| Basic Information | |
|---|---|
| Family ID | F068918 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 27.42 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 98.39 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (70.968 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.323 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.290 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.92% β-sheet: 9.23% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.19 % |
| Unclassified | root | N/A | 25.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10182755 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 724 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10187349 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 710 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10232440 | Not Available | 593 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10251771 | Not Available | 555 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10167241 | Not Available | 637 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10210883 | Not Available | 535 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10261973 | Not Available | 521 | Open in IMG/M |
| 3300000973|BBAY93_10044411 | Not Available | 1165 | Open in IMG/M |
| 3300001450|JGI24006J15134_10242949 | Not Available | 521 | Open in IMG/M |
| 3300001472|JGI24004J15324_10084140 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 854 | Open in IMG/M |
| 3300001472|JGI24004J15324_10122310 | Not Available | 636 | Open in IMG/M |
| 3300001739|JGI24658J20074_1017754 | Not Available | 579 | Open in IMG/M |
| 3300001740|JGI24656J20076_1010350 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1233 | Open in IMG/M |
| 3300001740|JGI24656J20076_1030857 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 580 | Open in IMG/M |
| 3300005398|Ga0066858_10119719 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 765 | Open in IMG/M |
| 3300005408|Ga0066848_10101644 | Not Available | 782 | Open in IMG/M |
| 3300005428|Ga0066863_10249504 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 621 | Open in IMG/M |
| 3300005430|Ga0066849_10224972 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 726 | Open in IMG/M |
| 3300005595|Ga0066833_10195003 | Not Available | 556 | Open in IMG/M |
| 3300005912|Ga0075109_1275393 | Not Available | 501 | Open in IMG/M |
| 3300005931|Ga0075119_1046187 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1110 | Open in IMG/M |
| 3300006340|Ga0068503_11163658 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 502 | Open in IMG/M |
| 3300006403|Ga0075514_1573238 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 539 | Open in IMG/M |
| 3300006735|Ga0098038_1233626 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 585 | Open in IMG/M |
| 3300006736|Ga0098033_1121678 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 737 | Open in IMG/M |
| 3300006737|Ga0098037_1089333 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1075 | Open in IMG/M |
| 3300006738|Ga0098035_1092169 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1062 | Open in IMG/M |
| 3300006738|Ga0098035_1158489 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 767 | Open in IMG/M |
| 3300006751|Ga0098040_1244936 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 519 | Open in IMG/M |
| 3300006752|Ga0098048_1202177 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 586 | Open in IMG/M |
| 3300006754|Ga0098044_1405583 | Not Available | 512 | Open in IMG/M |
| 3300006789|Ga0098054_1210275 | Not Available | 707 | Open in IMG/M |
