(33.065 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.032 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.75%    β-sheet: 22.50%    Coil/Unstructured: 73.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF12681Glyoxalase_2 9.68
PF00903Glyoxalase 8.06
PF09674DUF2400 3.23
PF02954HTH_8 2.42
PF02661Fic 1.61
PF02738MoCoBD_1 1.61
PF07519Tannase 0.81
PF12833HTH_18 0.81
PF01425Amidase 0.81
PF07040DUF1326 0.81
PF00723Glyco_hydro_15 0.81
PF03972MmgE_PrpD 0.81
PF12704MacB_PCD 0.81
PF00069Pkinase 0.81
PF01613Flavin_Reduct 0.81
PF13520AA_permease_2 0.81
PF10162G8 0.81
PF05638T6SS_HCP 0.81
PF00248Aldo_ket_red 0.81
PF04140ICMT 0.81
PF01571GCV_T 0.81
PF00180Iso_dh 0.81
PF03444HrcA_DNA-bdg 0.81
PF14559TPR_19 0.81
PF13620CarboxypepD_reg 0.81
PF00535Glycos_transf_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.23
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.81
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.81
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.81
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.81
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.81
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.81
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.48 %
UnclassifiedrootN/A14.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001139|JGI10220J13317_11740260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300004081|Ga0063454_100436619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300005093|Ga0062594_101235821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300005330|Ga0070690_101560008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300005336|Ga0070680_101426176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300005340|Ga0070689_100870193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300005355|Ga0070671_100113745All Organisms → cellular organisms → Bacteria2274Open in IMG/M
3300005367|Ga0070667_100170251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium loti1922Open in IMG/M
3300005440|Ga0070705_100937670All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300005441|Ga0070700_100019367All Organisms → cellular organisms → Bacteria3927Open in IMG/M
3300005458|Ga0070681_10045417All Organisms → cellular organisms → Bacteria → Proteobacteria4395Open in IMG/M
3300005526|Ga0073909_10006564All Organisms → cellular organisms → Bacteria3457Open in IMG/M
3300005529|Ga0070741_11277677Not Available615Open in IMG/M
3300005535|Ga0070684_100120002All Organisms → cellular organisms → Bacteria → Acidobacteria2365Open in IMG/M
3300005542|Ga0070732_10115982All Organisms → cellular organisms → Bacteria → Acidobacteria1584Open in IMG/M
3300005543|Ga0070672_101224013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300005549|Ga0070704_101296398All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300005557|Ga0066704_10859222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21562Open in IMG/M
3300005558|Ga0066698_10638172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300005568|Ga0066703_10160061Not Available1355Open in IMG/M
3300005575|Ga0066702_10492659Not Available747Open in IMG/M
3300005577|Ga0068857_102123820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300005578|Ga0068854_102277058All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300005618|Ga0068864_102657954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15506Open in IMG/M
3300005764|Ga0066903_102424636All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300005764|Ga0066903_107623752All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300005836|Ga0074470_10677227All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005842|Ga0068858_101327897All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300005842|Ga0068858_102364593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300005843|Ga0068860_100448528All Organisms → cellular organisms → Bacteria → Acidobacteria1282Open in IMG/M
