Metagenome / Metatranscriptome Family F068951

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F068951
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	41 residues
Representative Sequence	MTERDNGLNCRKVRMGRLVEAHMALICGKVITWFVGCRL
Number of Associated Samples	103
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	69.35 %
% of genes near scaffold ends (potentially truncated)	42.74 %
% of genes from short scaffolds (< 2000 bps)	62.90 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.806 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (11.290 % of family members)
Environment Ontology (ENVO)	Unclassified (29.839 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.355 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF11578	DUF3237	5.65
PF08281	Sigma70_r4_2	5.65
PF04392	ABC_sub_bind	4.03
PF13474	SnoaL_3	4.03
PF00135	COesterase	2.42
PF13473	Cupredoxin_1	2.42
PF00300	His_Phos_1	1.61
PF00296	Bac_luciferase	1.61
PF02798	GST_N	1.61
PF14539	DUF4442	1.61
PF07519	Tannase	0.81
PF13185	GAF_2	0.81
PF01464	SLT	0.81
PF01663	Phosphodiest	0.81
PF13575	DUF4135	0.81
PF13467	RHH_4	0.81
PF06568	DUF1127	0.81
PF00528	BPD_transp_1	0.81
PF14559	TPR_19	0.81
PF05050	Methyltransf_21	0.81
PF03544	TonB_C	0.81
PF05545	FixQ	0.81
PF13545	HTH_Crp_2	0.81
PF05565	Sipho_Gp157	0.81
PF00571	CBS	0.81
PF04343	DUF488	0.81
PF03795	YCII	0.81
PF04993	TfoX_N	0.81
PF00106	adh_short	0.81

COG ID	Name	Functional Category	% Frequency in 124 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	4.03
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	2.42
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.61
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.81
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.81
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.81
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.81
COG4736	Cbb3-type cytochrome oxidase, subunit 3	Energy production and conversion [C]	0.81
COG5457	Uncharacterized conserved protein YjiS, DUF1127 family	Function unknown [S]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
All Organisms	root	All Organisms	49.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
cellular organisms	root	All Organisms → cellular organisms	49.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	48.39 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	30.65 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.42 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	26.61 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.42 %
Candidatus Bathyarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota	0.81 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18.55 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.42 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.81 %
unclassified Candidatus Bathyarchaeota	no rank	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota	0.81 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	10.48 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.42 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.61 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	8.06 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.42 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.61 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	4.84 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.42 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.81 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.81 %
Bradyrhizobium sp. CCBAU 051011	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	4.03 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.42 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.81 %