| 3300006789|Ga0098054_1285637 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 591 | Open in IMG/M |
| 3300006789|Ga0098054_1355716 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 519 | Open in IMG/M |
| 3300006789|Ga0098054_1359805 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 515 | Open in IMG/M |
| 3300006793|Ga0098055_1321902 | Not Available | 576 | Open in IMG/M |
| 3300006793|Ga0098055_1410439 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 501 | Open in IMG/M |
| 3300006916|Ga0070750_10467282 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 520 | Open in IMG/M |
| 3300006926|Ga0098057_1077275 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 811 | Open in IMG/M |
| 3300006926|Ga0098057_1121549 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 637 | Open in IMG/M |
| 3300006928|Ga0098041_1240293 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 578 | Open in IMG/M |
| 3300006929|Ga0098036_1049291 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1311 | Open in IMG/M |
| 3300007074|Ga0075110_1043849 | Not Available | 1083 | Open in IMG/M |
| 3300007074|Ga0075110_1126732 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 514 | Open in IMG/M |
| 3300007276|Ga0070747_1320654 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 531 | Open in IMG/M |
| 3300007345|Ga0070752_1225231 | Not Available | 738 | Open in IMG/M |
| 3300007756|Ga0105664_1124711 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 628 | Open in IMG/M |
| 3300008012|Ga0075480_10077780 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1892 | Open in IMG/M |
| 3300008050|Ga0098052_1269197 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 648 | Open in IMG/M |
| 3300008219|Ga0114905_1262172 | Not Available | 540 | Open in IMG/M |
| 3300008221|Ga0114916_1138053 | Not Available | 556 | Open in IMG/M |
| 3300009193|Ga0115551_1276001 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 739 | Open in IMG/M |
| 3300009414|Ga0114909_1039748 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1431 | Open in IMG/M |
| 3300009425|Ga0114997_10430814 | Not Available | 709 | Open in IMG/M |
| 3300009435|Ga0115546_1321466 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 527 | Open in IMG/M |
| 3300009443|Ga0115557_1224548 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 727 | Open in IMG/M |
| 3300009472|Ga0115554_1105497 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1195 | Open in IMG/M |
| 3300009481|Ga0114932_10786477 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 552 | Open in IMG/M |
| 3300009481|Ga0114932_10882451 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 516 | Open in IMG/M |
| 3300009593|Ga0115011_10770340 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 794 | Open in IMG/M |
| 3300009593|Ga0115011_10968693 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 717 | Open in IMG/M |
| 3300010150|Ga0098056_1148635 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 791 | Open in IMG/M |
| 3300010153|Ga0098059_1422349 | Not Available | 502 | Open in IMG/M |
| 3300010155|Ga0098047_10330798 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 573 | Open in IMG/M |
| 3300010300|Ga0129351_1377027 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 530 | Open in IMG/M |
| 3300010368|Ga0129324_10393738 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 536 | Open in IMG/M |
| 3300011013|Ga0114934_10337196 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 676 | Open in IMG/M |
| 3300011254|Ga0151675_1025559 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 815 | Open in IMG/M |
