NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068902

Metagenome / Metatranscriptome Family F068902

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068902
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 92 residues
Representative Sequence HVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYAQDNTLVQ
Number of Associated Samples 94
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.83 %
% of genes near scaffold ends (potentially truncated) 75.81 %
% of genes from short scaffolds (< 2000 bps) 97.58 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.968 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(43.548 % of family members)
Environment Ontology (ENVO) Unclassified
(60.484 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.839 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 17.50%    β-sheet: 0.00%    Coil/Unstructured: 82.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.97 %
UnclassifiedrootN/A4.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005516|Ga0066831_10038814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1292Open in IMG/M
3300006356|Ga0075487_1329127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300006379|Ga0075513_1309711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300006384|Ga0075516_1000384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300006393|Ga0075517_1474198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300006397|Ga0075488_1607727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium750Open in IMG/M
3300006403|Ga0075514_1750002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300008832|Ga0103951_10481991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300008952|Ga0115651_1174813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1474Open in IMG/M
3300009436|Ga0115008_10200375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1432Open in IMG/M
3300009441|Ga0115007_10157774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1458Open in IMG/M
3300009606|Ga0115102_10624320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300009677|Ga0115104_10122138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium735Open in IMG/M
3300009677|Ga0115104_10735936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300009679|Ga0115105_10234680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300009785|Ga0115001_10425561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium827Open in IMG/M
3300010883|Ga0133547_11493290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1269Open in IMG/M
3300010981|Ga0138316_10332549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300010981|Ga0138316_10403274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300010985|Ga0138326_10005690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300010985|Ga0138326_11305969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300010987|Ga0138324_10397758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300012524|Ga0129331_1321091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300018622|Ga0188862_1012180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300018725|Ga0193517_1076540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300018765|Ga0193031_1028834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani864Open in IMG/M
3300018765|Ga0193031_1069899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300018862|Ga0193308_1059424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium626Open in IMG/M
3300018871|Ga0192978_1102229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300018913|Ga0192868_10078234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300018967|Ga0193178_10029247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium751Open in IMG/M
3300018982|Ga0192947_10160071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300018989|Ga0193030_10096832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani900Open in IMG/M
3300018989|Ga0193030_10106564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani868Open in IMG/M
3300018989|Ga0193030_10114978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300018989|Ga0193030_10116794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani838Open in IMG/M
3300018989|Ga0193030_10117237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani837Open in IMG/M