Bradyrhizobium sp. STM 3843	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843	0.81 %
Candidatus Bathyarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	0.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.81 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664021\|ICCgaii200_c1100861	All Organisms → cellular organisms → Bacteria → Proteobacteria	2428	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1005262	All Organisms → cellular organisms → Bacteria	2094	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1028738	Not Available	1032	Open in IMG/M
3300002244\|JGI24742J22300_10087863	Not Available	592	Open in IMG/M
3300004479\|Ga0062595_100161203	Not Available	1324	Open in IMG/M
3300004479\|Ga0062595_101670545	Not Available	598	Open in IMG/M
3300005204\|Ga0068997_10018695	Not Available	1116	Open in IMG/M
3300005295\|Ga0065707_10138073	All Organisms → cellular organisms → Bacteria	1811	Open in IMG/M
3300005332\|Ga0066388_100335634	Not Available	2157	Open in IMG/M
3300005332\|Ga0066388_100354242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2114	Open in IMG/M
3300005332\|Ga0066388_102716370	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300005333\|Ga0070677_10662348	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300005334\|Ga0068869_100060612	All Organisms → cellular organisms → Bacteria	2773	Open in IMG/M
3300005337\|Ga0070682_100283860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1208	Open in IMG/M
3300005347\|Ga0070668_100875331	Not Available	802	Open in IMG/M
3300005543\|Ga0070672_100050441	Not Available	3241	Open in IMG/M
3300005564\|Ga0070664_101015098	Not Available	780	Open in IMG/M
3300005618\|Ga0068864_100427752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	1263	Open in IMG/M
3300005713\|Ga0066905_100194907	Not Available	1508	Open in IMG/M
3300005764\|Ga0066903_101096252	Not Available	1467	Open in IMG/M
3300005843\|Ga0068860_101241055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	766	Open in IMG/M
3300005844\|Ga0068862_100763478	Not Available	942	Open in IMG/M
3300006049\|Ga0075417_10000082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	19253	Open in IMG/M
3300006049\|Ga0075417_10528991	Not Available	595	Open in IMG/M
3300006050\|Ga0075028_100000712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11865	Open in IMG/M
3300006057\|Ga0075026_100923510	Not Available	538	Open in IMG/M
3300006237\|Ga0097621_101576496	Not Available	624	Open in IMG/M
3300006237\|Ga0097621_102404661	Not Available	504	Open in IMG/M
3300006806\|Ga0079220_11623232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	561	Open in IMG/M
3300006852\|Ga0075433_11681962	Not Available	547	Open in IMG/M
3300007076\|Ga0075435_100034846	All Organisms → cellular organisms → Bacteria	3991	Open in IMG/M
3300007076\|Ga0075435_101666391	Not Available	560	Open in IMG/M
3300009094\|Ga0111539_12927938	Not Available	552	Open in IMG/M
3300009101\|Ga0105247_10014205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4778	Open in IMG/M
3300009147\|Ga0114129_10008567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14580	Open in IMG/M
3300009148\|Ga0105243_10129136	Not Available	2142	Open in IMG/M
3300009174\|Ga0105241_11002961	Not Available	781	Open in IMG/M
3300009176\|Ga0105242_10611736	Not Available	1054	Open in IMG/M
3300009792\|Ga0126374_10808438	Not Available	717	Open in IMG/M
3300010043\|Ga0126380_10001749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8368	Open in IMG/M
3300010043\|Ga0126380_10023181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3020	Open in IMG/M