| 3300012953|Ga0163179_10206912 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1505 | Open in IMG/M |
| 3300012954|Ga0163111_12524591 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 523 | Open in IMG/M |
| 3300017713|Ga0181391_1062825 | Not Available | 862 | Open in IMG/M |
| 3300017717|Ga0181404_1160529 | Not Available | 541 | Open in IMG/M |
| 3300017731|Ga0181416_1088404 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 737 | Open in IMG/M |
| 3300017733|Ga0181426_1131045 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 506 | Open in IMG/M |
| 3300017757|Ga0181420_1145711 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 708 | Open in IMG/M |
| 3300017757|Ga0181420_1174872 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 632 | Open in IMG/M |
| 3300017769|Ga0187221_1098551 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 894 | Open in IMG/M |
| 3300017772|Ga0181430_1209707 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 555 | Open in IMG/M |
| 3300017773|Ga0181386_1116993 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 825 | Open in IMG/M |
| 3300017779|Ga0181395_1176605 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 668 | Open in IMG/M |
| 3300017786|Ga0181424_10014098 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 3452 | Open in IMG/M |
| 3300020165|Ga0206125_10131344 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1025 | Open in IMG/M |
| 3300020282|Ga0211667_1066732 | Not Available | 891 | Open in IMG/M |
| 3300022178|Ga0196887_1109759 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 606 | Open in IMG/M |
| 3300022843|Ga0222631_1009153 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1744 | Open in IMG/M |
| 3300022843|Ga0222631_1019025 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300025078|Ga0208668_1076010 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 600 | Open in IMG/M |
| 3300025096|Ga0208011_1089526 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 664 | Open in IMG/M |
| 3300025103|Ga0208013_1092226 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 772 | Open in IMG/M |
| 3300025109|Ga0208553_1100969 | Not Available | 668 | Open in IMG/M |
| 3300025112|Ga0209349_1050105 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300025118|Ga0208790_1165259 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 604 | Open in IMG/M |
| 3300025122|Ga0209434_1040331 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1486 | Open in IMG/M |
| 3300025128|Ga0208919_1213042 | Not Available | 575 | Open in IMG/M |
| 3300025137|Ga0209336_10149127 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 619 | Open in IMG/M |
| 3300025137|Ga0209336_10189633 | Not Available | 513 | Open in IMG/M |
| 3300025138|Ga0209634_1205565 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 749 | Open in IMG/M |
| 3300025237|Ga0208031_1032662 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 682 | Open in IMG/M |
| 3300025268|Ga0207894_1011807 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1649 | Open in IMG/M |
| 3300025268|Ga0207894_1029525 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 981 | Open in IMG/M |
| 3300025274|Ga0208183_1093355 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 555 | Open in IMG/M |
| 3300025277|Ga0208180_1131682 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 522 | Open in IMG/M |
| 3300025286|Ga0208315_1148979 | Not Available | 523 | Open in IMG/M |
| 3300025645|Ga0208643_1025705 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
| 3300025652|Ga0208134_1178896 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 510 | Open in IMG/M |
