| Basic Information | |
|---|---|
| Family ID | F068947 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.226 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.839 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF03932 | CutC | 36.29 |
| PF14464 | Prok-JAB | 8.06 |
| PF01569 | PAP2 | 5.65 |
| PF00296 | Bac_luciferase | 4.84 |
| PF01040 | UbiA | 4.03 |
| PF00881 | Nitroreductase | 2.42 |
| PF00702 | Hydrolase | 2.42 |
| PF04228 | Zn_peptidase | 1.61 |
| PF07228 | SpoIIE | 1.61 |
| PF01850 | PIN | 1.61 |
| PF00464 | SHMT | 1.61 |
| PF13407 | Peripla_BP_4 | 0.81 |
| PF10865 | DUF2703 | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF05506 | PLipase_C_C | 0.81 |
| PF13650 | Asp_protease_2 | 0.81 |
| PF03328 | HpcH_HpaI | 0.81 |
| PF02583 | Trns_repr_metal | 0.81 |
| PF13620 | CarboxypepD_reg | 0.81 |
| PF04101 | Glyco_tran_28_C | 0.81 |
| PF00912 | Transgly | 0.81 |
| PF02604 | PhdYeFM_antitox | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3142 | Copper homeostasis protein CutC | Inorganic ion transport and metabolism [P] | 36.29 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.84 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 1.61 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 1.61 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.61 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.81 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.81 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.81 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.81 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.23 % |
| Unclassified | root | N/A | 21.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E01CMT7B | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300001593|JGI12635J15846_10611095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300001593|JGI12635J15846_10669318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300001593|JGI12635J15846_10870001 | Not Available | 515 | Open in IMG/M |
| 3300005332|Ga0066388_100068168 | All Organisms → cellular organisms → Bacteria | 3842 | Open in IMG/M |
| 3300005332|Ga0066388_102575077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300005437|Ga0070710_10806027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005447|Ga0066689_10184030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300005467|Ga0070706_101844543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Thermohalobacteraceae → Clostridiisalibacter → Clostridiisalibacter paucivorans | 549 | Open in IMG/M |
| 3300005537|Ga0070730_10446154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300005538|Ga0070731_10094074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1985 | Open in IMG/M |
| 3300005557|Ga0066704_10725165 | Not Available | 624 | Open in IMG/M |
| 3300005566|Ga0066693_10321716 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005576|Ga0066708_10299216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300005587|Ga0066654_10118359 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005712|Ga0070764_10110297 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300005764|Ga0066903_103146333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300006031|Ga0066651_10772059 | Not Available | 520 | Open in IMG/M |
| 3300006237|Ga0097621_101944972 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006755|Ga0079222_10107658 | Not Available | 1483 | Open in IMG/M |
| 3300006806|Ga0079220_10441716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300007258|Ga0099793_10016158 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
| 3300007258|Ga0099793_10620780 | Not Available | 542 | Open in IMG/M |
| 3300007819|Ga0104322_130500 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300009012|Ga0066710_104862396 | Not Available | 503 | Open in IMG/M |
| 3300009038|Ga0099829_10846671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300009038|Ga0099829_11721587 | Not Available | 515 | Open in IMG/M |