3300010043\|Ga0126380_10540427	Not Available	904	Open in IMG/M
3300010046\|Ga0126384_10082289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2323	Open in IMG/M
3300010358\|Ga0126370_10205760	Not Available	1491	Open in IMG/M
3300010358\|Ga0126370_10213991	Not Available	1467	Open in IMG/M
3300010359\|Ga0126376_11688914	Not Available	668	Open in IMG/M
3300010359\|Ga0126376_12861285	Not Available	532	Open in IMG/M
3300010361\|Ga0126378_11474995	Not Available	771	Open in IMG/M
3300010366\|Ga0126379_12416015	Not Available	625	Open in IMG/M
3300010371\|Ga0134125_10058610	All Organisms → cellular organisms → Bacteria	4280	Open in IMG/M
3300010376\|Ga0126381_105107274	Not Available	503	Open in IMG/M
3300010400\|Ga0134122_10011579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6568	Open in IMG/M
3300010400\|Ga0134122_10715122	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	943	Open in IMG/M
3300012901\|Ga0157288_10224148	Not Available	614	Open in IMG/M
3300012958\|Ga0164299_10010829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	3386	Open in IMG/M
3300012961\|Ga0164302_10940228	Not Available	667	Open in IMG/M
3300012971\|Ga0126369_10106914	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	2546	Open in IMG/M
3300012985\|Ga0164308_11758374	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300012986\|Ga0164304_10323077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1067	Open in IMG/M
3300013100\|Ga0157373_11217972	Not Available	568	Open in IMG/M
3300013308\|Ga0157375_10352239	All Organisms → cellular organisms → Bacteria	1638	Open in IMG/M
3300014308\|Ga0075354_1069235	Not Available	686	Open in IMG/M
3300014308\|Ga0075354_1167268	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	512	Open in IMG/M
3300014320\|Ga0075342_1002988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3353	Open in IMG/M
3300014324\|Ga0075352_1011940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1684	Open in IMG/M
3300014969\|Ga0157376_10006713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8147	Open in IMG/M
3300015371\|Ga0132258_10360082	All Organisms → cellular organisms → Bacteria → Proteobacteria	3600	Open in IMG/M
3300015371\|Ga0132258_10501773	All Organisms → cellular organisms → Bacteria	3035	Open in IMG/M
3300015371\|Ga0132258_10688578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843	2573	Open in IMG/M
3300015371\|Ga0132258_10883027	Not Available	2257	Open in IMG/M
3300015371\|Ga0132258_11456581	Not Available	1730	Open in IMG/M
3300015372\|Ga0132256_100128827	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2509	Open in IMG/M
3300015372\|Ga0132256_100148064	Not Available	2352	Open in IMG/M
3300015373\|Ga0132257_100058547	All Organisms → cellular organisms → Bacteria → Proteobacteria	4316	Open in IMG/M
3300015374\|Ga0132255_100450303	Not Available	1884	Open in IMG/M
3300017947\|Ga0187785_10776920	Not Available	507	Open in IMG/M
3300017974\|Ga0187777_10877330	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300018029\|Ga0187787_10140439	Not Available	811	Open in IMG/M
3300018032\|Ga0187788_10004930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4052	Open in IMG/M
3300018060\|Ga0187765_10052644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2100	Open in IMG/M
3300018064\|Ga0187773_10059351	All Organisms → cellular organisms → Bacteria	1786	Open in IMG/M
3300018072\|Ga0184635_10033406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1943	Open in IMG/M
3300021168\|Ga0210406_10501496	Not Available	960	Open in IMG/M
3300021560\|Ga0126371_10004385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	12456	Open in IMG/M