| 3300025890|Ga0209631_10479444 | Not Available | 558 | Open in IMG/M |
| 3300025892|Ga0209630_10206497 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 951 | Open in IMG/M |
| 3300025892|Ga0209630_10358239 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 644 | Open in IMG/M |
| 3300026257|Ga0208407_1228124 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 535 | Open in IMG/M |
| 3300026269|Ga0208766_1088542 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 880 | Open in IMG/M |
| 3300026503|Ga0247605_1095804 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 726 | Open in IMG/M |
| 3300027752|Ga0209192_10225925 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 702 | Open in IMG/M |
| 3300027813|Ga0209090_10514964 | Not Available | 555 | Open in IMG/M |
| 3300027839|Ga0209403_10539828 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 580 | Open in IMG/M |
| 3300027847|Ga0209402_10449368 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 764 | Open in IMG/M |
| 3300028022|Ga0256382_1142361 | Not Available | 575 | Open in IMG/M |
| 3300029448|Ga0183755_1101416 | Not Available | 565 | Open in IMG/M |
| 3300031142|Ga0308022_1047209 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1348 | Open in IMG/M |
| 3300031519|Ga0307488_10447456 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 785 | Open in IMG/M |
| 3300032278|Ga0310345_10566799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
| 3300032820|Ga0310342_102591964 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 606 | Open in IMG/M |
| 3300034374|Ga0348335_064184 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1325 | Open in IMG/M |
| 3300034375|Ga0348336_173171 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 611 | Open in IMG/M |
| 3300034418|Ga0348337_081176 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1132 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.32% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 9.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.87% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.87% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.23% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.23% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.42% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.42% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.61% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.81% |
| Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.81% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.81% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001739 | Marine viral communities from the Deep Pacific Ocean - MSP-121 | Environmental | Open in IMG/M |
| 3300001740 | Marine viral communities from the Deep Pacific Ocean - MSP-114 | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101827553 | 3300000101 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEA |
| DelMOSum2010_101873494 | 3300000101 | Marine | VIKRKARTIPFGYKLAEDPDYIEPIESELEALEEA |
| DelMOSum2010_102324402 | 3300000101 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFLKT |
| DelMOSum2010_102517711 | 3300000101 | Marine | LIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFL |
| DelMOSum2011_101672413 | 3300000115 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKF |
| DelMOSum2011_102108831 | 3300000115 | Marine | LIKRKARTIPFGYKLAEDTDYIEPIESELEALEEA |
| DelMOSpr2010_102619731 | 3300000116 | Marine | LIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFLKT |
| BBAY93_100444116 | 3300000973 | Macroalgal Surface | MELIKRKARTIPFGYKLAEDTDYLVPIESELEALEQA |