| 3300009088|Ga0099830_10456336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300009088|Ga0099830_11622022 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009088|Ga0099830_11868797 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009090|Ga0099827_11574973 | Not Available | 572 | Open in IMG/M |
| 3300010048|Ga0126373_10842791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300010048|Ga0126373_11390885 | Not Available | 767 | Open in IMG/M |
| 3300010361|Ga0126378_11669394 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010366|Ga0126379_11857525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300010376|Ga0126381_103595812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300010880|Ga0126350_10133694 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012096|Ga0137389_11630138 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012189|Ga0137388_10951987 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012202|Ga0137363_10067860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2614 | Open in IMG/M |
| 3300012205|Ga0137362_11083620 | Not Available | 681 | Open in IMG/M |
| 3300012206|Ga0137380_10135855 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300012206|Ga0137380_10181453 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300012361|Ga0137360_10028537 | All Organisms → cellular organisms → Bacteria | 3833 | Open in IMG/M |
| 3300012361|Ga0137360_10936519 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012362|Ga0137361_11338438 | Not Available | 640 | Open in IMG/M |
| 3300012363|Ga0137390_11600831 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012925|Ga0137419_10950137 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012944|Ga0137410_10094993 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300012971|Ga0126369_10104051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2577 | Open in IMG/M |
| 3300012975|Ga0134110_10138870 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300013307|Ga0157372_10537053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
| 3300014495|Ga0182015_10950294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300015264|Ga0137403_10016179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8074 | Open in IMG/M |
| 3300016294|Ga0182041_10353822 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300017995|Ga0187816_10103270 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300018060|Ga0187765_10653688 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300018085|Ga0187772_10714085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300020579|Ga0210407_10249586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300020579|Ga0210407_10745847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300020579|Ga0210407_10916683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 671 | Open in IMG/M |
| 3300020580|Ga0210403_10192111 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300020581|Ga0210399_11035498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300020581|Ga0210399_11536302 | Not Available | 515 | Open in IMG/M |
| 3300020583|Ga0210401_10554059 | Not Available | 1012 | Open in IMG/M |
| 3300020583|Ga0210401_10864638 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300021046|Ga0215015_10064053 | Not Available | 1342 | Open in IMG/M |
| 3300021086|Ga0179596_10431028 | Not Available | 666 | Open in IMG/M |
| 3300021180|Ga0210396_10005288 | All Organisms → cellular organisms → Bacteria | 12513 | Open in IMG/M |
| 3300021404|Ga0210389_11506770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
| 3300021405|Ga0210387_11737273 | Not Available | 527 | Open in IMG/M |
| 3300021420|Ga0210394_10183547 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300021420|Ga0210394_10228881 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300021432|Ga0210384_10913234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300021477|Ga0210398_10405008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300021478|Ga0210402_10545489 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300021478|Ga0210402_11689933 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300022508|Ga0222728_1026066 | Not Available | 877 | Open in IMG/M |