3300022694\|Ga0222623_10100693	Not Available	1124	Open in IMG/M
3300025735\|Ga0207713_1238114	Not Available	541	Open in IMG/M
3300025900\|Ga0207710_10009281	Not Available	4137	Open in IMG/M
3300025900\|Ga0207710_10126815	Not Available	1223	Open in IMG/M
3300025904\|Ga0207647_10027116	All Organisms → cellular organisms → Bacteria	3738	Open in IMG/M
3300025905\|Ga0207685_10166017	Not Available	1012	Open in IMG/M
3300025906\|Ga0207699_10025417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3251	Open in IMG/M
3300025912\|Ga0207707_10040874	All Organisms → cellular organisms → Bacteria → Proteobacteria	4049	Open in IMG/M
3300025917\|Ga0207660_10229723	All Organisms → cellular organisms → Bacteria	1458	Open in IMG/M
3300025919\|Ga0207657_10386016	All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	1102	Open in IMG/M
3300025921\|Ga0207652_11080762	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300025931\|Ga0207644_10342442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	1213	Open in IMG/M
3300025933\|Ga0207706_10725837	Not Available	848	Open in IMG/M
3300025938\|Ga0207704_11403607	Not Available	598	Open in IMG/M
3300025985\|Ga0210117_1023648	Not Available	914	Open in IMG/M
3300026035\|Ga0207703_10327276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011	1405	Open in IMG/M
3300026035\|Ga0207703_10612814	All Organisms → cellular organisms → Bacteria	1030	Open in IMG/M
3300026053\|Ga0208422_1022790	Not Available	743	Open in IMG/M
3300026067\|Ga0207678_10008740	All Organisms → cellular organisms → Bacteria	8914	Open in IMG/M
3300026088\|Ga0207641_11307821	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300026452\|Ga0256821_1001243	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2092	Open in IMG/M
3300027873\|Ga0209814_10000205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	17917	Open in IMG/M
3300027874\|Ga0209465_10028883	Not Available	2603	Open in IMG/M
3300027880\|Ga0209481_10006395	All Organisms → cellular organisms → Bacteria	5012	Open in IMG/M
3300027993\|Ga0247749_1052326	Not Available	503	Open in IMG/M
3300028592\|Ga0247822_11777589	Not Available	526	Open in IMG/M
3300028768\|Ga0307280_10086409	Not Available	1028	Open in IMG/M
3300028791\|Ga0307290_10334867	Not Available	554	Open in IMG/M
3300031170\|Ga0307498_10109098	Not Available	864	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1009828	Not Available	2277	Open in IMG/M
3300031421\|Ga0308194_10159198	Not Available	702	Open in IMG/M
3300031474\|Ga0170818_103005387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4023	Open in IMG/M
3300031890\|Ga0306925_11283695	Not Available	728	Open in IMG/M
3300031942\|Ga0310916_10126260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2087	Open in IMG/M
3300031947\|Ga0310909_10028356	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4122	Open in IMG/M
3300032180\|Ga0307471_102418449	Not Available	664	Open in IMG/M
3300033433\|Ga0326726_10010389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	8221	Open in IMG/M
3300033433\|Ga0326726_10056755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3433	Open in IMG/M
3300034090\|Ga0326723_0159590	Not Available	992	Open in IMG/M
3300034090\|Ga0326723_0468538	Not Available	576	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.29%
Host-Associated	Host-Associated	38.71%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.65%
Plants	Host-Associated → Plants	38.71%
Aquatic	Environmental → Aquatic	5.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.39%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.71%
Sediment	Environmental → Aquatic → Sediment	3.23%