| JGI24006J15134_102429491 | 3300001450 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELEALEEAKK |
| JGI24004J15324_100841403 | 3300001472 | Marine | MESIKRKARVIPFGYKLSDDTDYIQPVQEELDALE |
| JGI24004J15324_101223102 | 3300001472 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFLK |
| JGI24658J20074_10177542 | 3300001739 | Deep Ocean | MLLRRKARTIPFGYKLANDPDYIEPVKEELDALNEAKDYLNNLLLP* |
| JGI24656J20076_10103501 | 3300001740 | Deep Ocean | VIKRKARTIPFGYKTDDTGDYLIPIESELKALEEA |
| JGI24656J20076_10308573 | 3300001740 | Deep Ocean | VGELSVLENKIKRKARTXPFGYKLAEDTDYIEPIESELQALQ |
| Ga0066858_101197191 | 3300005398 | Marine | VIKRKARTIPFGYKTDDTGDYLIPIESELKALEEAKNYLK |
| Ga0066848_101016443 | 3300005408 | Marine | VIKRKARTIPFGYKTDDTGDYLIPIESELKALEEAKNYLKTCS |
| Ga0066863_102495043 | 3300005428 | Marine | MELIKRKARTIPFGYKLAEDINYLEPIQEQLDALKQAINYLE |
| Ga0066849_102249721 | 3300005430 | Marine | LLQKIKRKARTIPFGYKIDDTGNYLVPIESELEALEQAKN |
| Ga0066833_101950031 | 3300005595 | Marine | MRLRRKARTIPFGYKLSDDPDYIEPVQEELDALDE |
| Ga0075109_12753932 | 3300005912 | Saline Lake | VIKRKSRTIPFGYKLAEDTDYIEPIQFELEALEEAKNFLKTC |
| Ga0075119_10461875 | 3300005931 | Saline Lake | MPMHIIKRKSRTIPFGYKLAEDTDYIEPIQFELEALE |
| Ga0068503_111636581 | 3300006340 | Marine | VILYNKIKRKSRIIPFGYKIDETENYLIRIESELQALE |
| Ga0075514_15732381 | 3300006403 | Aqueous | MESIKRKARVIPFGYKLADDTDYIEPVQEELDALEEAKEYLNNC |
| Ga0098038_12336263 | 3300006735 | Marine | VELQKIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFL |
| Ga0098033_11216783 | 3300006736 | Marine | LLEKIKRKARTIPFGYKTDDTGDYLIPIESELKALEEA |
| Ga0098037_10893331 | 3300006737 | Marine | LLLQSKIKRKARTIPFGYKLAEDPDYIEPIESELEALEEAKKFLKT |
| Ga0098035_10921691 | 3300006738 | Marine | LQVLIKRKARIIPFGYKIEDTGDYLVPIESELAALEQAQEYLKTC |
| Ga0098035_11584891 | 3300006738 | Marine | LGKIKRKARTIPFGYKIDETGDYLIPIESELEALEKAKEYLKTC |
| Ga0098040_12449361 | 3300006751 | Marine | VIKRKARTIPFGYKIDDTGDYLIPIESELEALEQAKNY |
| Ga0098048_12021772 | 3300006752 | Marine | LSLQIKIKRKARTIPFGYRLAEDPDYIEPIQSELDALEE |
| Ga0098044_14055833 | 3300006754 | Marine | LLQKIKRKARTIPFGYKIDDTGNYLIPIESELEALEQA |
| Ga0098054_12102753 | 3300006789 | Marine | VIKRKARTIPFGYKIDDTGNYLIPIESELEALEQAKNYLKT |
| Ga0098054_12856371 | 3300006789 | Marine | LLQKIKRKARTIPFGYKIDDTGNYLIPIESELEALEQAKNYLKT |
| Ga0098054_13557163 | 3300006789 | Marine | VLKRRARTIPFGYKLAEDTDYLVPIESELEALEQAKNYLK |
| Ga0098054_13598051 | 3300006789 | Marine | LLQKIKRKARTIPFGYKIDDTGDYIVPIESELEALEQAKNY |
| Ga0098055_13219021 | 3300006793 | Marine | VIKRKARTIPFGYKIDDTGNYLIPIESELEALEQAKNY |
| Ga0098055_14104393 | 3300006793 | Marine | LVQKNSLLQKIKRKARTIPFGYKIDDTGDYLVPIESELEALE |
| Ga0070750_104672821 | 3300006916 | Aqueous | VIKRKARTIPFGYKLAEDPDYIEPIESELEALEEAKKF |
| Ga0098057_10772754 | 3300006926 | Marine | LIKIKRKARTIPFGYKIDETGDYLIPIESELEALQEAKNYLKT |
| Ga0098057_11215491 | 3300006926 | Marine | VLKRKARTIPFGYKLAEDTDYIEPIESELQALEQAKIYLKTCS |
| Ga0098041_12402933 | 3300006928 | Marine | VIKRKARTIPFGYKLSEDTDYIEPIESELQALEEA |
| Ga0098036_10492911 | 3300006929 | Marine | VIKRKARTIPFGYKVDDTGNYLIPIESELEALEKAKEY |
| Ga0075110_10438494 | 3300007074 | Saline Lake | MPMHIIKRKSRTIPFGYKLAEDTDYIEPIQFELEALEEAKNFLKTC |
| Ga0075110_11267323 | 3300007074 | Saline Lake | MHIKRKLIKRKSRTIPFGYKLAEDTDYIEPIQFELEALEEAKNFLKTC |
| Ga0070747_13206543 | 3300007276 | Aqueous | VIKRKARTIPFGYRLAEDTDYIEPIQSELDALEEA |
| Ga0070752_12252313 | 3300007345 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEES |
| Ga0105664_11247111 | 3300007756 | Background Seawater | LEKIKRKARTIPFGYKLSEDTDYIEPIESELKALE |
| Ga0075480_100777801 | 3300008012 | Aqueous | VIKRKARTIPFGYKLAEDPDYIEPIESELEALEEAKKFLKTC |