3300005843|Ga0068860_102713195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300006046|Ga0066652_101355607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300006237|Ga0097621_100358682All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300006797|Ga0066659_10600545Not Available893Open in IMG/M
3300006806|Ga0079220_10906097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300006854|Ga0075425_100001998All Organisms → cellular organisms → Bacteria20151Open in IMG/M
3300006854|Ga0075425_101046600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300006854|Ga0075425_101175589All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300006871|Ga0075434_101085227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300006880|Ga0075429_100233904All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300006881|Ga0068865_101505279All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300006903|Ga0075426_10000974All Organisms → cellular organisms → Bacteria20141Open in IMG/M
3300006903|Ga0075426_10038414All Organisms → cellular organisms → Bacteria3423Open in IMG/M
3300006903|Ga0075426_10448878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300006904|Ga0075424_102760737All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300006914|Ga0075436_100063978All Organisms → cellular organisms → Bacteria2542Open in IMG/M
3300006914|Ga0075436_100228888All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300006914|Ga0075436_101377621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300007265|Ga0099794_10799087All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300009012|Ga0066710_102800056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300009092|Ga0105250_10446935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15580Open in IMG/M
3300009100|Ga0075418_11508471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300009177|Ga0105248_10172028All Organisms → cellular organisms → Bacteria → Acidobacteria2441Open in IMG/M
3300009177|Ga0105248_12694777All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300009239|Ga0103858_10095770All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300009551|Ga0105238_12632413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300010046|Ga0126384_12060405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300010358|Ga0126370_10322414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1236Open in IMG/M
3300010358|Ga0126370_11051473All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300010358|Ga0126370_12208132All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300010359|Ga0126376_11491126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300010362|Ga0126377_13061445Not Available540Open in IMG/M
3300012207|Ga0137381_11804285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300012210|Ga0137378_11092266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300012469|Ga0150984_123660272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300012896|Ga0157303_10104773All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300012912|Ga0157306_10075075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300012917|Ga0137395_10785741All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012960|Ga0164301_11767230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300012971|Ga0126369_10621614Not Available1152Open in IMG/M
3300012972|Ga0134077_10293365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300012988|Ga0164306_11172302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300012989|Ga0164305_11241800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300013296|Ga0157374_11157806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300013297|Ga0157378_12932370All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300014269|Ga0075302_1166608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15544Open in IMG/M
3300014968|Ga0157379_12391004All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15527Open in IMG/M
3300014969|Ga0157376_11359961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21741Open in IMG/M
3300015371|Ga0132258_12630416All Organisms → cellular organisms → Bacteria → Acidobacteria1257Open in IMG/M