Peat	Environmental → Terrestrial → Peat	3.23%
Marine	Environmental → Aquatic → Marine	1.61%
Roots	Host-Associated → Plants → Roots	1.61%
Freshwater	Environmental → Aquatic → Freshwater	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	33.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.32%
Loam	Environmental → Terrestrial → Soil → Loam	9.68%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.87%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.06%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	3.23%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.61%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.61%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.81%
Sand	Environmental → Terrestrial → Soil → Sand	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.32%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.06%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.23%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	3.23%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.61%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.61%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.81%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.81%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.81%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.26%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.26%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.84%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.84%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	4.03%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.23%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	3.23%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.23%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.42%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.61%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.61%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.81%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.81%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005204	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300014320	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1	Environmental	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018032	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025985	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026053	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026452	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027993	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ICCgaii200_11008611	2228664021	Soil	QGVTGDSTMTERDKSLNGRKARIGRIVEAHMTLICGKVITWFVGCRL
AF_2010_repII_A01DRAFT_10052624	3300000580	Forest Soil	MAERDKGLTGRRVRMGRVVEANMALICGKVITWFVGCRL*
AF_2010_repII_A100DRAFT_10287381	3300000655	Forest Soil	MTERDKSLNCRKVRMGRFVEAHMALICGKVITWFVGCRLE
JGI24742J22300_100878632	3300002244	Corn, Switchgrass And Miscanthus Rhizosphere	ERDKHLDYRKARMGRLIEAHMAMICGKAITWFVGCRL*
Ga0062595_1001612034	3300004479	Soil	MTEGKNGLNRRKALDIRTGWLVEAHMALICGKVITWFIGCRL*
Ga0062595_1016705451	3300004479	Soil	MTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCRL*
Ga0068997_100186953	3300005204	Natural And Restored Wetlands	MVESENGLNRRKAFDIRIGRHVEAHMALICGKVITWFIGCRI*
Ga0065707_101380732	3300005295	Switchgrass Rhizosphere	VEVIKAYGDLAMTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL*
Ga0066388_1003356343	3300005332	Tropical Forest Soil	MREHDKDVNHRKVRMGRVVEAQMELICGKVITWFVGCRL*
Ga0066388_1003542422	3300005332	Tropical Forest Soil	MTKGEKALKRRKALDIRRGRLVEAHMALICGKLITWFIGCRL*
Ga0066388_1027163702	3300005332	Tropical Forest Soil	MAEGDKGLTGRKVRMGRVVEANMALICGKLVTWFVGCRL*