| Ga0098052_12691973 | 3300008050 | Marine | MSLIKRKARTIPFGYKLAEDTDYLESIPEELEALEQAMKYLE |
| Ga0114905_12621721 | 3300008219 | Deep Ocean | LLLKRKARTIPFGYKISDDPDYIEPVQEELDALDE |
| Ga0114916_11380533 | 3300008221 | Deep Ocean | LIKRKSRTIPFGYKLAEDTDYIEPIESELEALEEAKNFL |
| Ga0115551_12760013 | 3300009193 | Pelagic Marine | LLHPYKIKRKARTIPFGYKLAEDTDYIEPIQSELDALEE |
| Ga0114909_10397484 | 3300009414 | Deep Ocean | LLEKIKRKARTIPFGYKIDDTGDYLIPIESELKALEEAKNYLK |
| Ga0114997_104308141 | 3300009425 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQFELDALEEAKKF |
| Ga0115546_13214663 | 3300009435 | Pelagic Marine | VIKRKARTIPFGYKLTEDTDYIEPIESELDALEEA |
| Ga0115557_12245483 | 3300009443 | Pelagic Marine | LLLQSKIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKK |
| Ga0115554_11054973 | 3300009472 | Pelagic Marine | LLLQSKIKRKARTIPFGYKLAEDPDYIEPIESELEALEEA |
| Ga0114932_107864771 | 3300009481 | Deep Subsurface | LVQKNSLLQKIKRKARTVPFGYKKDETGEYLLPIESELEALEQAKN |
| Ga0114932_108824513 | 3300009481 | Deep Subsurface | LLQKIKRKARTIPFGYKIDDTGNYLIPIESELRALE |
| Ga0115011_107703404 | 3300009593 | Marine | MELIRRKARTIPFGYKLAEDTDYIVPIESELEALEQAKNYLK |
| Ga0115011_109686932 | 3300009593 | Marine | LTKIKRKARTIPFGYKLSEDKDYIEPIESELKALEK |
| Ga0098056_11486353 | 3300010150 | Marine | VIKRKARTIPFGYKIDETGDYLIPIESELEALEKAKEYLKTCSL |
| Ga0098059_14223493 | 3300010153 | Marine | VEKIKRKARTIPFGYKIDDTGDYIVPIESELEALE |
| Ga0098047_103307983 | 3300010155 | Marine | LLEKIKRKARTIPFGYKIDDTGNYLIPIESELEALEQAKN |
| Ga0129351_13770273 | 3300010300 | Freshwater To Marine Saline Gradient | VIKRKARTIPFGYKLAEDPDYIEPIESELEALEEAKK |
| Ga0129324_103937381 | 3300010368 | Freshwater To Marine Saline Gradient | MESIKRKARVIPFGYKLADDTDSIEPVQEELDALEEAKEYLNNC |
| Ga0114934_103371961 | 3300011013 | Deep Subsurface | MLKRRTSTIPFGYKLSDDPKYIEPIQTELDALEEAKQFTNNCS |
| Ga0151675_10255594 | 3300011254 | Marine | MESIKRKARVIPFGYKLSDDTDYIQPVQEELDALEEA |
| Ga0163179_102069127 | 3300012953 | Seawater | MESIKRKARVIPFGYKLEENTDYIEPIQEELDALE |
| Ga0163111_125245911 | 3300012954 | Surface Seawater | LLLQSKIKRRARTVPFGYKKDETGEYLLPIESELKALEQAKN |
| Ga0181391_10628254 | 3300017713 | Seawater | VIKRKARTIPFGYKLAEDPDYMEPIQSELDALEEAKS |
| Ga0181404_11605291 | 3300017717 | Seawater | VIKRKARTIPFGYKLAEDPDYIEPIESELKALEEAKEFLKTC |
| Ga0181416_10884042 | 3300017731 | Seawater | LLLQSKIKRKARTIPFGYKLAEDTDYIEPIESELKALEEAKEFL |
| Ga0181426_11310453 | 3300017733 | Seawater | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAK |
| Ga0181420_11457113 | 3300017757 | Seawater | VELQKIKRKARTIPFGYKLAEDTDYIEPIESELEALEEA |
| Ga0181420_11748722 | 3300017757 | Seawater | LLLQSKIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAK |
| Ga0187221_10985512 | 3300017769 | Seawater | LSLQIKIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEA |
| Ga0181430_12097073 | 3300017772 | Seawater | VIKRKARTIPFGYKLAEDTDYIEPIESELKALEEA |
| Ga0181386_11169931 | 3300017773 | Seawater | LSLQIKIKRKARTIPFGYKLAEDPDYIEPIQSELEALEEAK |
| Ga0181395_11766053 | 3300017779 | Seawater | MESIKRKARVIPFGYKLADDTDYIEPVQEELDALEEA |
| Ga0181424_100140981 | 3300017786 | Seawater | VELQKIKRKARTIPFGYKLAEDTDYIEPIESELKTLEEGKEIFKKCS |
| Ga0206125_101313441 | 3300020165 | Seawater | VIKRKARTIPFGYKLAEDTDYIEPIESELKALEEAKEFLK |
| Ga0211667_10667324 | 3300020282 | Marine | MQRIKRKARVIPFGYKESDDPDYIEPVQLELDALE |
| Ga0196887_11097593 | 3300022178 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKF |
| Ga0222631_10091531 | 3300022843 | Saline Water | MHIKRKLIKRKSRTIPFGYKLAEDTDYIEPIQFELEALEEAKN |
| Ga0222631_10190251 | 3300022843 | Saline Water | MVIKRKSRTIPFGYKLAEDTDYIEPIQFELEALEEA |