| 3300023259|Ga0224551_1084961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025157|Ga0209399_10397458 | Not Available | 535 | Open in IMG/M |
| 3300025501|Ga0208563_1024369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1546 | Open in IMG/M |
| 3300025812|Ga0208457_1049374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300025912|Ga0207707_10207214 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300025939|Ga0207665_10166429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1589 | Open in IMG/M |
| 3300025939|Ga0207665_10663586 | Not Available | 818 | Open in IMG/M |
| 3300025939|Ga0207665_11538828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300026035|Ga0207703_10805425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300026331|Ga0209267_1117221 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300026342|Ga0209057_1080269 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300027521|Ga0209524_1124454 | Not Available | 537 | Open in IMG/M |
| 3300027605|Ga0209329_1033894 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300027643|Ga0209076_1060137 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300027660|Ga0209736_1185321 | Not Available | 544 | Open in IMG/M |
| 3300027671|Ga0209588_1085841 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300027678|Ga0209011_1063507 | Not Available | 1109 | Open in IMG/M |
| 3300027701|Ga0209447_10010781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2637 | Open in IMG/M |
| 3300027846|Ga0209180_10032624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2812 | Open in IMG/M |
| 3300027857|Ga0209166_10347123 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300027875|Ga0209283_10057624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2486 | Open in IMG/M |
| 3300027875|Ga0209283_10175922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
| 3300027908|Ga0209006_10617079 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300028047|Ga0209526_10366504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300028536|Ga0137415_10571655 | Not Available | 940 | Open in IMG/M |
| 3300028759|Ga0302224_10071301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1316 | Open in IMG/M |
| 3300029636|Ga0222749_10093868 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1399 | Open in IMG/M |
| 3300030580|Ga0311355_10019914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8371 | Open in IMG/M |
| 3300031236|Ga0302324_100394347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2068 | Open in IMG/M |
| 3300031543|Ga0318516_10278498 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031573|Ga0310915_10813895 | Not Available | 657 | Open in IMG/M |
| 3300031719|Ga0306917_10769163 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300031754|Ga0307475_10141565 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300031820|Ga0307473_10983610 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031962|Ga0307479_10217950 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300031962|Ga0307479_11372172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300032001|Ga0306922_10591897 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300032770|Ga0335085_10287303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1956 | Open in IMG/M |
| 3300032782|Ga0335082_11493870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300032783|Ga0335079_10551407 | Not Available | 1222 | Open in IMG/M |
| 3300032805|Ga0335078_12366223 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032892|Ga0335081_10169149 | All Organisms → cellular organisms → Bacteria | 3086 | Open in IMG/M |
| 3300032898|Ga0335072_11557380 | Not Available | 560 | Open in IMG/M |
| 3300032954|Ga0335083_10715389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300032955|Ga0335076_11632729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_08939750 | 2189573000 | Grass Soil | ISNEPQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA |
| JGI12635J15846_106110951 | 3300001593 | Forest Soil | GREMEEPMPRQQTLPNVVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA* |