3300018989|Ga0193030_10121067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300018989|Ga0193030_10129700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300018989|Ga0193030_10179602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300018989|Ga0193030_10216234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300019031|Ga0193516_10272245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300019032|Ga0192869_10077725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1217Open in IMG/M
3300019032|Ga0192869_10209621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani832Open in IMG/M
3300019036|Ga0192945_10109803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300019045|Ga0193336_10131080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani900Open in IMG/M
3300019048|Ga0192981_10085356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1217Open in IMG/M
3300019048|Ga0192981_10085592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1215Open in IMG/M
3300019048|Ga0192981_10318196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300019050|Ga0192966_10118307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani924Open in IMG/M
3300019123|Ga0192980_1037737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani925Open in IMG/M
3300019125|Ga0193104_1027843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300019149|Ga0188870_10075507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani821Open in IMG/M
3300019149|Ga0188870_10079623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani797Open in IMG/M
3300019253|Ga0182064_1251944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300021169|Ga0206687_1265067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300021350|Ga0206692_1087336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300021355|Ga0206690_10621675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300021359|Ga0206689_10411585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium809Open in IMG/M
3300021866|Ga0063109_111403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300021872|Ga0063132_103538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani840Open in IMG/M
3300021879|Ga0063113_102664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300021887|Ga0063105_1022323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300021889|Ga0063089_1031476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300021890|Ga0063090_1061563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300021898|Ga0063097_1010971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300021902|Ga0063086_1003380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300021902|Ga0063086_1004138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani805Open in IMG/M
3300021912|Ga0063133_1028209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300021913|Ga0063104_1025731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300021924|Ga0063085_1008208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300021925|Ga0063096_1003126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300021927|Ga0063103_1060712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300021928|Ga0063134_1039454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300021928|Ga0063134_1111023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300021928|Ga0063134_1119591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300021939|Ga0063095_1060953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium771Open in IMG/M
3300021943|Ga0063094_1017348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300021943|Ga0063094_1040508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300021950|Ga0063101_1066907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani849Open in IMG/M
3300021950|Ga0063101_1100763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300023694|Ga0228683_1022674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300023696|Ga0228687_1018912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium785Open in IMG/M
3300023696|Ga0228687_1019842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300023704|Ga0228684_1034895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani775Open in IMG/M
3300026182|Ga0208275_1021120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1382Open in IMG/M
3300026458|Ga0247578_1102913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300026462|Ga0247568_1051405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani802Open in IMG/M
3300026503|Ga0247605_1155151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300026504|Ga0247587_1093341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300027810|Ga0209302_10100633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1458Open in IMG/M