Ga0070677_106623481	3300005333	Miscanthus Rhizosphere	IGDLAMTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL*
Ga0068869_1000606126	3300005334	Miscanthus Rhizosphere	MTERDKHLDYRKARMGRLIEAHMAMICGKAITWFVRCRL*
Ga0070682_1002838601	3300005337	Corn Rhizosphere	VTGDSTMTERDKDLNCRKVRIGRTVEDHMTPICGKVITWFVGCRL*
Ga0070668_1008753311	3300005347	Switchgrass Rhizosphere	QGVTGDSTMTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCRL*
Ga0070672_1000504415	3300005543	Miscanthus Rhizosphere	MTERDKHLDYRKARMGRLIEAHMAMICGKAITWFVGCRL*
Ga0070664_1010150982	3300005564	Corn Rhizosphere	KGLNGRKVRMGRLVEAQMAQICGKVVTWFVGCRL*
Ga0068864_1004277524	3300005618	Switchgrass Rhizosphere	RYKDLNRRKVRIGRTVEAHMTLICGKVVTWFVGCRL*
Ga0066905_1001949075	3300005713	Tropical Forest Soil	MTERDKGLNGRKVRIGRIVEAHMTLICGKVVTWFVGCRL*
Ga0066903_1010962524	3300005764	Tropical Forest Soil	MMIERDKHLNCRTLGMGRLVEAHMSLICGKAITWFVGCRL*
Ga0068860_1012410551	3300005843	Switchgrass Rhizosphere	CQSQGVTGDSTMTERDKDLNGRKVRIGRTVEDHMTPICGKVITWFVGCRL*
Ga0068862_1007634781	3300005844	Switchgrass Rhizosphere	DSAMTERDKHLNNRKASLGRLIEAHVAMICGKAITWFVRCRL*
Ga0075417_100000823	3300006049	Populus Rhizosphere	MTERDKSLNGRKARIGRIVEAHMTLICGKVITWFVGCRL*
Ga0075417_105289913	3300006049	Populus Rhizosphere	MTDRDNGLNRRKVLDIRIGRLVEAHMALICGEVITWFIGCRL*
Ga0075028_1000007123	3300006050	Watersheds	MTESYDGSNRRKVRIGPLVEAHMALICGKAFTWFIGCRL*
Ga0075026_1009235101	3300006057	Watersheds	MTEDENGLNRRKALDIRTGWLVEAHMALICGKVITWFIGCRL*
Ga0097621_1015764961	3300006237	Miscanthus Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVVTWFVG
Ga0097621_1024046611	3300006237	Miscanthus Rhizosphere	MEDSTMTEGKNGLNRRKALDIRTGWLVEAHMALICGK
Ga0079220_116232322	3300006806	Agricultural Soil	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVITWFVDCRL*
Ga0075433_116819622	3300006852	Populus Rhizosphere	MTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCR
Ga0075435_1000348468	3300007076	Populus Rhizosphere	MTERDNGLNCRKVGMGRLVEAHMALICGKVITWFVGCRL*
Ga0075435_1016663911	3300007076	Populus Rhizosphere	RDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCRL*
Ga0111539_129279382	3300009094	Populus Rhizosphere	TGDSTMTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCRL*
Ga0105247_100142055	3300009101	Switchgrass Rhizosphere	MTERDKDLNGRKVRIGRTVEDHMTPICGKVITWFVGCRL*
Ga0114129_1000856721	3300009147	Populus Rhizosphere	MTERHKSLNGRKARIGRIVEAHMTLICGKVITWFVGCRL*
Ga0105243_101291364	3300009148	Miscanthus Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVVTWFVGCRL*
Ga0105241_110029613	3300009174	Corn Rhizosphere	MTERDNGLNCRKVRMGRLVEAHMALICGKVITWFVGCR
Ga0105242_106117361	3300009176	Miscanthus Rhizosphere	TMTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGSRL*
Ga0126374_108084382	3300009792	Tropical Forest Soil	MADRDKSLAGRKVRMGRVVEANMALICGKLVTWFVGCRL*
Ga0126380_1000174912	3300010043	Tropical Forest Soil	ENALKRRKALDIRRGRLVEAHMALICGKVITWFIGCRL*
Ga0126380_100231811	3300010043	Tropical Forest Soil	MTKGENALKRRKALDIRRGRLVEAHMALICGKLITWFIGCRL*
Ga0126380_105404271	3300010043	Tropical Forest Soil	HLEGRGRCQSQGVTGDSTMAERDKGLNGRKVRIGRIVEAHITLICGKAVTCFVGCRL*
Ga0126384_100822893	3300010046	Tropical Forest Soil	MTKGENALKRRKALDIRRGRLVEAHMALICGKVITWFIGCRL*
Ga0126370_102057603	3300010358	Tropical Forest Soil	MTERDKGLNCRKVRTGRLVETHMQLICGKVITWFVGCRL*
Ga0126370_102139912	3300010358	Tropical Forest Soil	MAERDKGLTGRKVRMGRVVEANMAMICGKVITWFVGCRL*
Ga0126376_116889141	3300010359	Tropical Forest Soil	VQFSTTHDATGDSAMREHDKDVNHRKVRMGRVVEAQMELICGKVITWFVGCRL*
Ga0126376_128612851	3300010359	Tropical Forest Soil	MMIERGKQLNCRKLGMGRLVEAHMSLICGKAITWFVGCRL*