3300015373|Ga0132257_100976196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300016404|Ga0182037_11810721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300017792|Ga0163161_11526571All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15587Open in IMG/M
3300025905|Ga0207685_10380746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300025906|Ga0207699_10342770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1053Open in IMG/M
3300025911|Ga0207654_10340337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300025912|Ga0207707_11334288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300025917|Ga0207660_11286674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300025920|Ga0207649_10123805All Organisms → cellular organisms → Bacteria → Acidobacteria1747Open in IMG/M
3300025938|Ga0207704_11671972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15547Open in IMG/M
3300025940|Ga0207691_10982425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300025981|Ga0207640_12190520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300026035|Ga0207703_10308673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1445Open in IMG/M
3300026035|Ga0207703_11093632All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300026067|Ga0207678_11835631All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300026116|Ga0207674_11239651All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15715Open in IMG/M
3300026332|Ga0209803_1314896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300026530|Ga0209807_1236808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300026550|Ga0209474_10474607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300027775|Ga0209177_10089059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300027821|Ga0209811_10129562All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300027903|Ga0209488_10358906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300028799|Ga0307284_10393222All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031226|Ga0307497_10273994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300031226|Ga0307497_10485517All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300031719|Ga0306917_11492925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300031720|Ga0307469_10910318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300031820|Ga0307473_10870220All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium648Open in IMG/M
3300031862|Ga0315280_10022408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium6668Open in IMG/M
3300031938|Ga0308175_102914433Not Available533Open in IMG/M
3300031962|Ga0307479_10713521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300032163|Ga0315281_11537176All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300032205|Ga0307472_102463954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300033486|Ga0316624_12202975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.03%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.23%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.61%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.61%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.81%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.81%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10220J13317_1174026023300001139SoilYDAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGSTMYPGPGCVVPNR*
Ga0063454_10043661913300004081SoilGDNGVNAWYDASGYEADDKCAWHNLYQMTNGGFWVQPEFSNGGTVTASGFTATYPRVSSAVGGCVVPNR*
Ga0062594_10123582113300005093SoilYEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP*
Ga0070690_10156000823300005330Switchgrass RhizosphereWYDSAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0070680_10142617613300005336Corn RhizosphereMISKRRAWHNLYQMTNGGFWVQPEYSNSGTVGSTTYPGPGCVVPNR*
Ga0070689_10087019323300005340Switchgrass RhizosphereVTDPMLNAWFDNAGYEADDKCAWHHLYQMANGGFYVQPEFSNGVLVGGVSYPTPAGCVVP
Ga0070671_10011374513300005355Switchgrass RhizosphereDDAGYEADDKCAWHNLYRMANGGFMVQPEFSNGGVAPYPGPGCVVP*