3300028137|Ga0256412_1187226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani765Open in IMG/M
3300028233|Ga0256417_1094248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani807Open in IMG/M
3300028282|Ga0256413_1185132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300028335|Ga0247566_1044880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300028575|Ga0304731_11330257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300028575|Ga0304731_11379999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300030671|Ga0307403_10333973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300030702|Ga0307399_10633616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300030912|Ga0073987_11221041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300031062|Ga0073989_13576978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300031622|Ga0302126_10104232Not Available1102Open in IMG/M
3300031710|Ga0307386_10310859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani794Open in IMG/M
3300031710|Ga0307386_10450614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300031717|Ga0307396_10391045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300031725|Ga0307381_10090352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani994Open in IMG/M
3300031725|Ga0307381_10222590Not Available664Open in IMG/M
3300031725|Ga0307381_10361745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300031734|Ga0307397_10251328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300031738|Ga0307384_10245580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300031738|Ga0307384_10262767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300031739|Ga0307383_10279660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300031743|Ga0307382_10261553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300031743|Ga0307382_10491143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300032517|Ga0314688_10332475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300032518|Ga0314689_10345678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300032521|Ga0314680_10456248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium801Open in IMG/M
3300032521|Ga0314680_10472643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani787Open in IMG/M
3300032540|Ga0314682_10402865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300032750|Ga0314708_10482418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300032751|Ga0314694_10251111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium754Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine43.55%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine28.23%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.42%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.81%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066831_1003881413300005516MarineMKSAVLSLLLGASSAHKIRDALHHFNEPTWGETFPSAAGFVQLENTACINSGVTGVTCGPSDAELFATGMNGDEDLGQDIIMKGEKFHYNQAPESTLIQWTPVEVK*
Ga0075487_132912713300006356AqueousSVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0075513_130971113300006379AqueousALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0075516_100038413300006384AqueousLFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0075517_147419813300006393AqueousVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0075488_160772713300006397AqueousGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0075514_175000213300006403AqueousKSVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0103951_1048199113300008832MarineMKSQVIALFIGASLAVKLGDAPPYWPGPTWTYNHPSAAGFVQTSACIDAGVDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYNQNDQSLV*
Ga0115651_117481333300008952MarineMKSAILSLFLGATAAVKLSDAPPYFNEPTWNERMPSAAGLVQTTSACQSAGVDGVTCGPADVQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0115008_1020037523300009436MarineMKSQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ*
Ga0115007_1015777413300009441MarineMKSQVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ*
Ga0115102_1062432013300009606MarineMKSVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASIDGVTCGPSDTQLFATGMNGDEDMGQDITMKGEKFHYKQEDSLVQ*
Ga0115104_1012213813300009677MarineTSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDQTNLQLEWTPVKVK*
Ga0115104_1073593613300009677MarineGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDATLLQTDWTPVKVK*
Ga0115105_1023468023300009679MarineKSQVIALLLGTAAAVKLEDAPAYWPGPTYTLNHPSASGLLQLSSCESAGINGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYAQDS*