| JGI12635J15846_106693182 | 3300001593 | Forest Soil | EPPQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA* |
| JGI12635J15846_108700011 | 3300001593 | Forest Soil | PPAQVVHHAQVQPPAREVHQDMDDLDVPTFLRRQAQKA* |
| Ga0066388_1000681684 | 3300005332 | Tropical Forest Soil | EATSEPAPPQPQQQQLPNVVHQVQQNVRDIQPEVRADDLDVPTFLRRQAQKA* |
| Ga0066388_1025750773 | 3300005332 | Tropical Forest Soil | REMPEPPMPVQPTLPNVVHQVHQNVRDVGAEVPADDLDVPTFLRRQAQKV* |
| Ga0070710_108060272 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PPAQVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA* |
| Ga0066689_101840302 | 3300005447 | Soil | WKAAREERTVVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA* |
| Ga0070706_1018445431 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PPPANVVHQVQQNVQEVSREVPVDDLDVPTFLRRQAQKA* |
| Ga0070730_104461541 | 3300005537 | Surface Soil | VAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA* |
| Ga0070731_100940741 | 3300005538 | Surface Soil | QQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA* |
| Ga0066704_107251651 | 3300005557 | Soil | EERTVVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA* |
| Ga0066693_103217162 | 3300005566 | Soil | AGREMMEPPMPAIQQPANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA* |
| Ga0066708_102992161 | 3300005576 | Soil | ANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA* |
| Ga0066654_101183591 | 3300005587 | Soil | VHEPANVVHQGQQNVRDVSPEVPPDDLDVPTFLRRQAQKA* |
| Ga0070764_101102971 | 3300005712 | Soil | QQQTLPNVVHQVQQNIRDVSREVPADDLDVPTFLRRQAQKA* |
| Ga0066903_1031463332 | 3300005764 | Tropical Forest Soil | ANVVHQVQQNVHEVSQEVPAVDDLDVPTFLRRQAQKV* |
| Ga0066651_107720592 | 3300006031 | Soil | KAGREIMEPPMQQPANVVHQVQQNVREVSPEVPADDLDVPTFLRRQAQKA* |
| Ga0097621_1019449722 | 3300006237 | Miscanthus Rhizosphere | PNVVHQVQQNVRDVSRDVPADDLDVPTFLRRQAQKA* |
| Ga0079222_101076583 | 3300006755 | Agricultural Soil | VHQVQQNVREFSQEVPATDDLDVPTFLRRQAQKA* |
| Ga0079220_104417161 | 3300006806 | Agricultural Soil | MPDMPVQQALPNVVHQVQENVREVGQDVPSDDLDVPTFLRRHAQKA* |
| Ga0099793_100161586 | 3300007258 | Vadose Zone Soil | SVVHQVAQNVREVSPEVPKDDLDVPTFLRRQAQKA* |
| Ga0099793_106207801 | 3300007258 | Vadose Zone Soil | NVVHQVQQNVREVSQDVPSDDLDVPTFLRRQAQRA* |
| Ga0104322_1305003 | 3300007819 | Permafrost Soil | PAPVVHHAQVPQPAREVHQDVDDLDVPTFLRRQAQKA* |
| Ga0066710_1048623961 | 3300009012 | Grasslands Soil | MEPPMPAIQQPANVVHQVQQSVCDVSQEVPGDDLDVPTFLRRQAQKA |
| Ga0099829_108466711 | 3300009038 | Vadose Zone Soil | QSQHQPANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA* |
| Ga0099829_117215871 | 3300009038 | Vadose Zone Soil | NVVHQVQQNVREVSQDVPSDDLDVPTFLRRQAQKA* |
| Ga0099830_104563361 | 3300009088 | Vadose Zone Soil | PEPPQSHHQPANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA* |
| Ga0099830_116220221 | 3300009088 | Vadose Zone Soil | REIPEEPMHHATSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA* |
| Ga0099830_118687972 | 3300009088 | Vadose Zone Soil | VVHQVQQNVREVSQDVPADDLDVPTFLRRQAQKA* |
| Ga0099827_115749731 | 3300009090 | Vadose Zone Soil | VVEQVAHNVGEALHEVPLDDLDVPTFLRRQAQKA* |
| Ga0126373_108427911 | 3300010048 | Tropical Forest Soil | PGPQPQPAAVVNQVQLESVRELSHEVPADDLDVPTFLRRQAQKA* |
| Ga0126373_113908851 | 3300010048 | Tropical Forest Soil | ANAVQQQVSKNVREASPEVPKDDLDVPTFMRRQAQKA* |
| Ga0126378_116693942 | 3300010361 | Tropical Forest Soil | VVHQVAQNVREVAPEVPKDDLDVPTFLRRQAQKA* |
| Ga0126379_118575251 | 3300010366 | Tropical Forest Soil | PMQPANVVHQVQQNVRDVSPEVPADDLDVPTFLRRQAQKA* |
| Ga0126381_1035958121 | 3300010376 | Tropical Forest Soil | MQPANVVHQVQQNVRDVSPEVPADDLDVPTFLRRQAQKA* |
| Ga0126350_101336942 | 3300010880 | Boreal Forest Soil | GREVEEPVPQQQTLPNVVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA* |
| Ga0137389_116301381 | 3300012096 | Vadose Zone Soil | MQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA* |
| Ga0137388_109519871 | 3300012189 | Vadose Zone Soil | QQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA* |
| Ga0137363_100678603 | 3300012202 | Vadose Zone Soil | EITEAPMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA* |