Ga0070673_10091328223300005364Switchgrass RhizosphereDDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP*
Ga0070667_10017025133300005367Switchgrass RhizosphereSGYEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP*
Ga0070705_10093767023300005440Corn, Switchgrass And Miscanthus RhizosphereGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0070700_10001936743300005441Corn, Switchgrass And Miscanthus RhizosphereVTDPQLNAWYDSQGYEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP*
Ga0070700_10107091823300005441Corn, Switchgrass And Miscanthus RhizosphereCAWHNLYRMAEGGFAVQPEYSNGGGTALGGGSYPGPGCVVPILQP*
Ga0070681_1004541713300005458Corn RhizosphereYDNAGYEADDKCAWHNLYRMANGGFVVQPEFSNGGGSSPVGVAYPGPGCVVP*
Ga0073909_1000656473300005526Surface SoilCAWHNLYQTAGSGAWVQPEFSNGNGANPYPGPGCVVPNQ*
Ga0070741_1127767713300005529Surface SoilADDKCAWHNLYQITGISAGGFWMQPEFSNGGSAAASGFTATYPGPGCVVPNR*
Ga0070684_10012000223300005535Corn RhizosphereGYEADDKCAWHNLYQMTGGGFWVQPEYSNGGTKNGTSYPGPGCVVPNR*
Ga0070732_1011598233300005542Surface SoilTDPGDNNVNAWYDAAGDEADDKCAWHNLYQMTNGGFWVQPEYSNGGGSTPSGPYPGPGCVVPNQP*
Ga0070672_10122401313300005543Miscanthus RhizosphereGYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGVVGSSTYPGPGCVKP*
Ga0070704_10129639823300005549Corn, Switchgrass And Miscanthus RhizosphereDDKCAWHNLYQMTIGGFWVQPEYSNGGTVNRSGFTARYPGPGCVVPSK*
Ga0066704_1085922223300005557SoilDDKCAWHNLYQMTNGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNR*
Ga0066698_1063817223300005558SoilADDKCAWHNLYQTARGHFWVQPEYSNGGGIYPGPGCVVPK*
Ga0066703_1016006123300005568SoilDGIGYEADDKCAWHNLYQMTRGGFWVQPEYSNGGPNLQYGVIFPGPGCIVPNR*
Ga0066702_1049265923300005575SoilEADDKCAWHNLYQTAAGNFWVQPEYSNGSPGGVPYPGPGCVVPR*
Ga0068857_10212382013300005577Corn RhizosphereDKCAWHNLYQMTNGGFTVQPEYSNGGTVNGVPYPGPGCVVPNQQP*
Ga0068854_10227705813300005578Corn RhizosphereKCAWHNLYQTSSGHFWVQPEYSNGLAGTPGPGCVVP*
Ga0068864_10265795423300005618Switchgrass RhizosphereDDKCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP*
Ga0066903_10020513713300005764Tropical Forest SoilGGFWVQPEYSNGGTTSNSGFTATYPGPGCVVPNR*
Ga0066903_10242463623300005764Tropical Forest SoilDKCAWHNLYQMTSGGFWVQPEYSNGGNGYPGPGCVVPNR*
Ga0066903_10762375213300005764Tropical Forest SoilLYQTQNGNYWVQPEFSNGGTVNGTSYPGTGCVVPR*
Ga0074470_1067722713300005836Sediment (Intertidal)PGDSNINAWYDASGYEADDKCAWHNLYQMTKGSFWVQPEFSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0068858_10132789723300005842Switchgrass RhizosphereDKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFAATYPAGCIVPNR*
Ga0068858_10236459313300005842Switchgrass RhizosphereGYEADDKCAWHNLYQMTRGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNR*
Ga0068860_10044852833300005843Switchgrass RhizosphereGTAWYDSAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR
Ga0068860_10271319513300005843Switchgrass RhizosphereKCAWHNLYQMTAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH*
Ga0066652_10135560723300006046SoilDDKCAWHNLYQTANGGFWVQPEYSNGGNGFPGPGCVVPR*
Ga0097621_10035868223300006237Miscanthus RhizosphereTDPQLNAWYDRSGYEADDKCAWHNLYQMAAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH*
Ga0066659_1060054513300006797SoilTRGGFWVQPEYSNGGPNLQYGVIFPGPGCIVPNR*
Ga0079220_1090609723300006806Agricultural SoilWYDSSGYEADDKCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP*
Ga0075425_100001998193300006854Populus RhizosphereTDPGDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGITTFPHGCVVPNR*
Ga0075425_10104660013300006854Populus RhizosphereVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR*
Ga0075425_10117558913300006854Populus RhizosphereEAVTDPDLDAWYDGAGYEADDKCAWHNLYQTTSGYWVQPEYSNGNSATPYPGPGCVVANK
Ga0075434_10108522713300006871Populus RhizosphereAGYEADDKCAWHNLYQMTRGGYWVQPEYSNGGNSTYPGPGCVVPQ*
Ga0075429_10023390413300006880Populus RhizosphereEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP*
Ga0068865_10150527923300006881Miscanthus RhizospherePDLNAWYDSAGYEADDKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFTATYPAGCIVPNR*
Ga0075426_1000097413300006903Populus RhizosphereGDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGITTFPHGCVVPNR*
Ga0075426_1003841443300006903Populus RhizosphereDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR*
Ga0075426_1044887813300006903Populus RhizosphereGYEADDKCAWHNLYQTANGFWVQPEFSNKDNGCVVP*
Ga0075424_10276073713300006904Populus RhizosphereEADDKCAWHNLYQLNRSAGLNFWVQPEYSNGGGVYPGPGCVKP*
Ga0075436_10006397833300006914Populus RhizosphereDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR*
Ga0075436_10022888833300006914Populus RhizosphereNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR*
Ga0075436_10137762113300006914Populus RhizosphereEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0099794_1079908723300007265Vadose Zone SoilAWYDSQGYEADDKCAWHNLYQMTKGGFWVQPEYSNGTSSPYPGPGCIVPNK*
Ga0066710_10280005623300009012Grasslands SoilSHEIREAVTDPGDNNVNAWYDAVGYEADDKCAWHNLYQMTHGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR
Ga0105250_1044693513300009092Switchgrass RhizosphereAWYDDQGYEADDKCAWHNLYQMAEGGFRVQPEYSNGGGQAPGDGLPYPGAGCVVPPQ*
Ga0075418_1150847123300009100Populus RhizosphereDPQLNAWYDSDGYEADDKCAWHNLYRMAEGGFAVQPEYSNGGGKYPGPGCVVP*
Ga0105248_1017202813300009177Switchgrass RhizosphereLGTAWYDSSGYEADDKYAWHNLYQMTNDGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0105248_1269477713300009177Switchgrass RhizosphereKCAWHNLYQMSGGGYWVQPEYSNGGTKNGTTYPGPGCVVPNR*
Ga0103858_1009577023300009239River WaterPDLNAWYDASGYEADDKCAWHNLYRTTNGSFWVQPEYSNGGGTRPGASGSYPGPGCVVPNR*
Ga0105238_1263241323300009551Corn RhizosphereYEADDKCAWHNLYQTANGFWVQPEFSNKDNGCVVP*
Ga0126384_1206040523300010046Tropical Forest SoilWFDAAGYEADDKCAWHNLYQTASGHFWVQPEYSNGLSGNPGPGCIVP*
Ga0126321_147287313300010145SoilGGFWVQPEYSNGGTVNRSGFTATYPGPGCVVPNR*
Ga0126370_1032241423300010358Tropical Forest SoilDAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGSATYPGPGCVVPNR*
Ga0126370_1105147313300010358Tropical Forest SoilDAAGYEADDKCAWHNLYQMTNGGFWVQPEYSNGGTVGNVTYPGQGCIVPNR*
Ga0126370_1220813213300010358Tropical Forest SoilDKCAWQHLYQTANGNYWVQPEFSNGGTVGGKTYPGPGCVVPR*
Ga0126376_1149112623300010359Tropical Forest SoilWHNLYQMTNGGFLGQSEYSNGGTVGSATYPAPGCVVPNR*
Ga0126377_1306144523300010362Tropical Forest SoilYEADDKCAWHNLYQTTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNP*
Ga0134125_1004792213300010371Terrestrial SoilNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0137381_1180428513300012207Vadose Zone SoilIREAVSDSLGTAWFDASGYEADDKCAWHNLYQMTSGGFWVQPEFSNGGTRTASGFTATYPGPGCIVPNR*
Ga0137378_1109226613300012210Vadose Zone SoilDNGVNAWYDAAGYEADDKCAWHNLYQMSNGGFWVQPEYSNGGTVTASGFSATYPGPGCVVPNR*
Ga0150985_10370618733300012212Avena Fatua RhizosphereLYQMSNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0150984_12366027223300012469Avena Fatua RhizosphereWYDSTGREADDKCAWHNLYQMSNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0157303_1010477313300012896SoilKCAWHNLYQMSNGGFWVQPEYSNGGIVTASGFTATYKKGCVVPNR*
Ga0157306_1007507513300012912SoilDALGTAWYDAAGYEADDKCAWHNLYQMTTGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0137395_1078574113300012917Vadose Zone SoilSNANAWYDRRGYEADDKCAWHNLYQLNRPAGLNFWVQPEYSNGGTVGTTTYPGSGCVVP*
Ga0153915_1263170313300012931Freshwater WetlandsLYQMANGAFWVQPEYSNGGSANAVSTASYPGPGCVKP*
Ga0164301_1176723023300012960SoilTDPDLNAWYDSVGYEADDKCAWHNLYQMSSGGFWVQPEYSNGLSGKPGPGCIVP*
Ga0153916_1020966713300012964Freshwater WetlandsQMTNGGFWVQPEYSNGGTTTASGFTATYPGPGCVVPNK*
Ga0126369_1062161413300012971Tropical Forest SoilAWYDASGYEADDKCAWHNLYQMTTGGFWVQPEYSNGGTVTRSGFKATYPGPGCVVPNR*
Ga0134077_1029336523300012972Grasslands SoilVYDAAGYEADDKCAWHNLYRTTNGGFWVQPEYSNGGNSTYPGPGCVVPQ*
Ga0164306_1117230223300012988SoilGYEADDKCAWHNLYQMTAGGFWVQPEYSNGGTVTASGFTASYPHGCVVPNQGTTSQRPH*
Ga0164305_1124180013300012989SoilADDKCAWHNLYQMSSGGFWVQPEYSNGLSGKPGPGCIVP*
Ga0157374_1115780623300013296Miscanthus RhizosphereYDDQGYEADDKCAWLNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP*
Ga0157378_1293237013300013297Miscanthus RhizosphereDKCAWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0075302_116660823300014269Natural And Restored WetlandsEADDKCAWHNLYRMSDGGFAVQPEYSNGGTVGGVSYPGPGCAVPIQ*