Ga0115001_1042556113300009785MarineMKASVFALLVSASSAVSLNDAPHYWPGPTYTQNHPSSAGFLQTSSCVSSGQLGVTCGPSDIELFATGMNGDEDLAQDITMKGDKFHYQQEESLAQWTPVVVK*
Ga0133547_1149329013300010883MarineMKASVFALLVASATAVSLNDAPHYWPGPTYTQNHPSSAGFLQTSSCVGAAQVGVTCGPSDVELFATGMNGDEDLAQDITMKGDKFHYQEEESLAQWTPVVVK*
Ga0138316_1033254913300010981MarineKSQVIALLLGTAAAVKLEDAPAYWPGPTYTLNHPSASGLLQLSSCESAGINGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYA*
Ga0138316_1040327413300010981MarineVIMKSALLIGAAAAINLGDAPPYWPGPTWTENHPSAAGLLQTSQCVSAGVVGVTCGPSDIELFATGMNGDEDLGQDITMKGEKFHYQ*
Ga0138326_1000569013300010985MarineQVIALLLGTAAAVKLEDAPAYWPGPTYTLNHPSASGLLQLSSCESAGINGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYA*
Ga0138326_1130596913300010985MarineALLIGAAAAINLGDAPPYWPGPTWTENHPSAAGLLQTSQCVSAGVVGVTCGPSDIELFATGMNGDEDLGQDITMKGEKFHYQ*
Ga0138324_1039775813300010987MarineQVIALFIGVASAVKLSDAPPYWPGPTWTYNHPSAAGFVQTNACIDAGVNGVTCGPSDVELFATGMNGDEDLGQDITMKG*
Ga0129331_132109113300012524AqueousLLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQEDQSLAQWTPVVVK*
Ga0188862_101218023300018622Freshwater LakeMKSVIALFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKNSLVQ
Ga0193517_107654023300018725MarineTWGLFYMGNINFIQMKSAILSLFLGATAAVQLRDAPPYFNEPTWNERMPSAAGLVQTTSACQAAGVDGVTCGPADAQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0193031_102883423300018765MarineMKFVALFLGATAAVKLGDAPPYFNEPTWNERMPSAAGLVQTTSACQSAGVNGVTCGPADDQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0193031_106989913300018765MarineMKFVALFLGATAAVKLGDAPPYFNEPTWNERMPSAAGLVQTTSACQSAGVNGVTCGPADDQYFATGMNGDEDLGQDIIMKGEKFHYNQALS
Ga0193308_105942413300018862MarineSAVKLSDAPPYWPGPTWTYNHPSAAGFVQTSACIDAGVDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYGQEQSLVQAEWTPVEVK
Ga0192978_110222913300018871MarineQVIALFIGVASAIKISDAPPYWPGPTWTYNHPSAAGFLQTSACVNAVASGVTCGPADTELFATGMNGDEDLGQDITMKGEKFHYA
Ga0192868_1007823423300018913MarineAVKLADAPAYWPGPTWTYNHPSAAGFLQTSACIGASIDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYA
Ga0193260_1005037723300018928MarineMKFFALIASAAAIQDAPPYWPGPTWTYNHPSAAGFVQTSACINAGVDGVTCGPANDELFATGMNGDEDLG
Ga0193178_1002924713300018967MarineAVKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYAQDQALVQ
Ga0192947_1016007113300018982MarineYWPGPTWTYNHPSAAGFLQVSACVGANVDGVVCGPSDVELFATGMNGDEDLGQDITMKGEKYHYNQEQSLVQTEWTPVTVK
Ga0193030_1009683223300018989MarineMKSAVYALLVGASSAVTLQDAPAYWPGPTWTQNHPSAAGFLQMNACVSAGITGVSCGPSDVELFATGMNGDEDLGQDITMKGQKFHYNE
Ga0193030_1010656413300018989MarineMKSVVALLIGAASAVKISDAPPYWPGPTWTYNHPSAAGYIQTSACLNASIDGVSCGPSDVELFATGMNGDEDLGQDITMKGEKFHYNQDQSLVQWTPVEVK
Ga0193030_1011497823300018989MarineMKSHVIALFLGSASAMKISNMDAPPYWPGPTWTYNHPSAAGFVQTSSCLEAGLNGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQD
Ga0193030_1011679413300018989MarineMGIFNCNLKFIMKSQVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGAEVDGVTCGPSDAQLFATGMNGDEDLGQDITMKGEKFHYAQD
Ga0193030_1011723723300018989MarineMKSQVIALLIGAACAVKLGDAPPYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYQQEQSLVQSEWTPVEVK
Ga0193030_1012106713300018989MarineMKSQVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDIELFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ
Ga0193030_1012970013300018989MarineMGNINFIQMKSAILSLFLGATAAVQLRDAPPYFNEPTWNERMPSAAGLVQTTSACQAAGVDGVTCGPADAQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0193030_1017960213300018989MarineLIKINNFYKNIQMKFVALFLGATAAVKLGDAPPYFNEPTWNERMPSAAGLVQTTSACQSAGVNGVTCGPADDQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0193030_1021623413300018989MarineMKSATLALFLGGAAALKLRDAPPFFSEPTWNEKFPSASGLVQTGSACQAAGVEGVTCGPADAVYFATGMNGDEDLGQDIIMKGEKFHYNQQSLA
Ga0193516_1027224513300019031MarineMKFVALFIASAQAIKLSDAPPYWPGPTWTYNHPSAAGFLQVSACDGAGINGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYNQEMI
Ga0192869_1007772513300019032MarineLICNLLIFDYNMKASVFALLISSSTAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCVSSGQQGVTCGPSDVELFATGMNGDEDLGQDITMKGDKFHYQQGEQSLSQWTPVVVK
Ga0192869_1020962113300019032MarineMKSQVIALFLGATSAVKLADAPAYWPGPTWTYNHPSAAGFLQTSACIGASIDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYA
Ga0192945_1010980313300019036MarineMKSPVIALLLRAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQVSACVGANVDGVVCGPSDVELFATGMNGDEDLGQDITMKGEKYHYNQEQSLVQTEWTPVTVK
Ga0193336_1013108013300019045MarineMKSQVIALLIGAACAVKLGDAPPYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYQQDQALVQSEWTPVEVK
Ga0193336_1035199913300019045MarineWPGPTWTYYHPSAAGFVQTSACIDAGVDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYGQEQSLVQAEWTPVEVK
Ga0192981_1008535613300019048MarineMKSQVIALLVSSTSAINLADAPPYWPGPTWTYNHPSAGGFLQLSSCVEAGINGVTCGPADTQLFATGMNGDEDLKQDITMKGEKFHYAQDNTLA