| Ga0208668_10760103 | 3300025078 | Marine | VIKRKARTIPFGYKIDDTGDYLIPIESELEALEQA |
| Ga0208011_10895261 | 3300025096 | Marine | LEKIKRKARTIPFGYKIDDTGNYLIPIESELKALEE |
| Ga0208013_10922263 | 3300025103 | Marine | LLQKIKRKARTIPFGYKIDDTGNYLIPIESELEALEQAKNYLKTC |
| Ga0208553_11009691 | 3300025109 | Marine | VIKRKARTIPFGYKTDDTGDYLIPIESELKALEEAKN |
| Ga0209349_10501053 | 3300025112 | Marine | LTKIKRKARTIPFGYKLSEDTDYIEPIESELQALEQ |
| Ga0208790_11652591 | 3300025118 | Marine | MHIKRKARTIPFGYKLAEDTDYIVPIESELEALEQAKNY |
| Ga0209434_10403316 | 3300025122 | Marine | LLEKIKRKARTIPFGYKIDDTGNYLIPIESELEALE |
| Ga0208919_12130421 | 3300025128 | Marine | VIKRKARTIPFGYKLAEDPDYIEPIQSELDALEEA |
| Ga0209336_101491273 | 3300025137 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELEALEEAK |
| Ga0209336_101896333 | 3300025137 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFLKTC |
| Ga0209634_12055651 | 3300025138 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKK |
| Ga0208031_10326621 | 3300025237 | Deep Ocean | LNLAKIKRKSRTIPFGYKLAEDVVYIEPIQSELEALEEA |
| Ga0207894_10118071 | 3300025268 | Deep Ocean | VIKRKARTIPFGYKLAEDTNYLVPIESELEALEEAKNYLK |
| Ga0207894_10295251 | 3300025268 | Deep Ocean | VIKRKARTIPFGYKLAKDTDYIEPIESELQALEQAKIYLKTCS |
| Ga0208183_10933553 | 3300025274 | Deep Ocean | LGKIKRKARTIPFGYKIDETGDYLIPIESELEALQEAKNYLK |
| Ga0208180_11316823 | 3300025277 | Deep Ocean | LGKIKRKARTIPFGYKIDETGDYLIPIESELEALEKAKEY |
| Ga0208315_11489791 | 3300025286 | Deep Ocean | VIKRKARTIPFGYKTDDTGDYLIPIESELKALEEAKNYLKT |
| Ga0208643_10257054 | 3300025645 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFLKTC |
| Ga0208134_11788963 | 3300025652 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFL |
| Ga0209631_104794441 | 3300025890 | Pelagic Marine | LIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAK |
| Ga0209630_102064971 | 3300025892 | Pelagic Marine | LSLQIKIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFLKT |
| Ga0209630_103582393 | 3300025892 | Pelagic Marine | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKEFLKTC |
| Ga0208407_12281241 | 3300026257 | Marine | LLPQSKIKRKARTIPFGYKLAEDTDYIEPIESELEALEKAKE |
| Ga0208766_10885421 | 3300026269 | Marine | VLKRKARTIPFGYKLSENTDFIEPIESELEALQEAK |
| Ga0247605_10958041 | 3300026503 | Seawater | LLLQSKIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKKFLKT |
| Ga0209192_102259253 | 3300027752 | Marine | LSHQYKIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFLKTC |
| Ga0209090_105149643 | 3300027813 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIQSELDALEEAKKFLKT |
| Ga0209403_105398281 | 3300027839 | Marine | MELKKIPRKSRVIPFGYKLAEDPKYIEPIEAELLALEEAKNYLK |
| Ga0209402_104493681 | 3300027847 | Marine | MQLIKRKARVIPFGYKLAEDSDYIEPVQTELDALEEAK |
| Ga0256382_11423611 | 3300028022 | Seawater | LEKIKRKARTIPFGYKIDDTGNYLVPIESELEALEQAKNYL |
| Ga0183755_11014161 | 3300029448 | Marine | VIKRKARTIPFGYKIDDTGNYLVPIESELEALEQAKNYLKTCSL |
| Ga0308022_10472091 | 3300031142 | Marine | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKNF |
| Ga0307488_104474561 | 3300031519 | Sackhole Brine | LSHLSKIKRKARTIPFGYKISEDTDYIEPIQSELDAL |
| Ga0310345_105667991 | 3300032278 | Seawater | LLPQSKIKRKARTIPFGYKLAEDTDYIEPIESELQALEKAKEYLKT |
| Ga0310342_1025919643 | 3300032820 | Seawater | MIKRKARTIPFGYKLSEDTDYIEPIESELQALEKAKEY |
| Ga0348335_064184_2_106 | 3300034374 | Aqueous | MIKRKARTIPFGYKLAEDPDYIEPIESELEALEEA |
| Ga0348336_173171_1_123 | 3300034375 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKEFLKT |
| Ga0348337_081176_1021_1131 | 3300034418 | Aqueous | VIKRKARTIPFGYKLAEDTDYIEPIESELEALEEAKK |
| ⦗Top⦘ |