| Ga0137362_110836201 | 3300012205 | Vadose Zone Soil | ESQTVVHQVQQNVRDVAQDVPADDLDVPTFLRRQAQKA* |
| Ga0137380_101358551 | 3300012206 | Vadose Zone Soil | VVHQVQQNVHDVGHDVPADDLDVPTFLRRQAQKA* |
| Ga0137380_101814533 | 3300012206 | Vadose Zone Soil | PDEPVQRAVPNVVHQVQQNVRDVSPDVPADDLDVPTFLRRQAQKA* |
| Ga0137360_100285371 | 3300012361 | Vadose Zone Soil | EEPVHHATSNVVHQVQQNVREVSHDVPVDDLDVPTFLRRQAQKA* |
| Ga0137360_109365191 | 3300012361 | Vadose Zone Soil | QANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA* |
| Ga0137361_113384382 | 3300012362 | Vadose Zone Soil | LPNVVHQVQQNVREVGQDVPSDDLDVPTFLRRQAQKA* |
| Ga0137390_116008311 | 3300012363 | Vadose Zone Soil | EQQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA* |
| Ga0137419_109501371 | 3300012925 | Vadose Zone Soil | SPQQQQLPNIVHQVQQNVRDVSHEVPADDLDVPTFLRRQAQKA* |
| Ga0137410_100949931 | 3300012944 | Vadose Zone Soil | TSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA* |
| Ga0126369_101040514 | 3300012971 | Tropical Forest Soil | SPNAPNVVHQVTQTVREAAPEMPKDDLDVPTFLRRQAQKA* |
| Ga0134110_101388701 | 3300012975 | Grasslands Soil | VVHQVQQNVREVGQDVPADDLDVPTFLRRQAQKA* |
| Ga0157372_105370531 | 3300013307 | Corn Rhizosphere | PPPQPTPNVVHQVQENVREVSRETPAMDDLDVPTFLRRAQKA* |
| Ga0182015_109502942 | 3300014495 | Palsa | SRNVSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA* |
| Ga0137403_100161791 | 3300015264 | Vadose Zone Soil | VVHQVQENVREVAREVPADDLDVPTFLRRHAQKA* |
| Ga0182041_103538223 | 3300016294 | Soil | PPANAVQQQVSKNVREASPEVPKDDLDVPTFMRRQAQKA |
| Ga0187816_101032701 | 3300017995 | Freshwater Sediment | NVVHQVTQNVRESAHEVPKDDLDVPTFLRRQAQKA |
| Ga0187765_106536881 | 3300018060 | Tropical Peatland | ELPAPPPNVVHQVAQNVRDVAPEVPKDDLDVPTFLRRQAQKA |
| Ga0187772_107140851 | 3300018085 | Tropical Peatland | GREVPMAPEQTNVVQQVAHNVADVAPEMAADDLDVPTFLRRQAKAGA |
| Ga0210407_102495861 | 3300020579 | Soil | VNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0210407_107458471 | 3300020579 | Soil | NVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0210407_109166831 | 3300020579 | Soil | PQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0210403_101921113 | 3300020580 | Soil | SVVHQVAQNVREVSPEVPKDDLDVPTFLRRQAQKA |
| Ga0210399_110354981 | 3300020581 | Soil | LPEPPQQVNVVHQVQENVREVGREVPADDLDVPTFLRRHAQTA |
| Ga0210399_115363021 | 3300020581 | Soil | NVVHQVQQNIRDVSQDVPADDLDVPTFLRRQAQKA |
| Ga0210401_105540591 | 3300020583 | Soil | ISDVPEPPQPQQHVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0210401_108646381 | 3300020583 | Soil | QQTNVVQQVSRNVADVRSEVPADDLDVPTFLRRQAQKA |
| Ga0215015_100640531 | 3300021046 | Soil | QPQQANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA |
| Ga0179596_104310282 | 3300021086 | Vadose Zone Soil | MPAQHDLPNVVHQVQQNVREVSQAVPSDDLDVPTFLRRQAQKA |
| Ga0210396_100052881 | 3300021180 | Soil | ANVVHQVQQPVREVSREVPAVDDLDVPTFLRRQAQKA |
| Ga0210389_115067701 | 3300021404 | Soil | NIVHSQHAREVARDVAPEPSKDDLDVPTFLRRQAQKA |
| Ga0210387_117372732 | 3300021405 | Soil | EQPPAQVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0210394_101835471 | 3300021420 | Soil | APPQTNVVQQVARNVSDVVPEMPSDDLDVPTFLRRQAKAGA |
| Ga0210394_102288813 | 3300021420 | Soil | PPANVVHQVQQPVREVSREVPAVDDLDVPTFLRRQAQKA |
| Ga0210384_109132341 | 3300021432 | Soil | APQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0210398_104050084 | 3300021477 | Soil | RNVNEVVHQVARNVSQVHEVPADDLDVPTFLRRQAQKA |
| Ga0210402_105454893 | 3300021478 | Soil | NAANVVHQVQQNIREVSHEVPADDLDVPTFLRRQAQKA |
| Ga0210402_116899331 | 3300021478 | Soil | KAGRDIPEAPVQQAPPNIVHQVQQNVREVNHDVPADDLDVPTFLRRQAQKA |
| Ga0222728_10260661 | 3300022508 | Soil | QQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0224551_10849612 | 3300023259 | Soil | VSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA |
| Ga0209399_103974581 | 3300025157 | Thermal Springs | VSARSNSSVVDEVTRNVSGLAHDVAADDLDVPTFLRRQASKA |
| Ga0208563_10243691 | 3300025501 | Peatland | NVVHQVAQNVREAAQEVPKDDLDVPTFLRRQAQKA |
| Ga0208457_10493741 | 3300025812 | Peatland | NVVHQVAQNVRDAAQEVPKDDLDVPTFLRRQAQKA |