Ga0192981_1008559213300019048MarineMGNLNLLTMKQVIALLIGAASAIKISDAPPYWPGPTWTYNHPSAAGFVQTSACVDAGINGVSCGPSDMELFATGMNGDEDLGQDITMKGEKFHYA
Ga0192981_1031819613300019048MarineHGEFNLLTMKQVIALFIGVASAIKISDAPPYWPGPTWTYNHPSAAGFLQTSACVNAVASGVTCGPADTELFATGMNGDEDLGQDITMKGEKFHYA
Ga0192966_1011830723300019050MarineMKSPVIALLLRAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQVSACVGANVDGVVCGPSDVELFATGMNGDEDLGQDITMKGEKYHYNQEQSLV
Ga0192980_103773723300019123MarineMKQVIALLIGAASAIKISDAPPYWPGPTWTYNHPSAAGFVQTSACVDAGINGVSCGPSDMELFATGMNGDEDLGQDITMKGEKFHYA
Ga0193104_102784313300019125MarineKISDAPPYWPGPTWTYNHPSAAGYVQTSACLNASIDGVSCGPSDVELFATGMNGDEDLGQDITMKGEKFHYNQDQSLVQWTPVEVK
Ga0188870_1007550723300019149Freshwater LakeYNMKASVFALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQEDQSLAQWTPVVVK
Ga0188870_1007962323300019149Freshwater LakeMKSVIALFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0182064_125194423300019253Salt MarshKSQVIALFLGAASAVKLGDAPPYWPGPTWTYNHPSAAGFVQTSSCISAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYNQDSTLVQQEWTPVVVK
Ga0206687_126506723300021169SeawaterSVFALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0206692_108733623300021350SeawaterNMKASVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0206690_1062167513300021355SeawaterKYTIALFLGVTSGIKISDAPSFWPGPTWTQNHPSASGLIQISSCEAAGVNGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYAQDTNLVQWTPVTVK
Ga0206689_1041158523300021359SeawaterSVIALFLGATSAIKLSDAPPYWPGPTWTENHPSAAGFVQTTACLDAGLNGVTCGPSDVELFATGMNGDEDLAQDIIMKGEKFHYAQEGWTPVKVK
Ga0063109_11140313300021866MarineVTLFIAAASAAKLSDAPPYWPGPTWTYNHPSAAGFVQLSSCASAGVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYNQE
Ga0063132_10353813300021872MarineIMKSQVIALFLGATSAVKLADAPPYWPGPTWTYNHPSAAGFLQTSACVDAGVDGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYNQE
Ga0063113_10266413300021879MarineMKSAILSLFLGATAAVQLRDAPPYFNEPTWNERMPSAAGLVQTTSACQAAGVDGVTCGPADVQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0063105_102232313300021887MarineVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063089_103147613300021889MarineKSQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ
Ga0063090_106156313300021890MarineQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ
Ga0063097_101097113300021898MarineQVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063086_100338013300021902MarineMKSQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ
Ga0063086_100413813300021902MarineNSHVIALFLSTVSAVKLGDAPAYWPGPTWTYNHPSAAGFVQTSACVDSGLGGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYA
Ga0063133_102820913300021912MarineMKSYTIALLLASTSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0063104_102573113300021913MarineKSQVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063085_100820813300021924MarineMNSHVIALFLSTVSAVKLGDAPAYWPGPTWTYNHPSAAGFVQTSACVDSGLGGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYA
Ga0063096_100312613300021925MarineSMKSQVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063103_106071213300021927MarineVIALFIGAACAVKIGDAPAYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063134_103945413300021928MarineNIQMKFVALFLGATAAVKLGDAPPYFNEPTWNERMPSAAGLVQTTSACQSAGVNGVTCGPADDQYFATGMNGDEDLGQDIIMKGEKFHYN
Ga0063134_111102313300021928MarineLFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVGASVDGVTCGPSDIALFATGMNGDEDLGQDITMKGEKFHYAQDQ
Ga0063134_111959113300021928MarineHVIALFLGSASAMKISNMDAPPYWPGPTWTYNHPSAAGFVQTSSCLEAGLNGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQD
Ga0063095_106095313300021939MarineFIGAACAVKIGDAPAYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063094_101734813300021943MarineKSQVIALFIGAACAVKIGDAPAYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063094_104050813300021943MarineIALFLSASAAVKLGDAPPYWAGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLAQDITMKGEKFHYA
Ga0063101_106690713300021950MarineMKSQVIALFIGAACAVKIGDAPAYWPGPTWTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0063101_110076313300021950MarineVIALFVGVASAVKLSDAPPYWAGPTWTYNHPSAAGFLQTSACIDAGVDGVTCGPSNQELFATGMNGDEDLGQDITMKGEKFHYA
Ga0228683_102267423300023694SeawaterSVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0228687_101891223300023696SeawaterVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0228687_101984213300023696SeawaterKSYTIALLLASTSAVKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0228684_103489523300023704SeawaterLIMKSYTIALLLASTSAIKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0208275_102112013300026182MarineMKSAVLSLLLGASSAHKIRDALHHFNEPTWGETFPSAAGFVQLENTACINSGVTGVTCGPSDAELFATGMNGDEDLGQDIIMKGEKFHYNQAPESTLIQWTPVEVK