Ga0126378_114749951	3300010361	Tropical Forest Soil	MAERDKGLTGRKVRMGRVVEANMALICGKLVTWFVGCR
Ga0126379_124160152	3300010366	Tropical Forest Soil	LEGRGRCQSQGVTGDSTMAERDKGLNGRKVRIGRIVEAHITLICGKVVTWFVGCRL*
Ga0134125_100586102	3300010371	Terrestrial Soil	MTERDKHLNNRKARMGRLIEAHMAMICGKAITWFVGCRL*
Ga0126381_1051072741	3300010376	Tropical Forest Soil	MAERDMGLTGRKVRMGRVVEANMALICGKVITWFVGCRL*
Ga0134122_100115796	3300010400	Terrestrial Soil	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVITWFVGCRL*
Ga0134122_107151222	3300010400	Terrestrial Soil	QGVTGDSTMTERDKDLNGRKVRIGRTVEDHMTLICGKVITWFVGCRL*
Ga0157288_102241481	3300012901	Soil	MTDRDKGLNPRKLPTGRLVEAHMALICGKVPAWFLGFRL
Ga0164299_100108294	3300012958	Soil	MTERDKGLNGRKVRMGRLVEAQMAQICGKVITWFVGCRL*
Ga0164302_109402283	3300012961	Soil	MTERDKHLNNRKASLGRLIEAHVAMICGKAITWFV
Ga0126369_101069145	3300012971	Tropical Forest Soil	ERDKHLNCRTLGMGRLVEAHMSLICGKAITWFVGCRL*
Ga0164308_117583742	3300012985	Soil	DLAMTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL*
Ga0164304_103230771	3300012986	Soil	AGSLWETPTMTERGKGLNFRKLGMGRFVEAHMTLICGKVITWFVGCRL*
Ga0157373_112179721	3300013100	Corn Rhizosphere	TDRDKGLNPRKLPTGRLVEAHMALICGKVPAWFLGFRL*
Ga0157375_103522391	3300013308	Miscanthus Rhizosphere	MTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL*
Ga0075354_10692352	3300014308	Natural And Restored Wetlands	MAESENGLNRRKAFDIRIGRHVEAHMALICGKVITWFIGCRI*
Ga0075354_11672681	3300014308	Natural And Restored Wetlands	QSVTGHSTMTDCDKGLNRGKALDFRIGRLVEAHMALICGKAIAWFIGCRL*
Ga0075342_10029883	3300014320	Natural And Restored Wetlands	MTDRDKGLNPRKLPTGRLVETHMALICGKVPAWFLGCRL*
Ga0075352_10119403	3300014324	Natural And Restored Wetlands	MAESKNGLNRRKAFDIRIGRHVEAHMALICGKVITWFIGCRI*
Ga0157376_100067136	3300014969	Miscanthus Rhizosphere	MTEGKNRLNRCKVLDMRNGRLVEAHMALICGKVVTWFVGCRL*
Ga0132258_103600822	3300015371	Arabidopsis Rhizosphere	MTERDNDLNGRKARIGRTVEAHMTLICGKVVTWFVGCRL*
Ga0132258_105017734	3300015371	Arabidopsis Rhizosphere	MTDRDKGLNLRKLPMGRLVEAHMALICGKVAAWFVGCRL*
Ga0132258_106885782	3300015371	Arabidopsis Rhizosphere	MAEIKTAMNRRKSLDIPTGRLVETHMSLICGKVITWFIGCRL*
Ga0132258_108830271	3300015371	Arabidopsis Rhizosphere	MTDRDKSLNPRKLPMGRLVEAHMALICGKVAAWFVGCRL*
Ga0132258_114565811	3300015371	Arabidopsis Rhizosphere	MTERDKHLNNRKASLGRLIEAHVAMICGKAITWFVGCR
Ga0132256_1001288275	3300015372	Arabidopsis Rhizosphere	MTGCDKGSNRGKALDIRIGRRVEAHMALICGKAITWFIGCRL*
Ga0132256_1001480643	3300015372	Arabidopsis Rhizosphere	MTDRDKGLNSPKLPMGRLVEAHMALICGKVATWFVGCRL*
Ga0132257_1000585475	3300015373	Arabidopsis Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQRAQICGKVVTWFVGCRL*
Ga0132255_1004503032	3300015374	Arabidopsis Rhizosphere	MTDRDKGLNPRKLPMGRLVEAHMALICGKVAAWFVGCRL*
Ga0187785_107769201	3300017947	Tropical Peatland	MTKGENALKRRKALDIRRGRLVEAHMALICGKVITWFIGCRL
Ga0187777_108773301	3300017974	Tropical Peatland	GPCQSQALLRDSTMTEQDKHLNDRKARMGRLVETHLAMICGKAITWFVGCRL
Ga0187787_101404393	3300018029	Tropical Peatland	DKGLNPRKLPMGWLVEAHMALICGKVAAWFVGCRL
Ga0187788_100049303	3300018032	Tropical Peatland	MTESENGLDHRKVLDIRMGRLVEAHMALICGKVITWFIGCRL
Ga0187765_100526443	3300018060	Tropical Peatland	MAEIKTAMNRRKALDIRTGRLVETHMSLICGKVITWFIGCRL
Ga0187773_100593513	3300018064	Tropical Peatland	MTESENGLDHRKVLDIRMGWLVEAHMALICGKVITWFIGCRL
Ga0184635_100334063	3300018072	Groundwater Sediment	MTESENGLNRRKVLDMRNGRLVEAHMALICGKVITWFVGCRL
Ga0210406_105014963	3300021168	Soil	MEDSTMTERENGLNRRKALDIRTGRLVEAHMALICGKVITWFIGCRL
Ga0126371_100043852	3300021560	Tropical Forest Soil	MTKGEKALKRRKALDIRRGRLVEAHMALICGKLITWFIGCRL
Ga0222623_101006932	3300022694	Groundwater Sediment	MTKRDNGLNRRKVLDIRIGRLIEAHMALICGTVITWFIGCRL