| Ga0207707_102072143 | 3300025912 | Corn Rhizosphere | NVVHQVQQNVRDVSRDVPADDLDVPTFLRRQAQKA |
| Ga0207665_101664293 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SESQTVVHQVQQNVRDVAQDVPADDLDVPTFLRRQAQKA |
| Ga0207665_106635863 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0207665_115388282 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | HEVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0207703_108054252 | 3300026035 | Switchgrass Rhizosphere | VVHEAPQTVVHQVQQNVRDVAHEVPADDLDVPTFLRRQATQKA |
| Ga0209267_11172213 | 3300026331 | Soil | KTWKAGREIPDMPMQQALPNAVHQVQQSVREVSPDVPADDLDVPTFLRRQAQKA |
| Ga0209057_10802693 | 3300026342 | Soil | EPPMPAIQQSANVVHQVQQSVCDVSQEVPTDDLDVPTFLRRQAQKA |
| Ga0209524_11244542 | 3300027521 | Forest Soil | QKPSFLPKTWKAGREVAEEPPPQPPNVVHQVQQNVPEVSREVPAPVDDLDVPTFLRRQAQKA |
| Ga0209329_10338944 | 3300027605 | Forest Soil | PANVVHQVQQNVREVSREVPAVDDLDIPTFLRRQAQKA |
| Ga0209076_10601371 | 3300027643 | Vadose Zone Soil | MHHATSNVVHQVQQNVREVSHEVPADDLDVPTFLRRQAQKA |
| Ga0209736_11853211 | 3300027660 | Forest Soil | WKAGREVAEEPPPQPPNVVHQVQQNVPEVSREVPAPVDDLDVPTFLRRQAQKA |
| Ga0209588_10858411 | 3300027671 | Vadose Zone Soil | HQANVVHQVQENVREVGREVPADDLDVPTFLRRHAQKA |
| Ga0209011_10635071 | 3300027678 | Forest Soil | QQPHQQANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0209447_100107814 | 3300027701 | Bog Forest Soil | QQLPNVVHQVNENVREVSREVSREVPSDDLDVPTFMRRQAQKA |
| Ga0209180_100326241 | 3300027846 | Vadose Zone Soil | EITEAPMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA |
| Ga0209166_103471232 | 3300027857 | Surface Soil | EPPQQQPQQQANVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0209283_100576243 | 3300027875 | Vadose Zone Soil | PMQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA |
| Ga0209283_101759222 | 3300027875 | Vadose Zone Soil | MQQTLPNVVHQVQQNVREVGEDVPADDLDVPTFLRRQAQKA |
| Ga0209006_106170791 | 3300027908 | Forest Soil | VPNVVHQVQENVRDVSRDTPAMDDLDVPTFLRRAQKA |
| Ga0209526_103665041 | 3300028047 | Forest Soil | PAHVAPQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0137415_105716552 | 3300028536 | Vadose Zone Soil | QPHEVNIVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0302224_100713013 | 3300028759 | Palsa | SEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA |
| Ga0222749_100938681 | 3300029636 | Soil | PNIVHQVQQNIREVNHEVPADDLDVPTFLRRQAQKA |
| Ga0311355_100199141 | 3300030580 | Palsa | VSRNVSEVVHQVARNVSDVREVPADDLDVPTFLRRQAQKA |
| Ga0302324_1003943473 | 3300031236 | Palsa | PNVVHHQVHENVREVSREVNREVPSDDLDVPTFMRRQAQKA |
| Ga0318516_102784982 | 3300031543 | Soil | LQPPANAVQQVSKNVREASPEVPKDDLDVPTFLRRQAQKA |
| Ga0310915_108138952 | 3300031573 | Soil | SIVNQVKQNVREVAPETHKDDLDVPTFLRRQAQKA |
| Ga0306917_107691632 | 3300031719 | Soil | GNVVHQVAKNVREAAPEAPKDDLDVPTFLRRQAQKA |
| Ga0307475_101415651 | 3300031754 | Hardwood Forest Soil | PPQQVNVVHQVQENVREVAREVPADDLDVPTFLRRHAQKA |
| Ga0307473_109836101 | 3300031820 | Hardwood Forest Soil | SNEQQTVVHQVQQNVRDVAREVPGDDLDVPTFLRRQAQKA |
| Ga0307479_102179501 | 3300031962 | Hardwood Forest Soil | GRDVPEPPQPPQQANIVHEVQENVREVGREVPADDLDVPTFLRRHAQKA |
| Ga0307479_113721721 | 3300031962 | Hardwood Forest Soil | QTVVHQVQQNVRDVAREVPGADLDVPTFLRRQAQKA |
| Ga0306922_105918971 | 3300032001 | Soil | PPANVVHQVAKNVREASPEVPKDDLDVPTFLRRQAQKA |
| Ga0335085_102873031 | 3300032770 | Soil | GAPLAQQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0335082_114938702 | 3300032782 | Soil | PLAQQQTNVVQQVARNVREAAPEMPSDDLDVPTFLRRQAQKA |
| Ga0335079_105514072 | 3300032783 | Soil | PSVVHQVAQNVRESAHEMPKDDLDVPTFLRRQAQKA |
| Ga0335078_123662232 | 3300032805 | Soil | AAPPNVVHQVAQNVRETAHEVPKDDLDVPTFLRRQAQKA |
| Ga0335081_101691491 | 3300032892 | Soil | VVQQVSRNVGDVLPEMPADDLDVPTFLRRQAHKAGA |
| Ga0335072_115573802 | 3300032898 | Soil | PNVVNQVKQNVREVREVTPEVAKDDLDVPTFLRRQAQKA |
| Ga0335083_107153892 | 3300032954 | Soil | WKVEPEIAEAEPAPPPPQQVPNVVHQVQENVREVSREAAMDDLDVPTFLRRAQKA |
| Ga0335076_116327291 | 3300032955 | Soil | PPPQQVPNVVHQVQENVREVSREAAMDDLDVPTFLRRAQKA |
| Ga0335077_115692391 | 3300033158 | Soil | QELPVAPPNVVHQVAQNVREVAPDVPKDDLDVPTFLRRQAQKA |
| ⦗Top⦘ |