Ga0247578_110291323300026458SeawaterKSQVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGIDGVTCGPADMELFATGMNGDEDLGQDITMKGEKFHYAQDQALVQ
Ga0247568_105140523300026462SeawaterKASVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0247605_115515113300026503SeawaterIFDYNMKASVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0247587_109334123300026504SeawaterKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0209302_1010063313300027810MarineMKSQVIALFIGAACAVKIGDAPAYWPGPTYTYNHPSAAGFVQTSACIDSGVEGVTCGPSDNQLFATGMNGDEDLGQDITMKGEKFHYAQEQ
Ga0256412_118722613300028137SeawaterLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0256417_109424823300028233SeawaterMKASVVALLVSASSAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCLSSGQLGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYQQDQSLAQWTPVVVK
Ga0256413_118513213300028282SeawaterHVIALFLGAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYAQDNTLVQ
Ga0247566_104488013300028335SeawaterVKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGASVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDAQNVQLEWTPVKVK
Ga0304731_1133025713300028575MarineVIMKSALLIGAAAAINLGDAPPYWPGPTWTENHPSAAGLLQTSQCVSAGVVGVTCGPSDIELFATGMNGDEDLGQDITMKGEKFHYQ
Ga0304731_1137999923300028575MarineKSQVIALLLGTAAAVKLEDAPAYWPGPTYTLNHPSASGLLQLSSCESAGINGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYA
Ga0307403_1033397323300030671MarineLNLLTMKQVIALLIGAASAIKISDAPPYWPGPTWTYNHPSAAGFVQTSACVDAGINGVSCGPSDMELFATGMNGDEDLGQDITMKGEKFHYA
Ga0307399_1063361623300030702MarineSVFALLVASATAVSLNDAPHYWPGPTWTQNHPSAAGFLQTSSCIGASQVGVTCGPSDVELFATGMNGDEDLAQDITMKGEKFHYQQE
Ga0073987_1122104113300030912MarineGDAPPYWPGPTWTYNHPSAAGFLQTSACVGAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYAQDQ
Ga0073989_1357697813300031062MarineVKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVELFATGMNGDEDLGQDITMKGEKFHYAQDATLLQTDWTPVKVK
Ga0308134_107534713300031579MarineIALLIGATSAIKLGDAPAYWAGPTWTYNHPSAAGFVQTSACVDAGIAGVSCGPSDNQLFATGMNGDEDLA
Ga0302126_1010423213300031622MarineMKSQVIALLIGATSAIKLGDAPAYWAGPTWTYNHPSAAGFVQTSACVDAGIAGVSCGPSDNQLFATGMNGDEDLA
Ga0307386_1031085923300031710MarineMKQQVIALFLSATSAIKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYAQEQGLVQTDNEWTPVTVK
Ga0307386_1045061413300031710MarineKSQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVGAGVDGVTCGPSDVQLFATGMNGDEDLGQDITMKGEKFHYAQDATNVQLDWTPVKVK
Ga0307396_1039104523300031717MarineTMKQVIALLIGAASAIKISDAPPYWPGPTWTYNHPSAAGFVQTSACVDAGINGVSCGPSDMELFATGMNGDEDLGQDITMKGEKFHYA
Ga0307381_1009035213300031725MarineVYAALVLGANAIKLGDAPAYWPGPTWTYNHPSAAGFLQTSSCVAAGINGVTCGPADIELFATGMNGDEDLGQDITMKGEKYHYAQNLAQWTPVEVK
Ga0307381_1022259013300031725MarineIMKSQVIALLIGATSAIKLGDAPAYWPGPTWTYNHPSAAGFVQTSACIGAEVDGVTCGPSDNQLFATGMNGDEDLK
Ga0307381_1036174523300031725MarineLIMKSPVIALLLRAASAVKLGDAPAYWPGPTWTYNHPSAAGFLQVSACVGANVDGVVCGPSDVELFATGMNGDEDLGQDITMKGEKYHYNQEQSLVQTEWTPVTVK
Ga0307397_1025132813300031734MarineIMKSQVIALLVSSTSAINLADAPPYWPGPTWTYNHPSAGGFLQLSSCVEAGINGVTCGPADTQLFATGMNGDEDLKQDITMKGEKFHYAQDNTLA
Ga0307384_1024558023300031738MarineMNSHVIALFLSTVSAVKLGDAPAYWPGPTWTYNHPSAAGFVQTSACVDSGLGGVTCRPSDVELFATGMNGDEDLGQDITMKGEKFHYA
Ga0307384_1026276723300031738MarineLIMKQQVIALFLSATSAIKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYAQEQGLVQTDNEWTPVTVK
Ga0307383_1027966033300031739MarineKFVALLIASAQAIKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYAQEQGLVQTDNEWTPVTVK
Ga0307382_1026155313300031743MarineQQVIALFLSATSAIKLGDAPPYWPGPTWTYNHPSAAGFLQTSACIGAGVDGVTCGPSDVALFATGMNGDEDLGQDITMKGEKFHYAQEQGLVQTDNEWTPVTVK
Ga0307382_1049114313300031743MarineKTTCVIAAIAAYANAVKLGDAPHYFNEPTWGQTWPSAAGLVQLETATACEKFGVKGVSCGPADLSLFATGMNGDEDLNQDIIMKGNKFHYA
Ga0314688_1033247513300032517SeawaterSVIALFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0314689_1034567813300032518SeawaterIMKSVIALFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0314680_1045624823300032521SeawaterFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0314680_1047264313300032521SeawaterSQVIALFLGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACVDAGLDGVTCGPSDMQLFATGMNGDEDLGQDITMKGEKFHYAQDQSLVQ
Ga0314682_1040286513300032540SeawaterLIMKSVIALFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0314708_1048241813300032750SeawaterLFIGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ
Ga0314694_1025111123300032751SeawaterGATSAVKLGDAPAYWPGPTWTYNHPSAAGFLQTSACLGASVDGVTCGPSDTQLFATGMNGDEDLGQDITMKGEKFHYQQEMAKDSLVQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.