Ga0163163_1193158523300014325Switchgrass RhizosphereGGFWVQPEFSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0157379_1239100413300014968Switchgrass RhizosphereQGYEADDKCAWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP*
Ga0157376_1135996123300014969Miscanthus RhizosphereAWFDIQGYEADDKCAWHNLYQTTTGGYWVQPEYSNGNGNNPYPGPGCVVPN*
Ga0132258_1263041613300015371Arabidopsis RhizosphereWHNLYQMTNGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR*
Ga0132257_10097619623300015373Arabidopsis RhizosphereCAWHNLYQTATGNYWVQPEYSNGGNSTYPGPGCVVPR*
Ga0182037_1181072113300016404SoilAGYEADDKCAWHNLYQTANGGFWVQPEFSNGTAAPYPGPGCVVPK
Ga0163161_1152657123300017792Switchgrass RhizosphereFDNAGYEADDKCAWHHLYQMANGGFYVQPEFSNGGLVGGVSYPTPAGCVVP
Ga0182022_101240213300019785FenTICMYQTTRGGFWVQPEYSNGGTRTASGFTATYPGPGCVVPNK
Ga0207685_1038074623300025905Corn, Switchgrass And Miscanthus RhizosphereVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGGTVTRGGVTATYPGPGCVVPNR
Ga0207699_1034277023300025906Corn, Switchgrass And Miscanthus RhizosphereITDPVNAWWESSSGYEADDKCAWHNLYQQTGGAWVQPEYSNGLTRNGSTFPQHGCVVPNR
Ga0207654_1034033713300025911Corn RhizosphereMISKRRAWHNLYQMTNGGFWVQPEYSNSGTVGSTTYPGPGCVVPNR
Ga0207707_1133428823300025912Corn RhizosphereYEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPLP
Ga0207660_1128667413300025917Corn RhizosphereDDKCAWHNLYRMADGGFAVQPEYSNGGGTAPGGGSYPGPGCIVPVPQP
Ga0207649_1012380513300025920Corn RhizosphereTDSLGTAWYDAQGYEADDKCAWHNLYQMTGGGFWVQPEYSNGGTKNGTSYPGPGCVVPNR
Ga0207704_1167197213300025938Miscanthus RhizosphereDDKCVWHNLYRMAEGGFMVQPEYSNGGGPAPGGGSYPGPGCVVPNQQP
Ga0207691_1098242523300025940Miscanthus RhizosphereGEFNKNAWYDKVGYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGVVGSSTYPGPGCVK
Ga0207640_1219052013300025981Corn RhizosphereKCAWHNLYQTSSGHFWVQPEYSNGLAGTPGPGCVVP
Ga0207703_1030867323300026035Switchgrass RhizosphereVTDPQLNAWYDSQGYEADDKCAWHNLYHMAEGGFVVQPEFSNGGGAYPGPGCIVPNPPPL
Ga0207703_1109363213300026035Switchgrass RhizosphereADDKCAWHNLYQINNGSFWVQPEYSNGGTVTRSGFAATYPAGCIVPNR
Ga0207678_1183563113300026067Corn RhizosphereGYEADDKCAWHNLYRTTGTGYWVQPEYSNGSADGKYPGPGCVVPNQ
Ga0207674_1123965113300026116Corn RhizosphereDKCAWHNLYQMTNGGFTVQPEYSNGGTVNGVPYPGPGCVVPNQQP
Ga0209803_131489613300026332SoilDDKCAWHNLYQMTRGNYWVQPEYSNGGNSTYPGPGCVVPQ
Ga0256802_101677123300026492SedimentNLYRTNNGGFWVQPEYSNGGSVKASGFTATYPGPGCVVP
Ga0209807_123680813300026530SoilEIREAVTDPGDNGVNAWYDAAGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR
Ga0209474_1047460723300026550SoilDDKCAWHNLYQMTRGGFWVQPEYSNGGGGYPGPGCFVPNR
Ga0209177_1008905923300027775Agricultural SoilKCAWHHLYQMADGGFWVQPEYSNGDGNIYPGAGCVVP
Ga0209811_1012956213300027821Surface SoilDPDLNAWYDSAGYEADDKCAWHNLYQTAGSGAWVQPEFSNGNGANPYPGPGCVVPNQ
Ga0209488_1035890633300027903Vadose Zone SoilAWYDAAGYEADDKCVWHNLYQMTTGGFWVQPEYSNGGTVTRSGFTATYPGPGCVVPNR
Ga0307284_1039322213300028799SoilWHNLYQMTRGGFWVQPEYSNGGGKYPGPGCFVPNR
Ga0307497_1027399423300031226SoilGYEADDKCAWHNLYRMANGGFVVQPEFSNSGAAPYPGSGCVVANPPPLP
Ga0307497_1048551723300031226SoilPDLNAWFDSSGYEADDKCAWHNLYQTGSGFWVQPEFSNGNGAKPYPGPGCVVPNQ
Ga0306917_1149292513300031719SoilCAWQNLYRTTSGGYWVQPEFSNGGTKNGTSYPGPGCVVPR
Ga0307469_1091031813300031720Hardwood Forest SoilYEADDKCAWHNLYRMAEGGFAVQPEYSNGGGTAPGGGSYPGAGCVVPIPQP
Ga0307473_1087022023300031820Hardwood Forest SoilDPGESNKSTWYDQSGYEADDKCAWHNLYQLNRTTGLNFWVQPEYSNGGNGYPGPGCVKP
Ga0315280_1002240823300031862SedimentMLTIVSSHEIREAVTDPGDNNANGWYDAAGYEGDDKCVWHNLYQMTRGGFWVQPEFSNGGTVTASGFTTTYPSASPGVGGCVVPNR
Ga0308175_10291443323300031938SoilDEADDKCVWHNLYKMANGGFWVQPEYSNGGQVTASGFTTTYPGPGCIVP
Ga0307479_1071352113300031962Hardwood Forest SoilESNKNAWYDQSGYEADDKCAWHNLYQLNRTAGLNFWVQPEYSNGGSGYPGPGCVRP
Ga0315281_1153717623300032163SedimentGYEADDKCAWHNLYQMTTGGFWVQPEFSNGGTVTRSGFTATYPGPGCIVPNR
Ga0307472_10246395423300032205Hardwood Forest SoilAVGYEADDKCAWHNLYQMTKGGFWVQPEYSNGLTRNGSTFPQHGCVVPNR
Ga0316624_1220297513300033486SoilAWYDSAGYEADDKCAWHFLYQMTNSMFWVQPEYSNGGNTSASGFNATYPGPGCVVPNK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.