Ga0207713_12381141	3300025735	Switchgrass Rhizosphere	KRGPRQRQGVTGDSTMTERDKDLNDRKVRIGRTVEDHMTLICGKVITWFVGCRL
Ga0207710_100092817	3300025900	Switchgrass Rhizosphere	MTERDKHLDYRKARMGRLIEAHMAMICGKAITWFVGCRL
Ga0207710_101268152	3300025900	Switchgrass Rhizosphere	MTERDKDLNGRKVRIGRTVEDHMTLICGKVITWFVGCRL
Ga0207647_100271164	3300025904	Corn Rhizosphere	MTDRDKGLNPRKLPTGRLVEAHMALICGKVPAWFLGCRL
Ga0207685_101660173	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MTEGKNGLNRRKALDIRTGWLVEAHMALICGKVITWFVGCRL
Ga0207699_100254175	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MTERDNGLNCRKVRMGRLVEAHMALICGKVITWFVGCRL
Ga0207707_100408745	3300025912	Corn Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVVTWFVGCRL
Ga0207660_102297232	3300025917	Corn Rhizosphere	MTGRDKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL
Ga0207657_103860161	3300025919	Corn Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVVTWFV
Ga0207652_110807622	3300025921	Corn Rhizosphere	GDLAMTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL
Ga0207644_103424421	3300025931	Switchgrass Rhizosphere	AKRGPHQSQGVTGDSTMTERDKDLNGRKVRIGRTVEDHMTPICGKVITWFVGCRL
Ga0207706_107258372	3300025933	Corn Rhizosphere	MTERDKGLNGRKVRIGRVVEANMALICGNLVTWFVGCRL
Ga0207704_114036072	3300025938	Miscanthus Rhizosphere	MTGRDKGLNGRKVRMVRLVEAQMAQICGKVITWFV
Ga0210117_10236483	3300025985	Natural And Restored Wetlands	MTDCDKGLNRGKALDFRIGRLVEAHMALICGKAIAWFIG
Ga0207703_103272764	3300026035	Switchgrass Rhizosphere	KRGPRQSHGVTGDSTMTERDKDLNGRKVRIGRTVEDHMTLICGKVITWFVGCRL
Ga0207703_106128144	3300026035	Switchgrass Rhizosphere	MTERDKDLNGRKVRIGRTVEDHMTLICGKVITWFV
Ga0208422_10227902	3300026053	Natural And Restored Wetlands	MTDRDKGLNPRKLPTGRLVETHMALICGKVPAWFLGCRL
Ga0207678_100087409	3300026067	Corn Rhizosphere	MTGRDKGLNGRKVRMGRLVEAQMAQICGKVITWFVGCRL
Ga0207641_113078211	3300026088	Switchgrass Rhizosphere	DLAMTKREKGLNGRKVRMGRLVEAEMALICGKVITWFVGCRL
Ga0256821_10012433	3300026452	Sediment	MTDCDKGLNRGKALDFRIGRLVEAHMALICGKAIAWFIGCRL
Ga0209814_100002053	3300027873	Populus Rhizosphere	MTERDKSLNGRKARIGRIVEAHMTLICGKVITWFVGCRL
Ga0209465_100288835	3300027874	Tropical Forest Soil	MAERDKGLTGRRVRMGRVVEANMALICGKVITWFVGCRL
Ga0209481_100063958	3300027880	Populus Rhizosphere	VTERDNGLNCRKVGMGRLVEAHMALICGKVITWFVGCRL
Ga0247749_10523263	3300027993	Soil	MTDRDKGLNPRKLPTGRLVEAHMALICGKVPAWFLGF
Ga0247822_117775891	3300028592	Soil	MTERDNGLNCRKVGMGRLVEAHMVLICGKVITWFV
Ga0307280_100864091	3300028768	Soil	MTERDKGLNGRKVRMGRLVEAHMALIYGKVITWFVG
Ga0307290_103348673	3300028791	Soil	MTERDKGLNGRKVRMGRLVEAHMALIYGKVITWFVGCR
Ga0307498_101090982	3300031170	Soil	MTESENGLNRRKVLDIRIGRLVEGFMALICGKVITWF
(restricted) Ga0255312_10098283	3300031248	Sandy Soil	MTDRDKGLNPRKLPMGRLVEAHMTLICGKVAAWFVGCRL
Ga0308194_101591984	3300031421	Soil	MTERDKGLNCRKVRMDRLVEAHIALICGKVITWFIGC
Ga0170818_1030053875	3300031474	Forest Soil	MTERDKGLNGRKVRMGRLVEAQTALICGKVITWFVSCRL
Ga0306925_112836951	3300031890	Soil	PGTRFFSSNVTGHSAMTERDKSLNHRKVRMGRIVKAQMELICGKVITWFVGCRL
Ga0310916_101262601	3300031942	Soil	SNVTGHSAMTERDKSLNHRKVRMGRIVKAQMELICGKVITWFVGCRL
Ga0310909_100283567	3300031947	Soil	MTERDKSLNHRKVRMGRIVKAQMELICGKVITWFVGCRL
Ga0307471_1024184492	3300032180	Hardwood Forest Soil	VTGDSTMTERDKDLNDRKVRIGRTVEDHMTLICGKVITWFVGCRL
Ga0326726_100103894	3300033433	Peat Soil	MTEDENGLNRRKALDIRTGWLVEAHMALICGKVITWFIGCRL
Ga0326726_100567554	3300033433	Peat Soil	MTEGVNGLNRGKALDIRTGWLVEAHMALICGKVITWFIGCRL
Ga0326723_0159590_2_115	3300034090	Peat Soil	NGLNRRKALDIRTGWLVEAHMALICGKVITWFIGCRL
Ga0326723_0468538_415_543	3300034090	Peat Soil	MVESENGLNRRKAFDIRIGRHVEAHMALICGKVITWFIGCRI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters