Basic Information | |
---|---|
Family ID | F068843 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 37 residues |
Representative Sequence | MSLTDEDIAFLIKIGQITEAPKKETKTNTPTTEKSEE |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 87.10 % |
% of genes near scaffold ends (potentially truncated) | 13.71 % |
% of genes from short scaffolds (< 2000 bps) | 62.10 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (78.226 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.226 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.968 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.097 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.85% β-sheet: 0.00% Coil/Unstructured: 86.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 6.45 |
PF03354 | TerL_ATPase | 4.84 |
PF13539 | Peptidase_M15_4 | 3.23 |
PF04586 | Peptidase_S78 | 3.23 |
PF04860 | Phage_portal | 3.23 |
PF00583 | Acetyltransf_1 | 1.61 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 6.45 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 4.84 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 3.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.26 % |
Unclassified | root | N/A | 17.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352003|2199749525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300000736|JGI12547J11936_1001167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7411 | Open in IMG/M |
3300000736|JGI12547J11936_1054659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300000929|NpDRAFT_10561250 | Not Available | 588 | Open in IMG/M |
3300002161|JGI24766J26685_10046681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300002835|B570J40625_100517090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
3300003497|JGI25925J51416_10133727 | Not Available | 571 | Open in IMG/M |
3300005517|Ga0070374_10001250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10884 | Open in IMG/M |
3300005581|Ga0049081_10006509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4419 | Open in IMG/M |
3300005581|Ga0049081_10011967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3279 | Open in IMG/M |
3300005581|Ga0049081_10048014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1618 | Open in IMG/M |
3300005582|Ga0049080_10159688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300005584|Ga0049082_10060557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
3300005662|Ga0078894_10003964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11266 | Open in IMG/M |
3300005662|Ga0078894_10226706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1693 | Open in IMG/M |
3300005662|Ga0078894_11055853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300005805|Ga0079957_1002727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15323 | Open in IMG/M |
3300006037|Ga0075465_10069196 | Not Available | 762 | Open in IMG/M |
3300006484|Ga0070744_10002664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5380 | Open in IMG/M |
3300006484|Ga0070744_10016208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2212 | Open in IMG/M |
3300006484|Ga0070744_10027475 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 1685 | Open in IMG/M |
3300006484|Ga0070744_10029007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1639 | Open in IMG/M |
3300006803|Ga0075467_10258605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300006805|Ga0075464_10339459 | Not Available | 908 | Open in IMG/M |
3300006805|Ga0075464_10575125 | Not Available | 693 | Open in IMG/M |
3300006805|Ga0075464_10648058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300006920|Ga0070748_1363270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300008266|Ga0114363_1046206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
3300008450|Ga0114880_1061900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
3300008450|Ga0114880_1068926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
3300009068|Ga0114973_10005928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8260 | Open in IMG/M |
3300009085|Ga0105103_10863763 | Not Available | 528 | Open in IMG/M |
3300009158|Ga0114977_10002223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12518 | Open in IMG/M |
3300009158|Ga0114977_10004495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8895 | Open in IMG/M |
3300009159|Ga0114978_10002292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15755 | Open in IMG/M |
3300009159|Ga0114978_10009877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7391 | Open in IMG/M |
3300009164|Ga0114975_10625727 | Not Available | 572 | Open in IMG/M |
3300009169|Ga0105097_10645594 | Not Available | 597 | Open in IMG/M |
3300009180|Ga0114979_10013678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5244 | Open in IMG/M |
3300009180|Ga0114979_10266118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300009180|Ga0114979_10287407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 979 | Open in IMG/M |
3300009181|Ga0114969_10147136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1483 | Open in IMG/M |
3300009183|Ga0114974_10008442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7550 | Open in IMG/M |
3300009184|Ga0114976_10492773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300009184|Ga0114976_10585825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300009184|Ga0114976_10642575 | Not Available | 536 | Open in IMG/M |
3300010354|Ga0129333_11315897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300010885|Ga0133913_10339659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3974 | Open in IMG/M |
3300010885|Ga0133913_10780292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2492 | Open in IMG/M |
3300010965|Ga0138308_108697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6562 | Open in IMG/M |
3300012702|Ga0157596_1175715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2975 | Open in IMG/M |
3300012707|Ga0157623_1051368 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 1521 | Open in IMG/M |
3300012717|Ga0157609_1013292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5018 | Open in IMG/M |
3300012724|Ga0157611_1021429 | Not Available | 528 | Open in IMG/M |
3300012757|Ga0157628_1017007 | Not Available | 803 | Open in IMG/M |
3300012757|Ga0157628_1062310 | Not Available | 550 | Open in IMG/M |
3300013004|Ga0164293_10725923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300013004|Ga0164293_11016414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300013372|Ga0177922_10018724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300017723|Ga0181362_1019338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
3300017777|Ga0181357_1299181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300017780|Ga0181346_1217889 | Not Available | 681 | Open in IMG/M |
3300019784|Ga0181359_1022048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2418 | Open in IMG/M |
3300019784|Ga0181359_1026506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2223 | Open in IMG/M |
3300019784|Ga0181359_1032313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2023 | Open in IMG/M |
3300019784|Ga0181359_1060946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
3300020048|Ga0207193_1038036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5341 | Open in IMG/M |
3300020048|Ga0207193_1080819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3097 | Open in IMG/M |
3300020159|Ga0211734_10128277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8454 | Open in IMG/M |
3300020205|Ga0211731_10278354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300020506|Ga0208091_1024690 | Not Available | 687 | Open in IMG/M |
3300020513|Ga0208090_1017893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300020551|Ga0208360_1024708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300021519|Ga0194048_10013036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3737 | Open in IMG/M |
3300021519|Ga0194048_10147920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300021952|Ga0213921_1017896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
3300022407|Ga0181351_1038794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2015 | Open in IMG/M |
3300022543|Ga0212119_1070085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300023174|Ga0214921_10021090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6947 | Open in IMG/M |
3300024346|Ga0244775_10178238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
3300024346|Ga0244775_10636435 | Not Available | 863 | Open in IMG/M |
3300024346|Ga0244775_11247446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300025075|Ga0209615_101387 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
3300027608|Ga0208974_1078208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300027659|Ga0208975_1004221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5411 | Open in IMG/M |
3300027659|Ga0208975_1082104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300027720|Ga0209617_10000494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17247 | Open in IMG/M |
3300027733|Ga0209297_1001727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12524 | Open in IMG/M |
3300027733|Ga0209297_1023003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2948 | Open in IMG/M |
3300027733|Ga0209297_1225840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300027759|Ga0209296_1006217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7550 | Open in IMG/M |
3300027760|Ga0209598_10024524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3453 | Open in IMG/M |
3300027763|Ga0209088_10023410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3171 | Open in IMG/M |
3300027764|Ga0209134_10189659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300027782|Ga0209500_10003379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10916 | Open in IMG/M |
3300027797|Ga0209107_10008186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5867 | Open in IMG/M |
3300027805|Ga0209229_10014910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3308 | Open in IMG/M |
3300028025|Ga0247723_1019958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2282 | Open in IMG/M |
3300033816|Ga0334980_0023555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2639 | Open in IMG/M |
3300033981|Ga0334982_0359517 | Not Available | 671 | Open in IMG/M |
3300033993|Ga0334994_0099450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1711 | Open in IMG/M |
3300033993|Ga0334994_0154532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300033996|Ga0334979_0004055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10441 | Open in IMG/M |
3300033996|Ga0334979_0006925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7922 | Open in IMG/M |
3300033996|Ga0334979_0041240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3028 | Open in IMG/M |
3300034018|Ga0334985_0768384 | Not Available | 512 | Open in IMG/M |
3300034060|Ga0334983_0597330 | Not Available | 603 | Open in IMG/M |
3300034061|Ga0334987_0535230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300034062|Ga0334995_0097417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2240 | Open in IMG/M |
3300034066|Ga0335019_0696661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300034092|Ga0335010_0690389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300034093|Ga0335012_0493894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300034101|Ga0335027_0135743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1826 | Open in IMG/M |
3300034101|Ga0335027_0253220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
3300034101|Ga0335027_0774521 | Not Available | 559 | Open in IMG/M |
3300034104|Ga0335031_0342163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300034104|Ga0335031_0762065 | Not Available | 547 | Open in IMG/M |
3300034105|Ga0335035_0085394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2047 | Open in IMG/M |
3300034105|Ga0335035_0267550 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300034106|Ga0335036_0727417 | Not Available | 584 | Open in IMG/M |
3300034106|Ga0335036_0817786 | Not Available | 537 | Open in IMG/M |
3300034116|Ga0335068_0150408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
3300034116|Ga0335068_0363982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300034283|Ga0335007_0081625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2429 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.29% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.45% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.65% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.03% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 2.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.42% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.61% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.61% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.61% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.61% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.81% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.81% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.81% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.81% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352003 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199902857 | 2199352003 | Freshwater | MSYTDEDIAFLIKIGQIEAAPVKDTKPKAPATEKTEE |
JGI12547J11936_10011676 | 3300000736 | Freshwater And Sediment | MSLTDEDIAFLIKIGQITEAPKKETKIKDTPTDKNEE* |
JGI12547J11936_10546593 | 3300000736 | Freshwater And Sediment | MAYTDEDIAFLIKIGQITEAPVKETKTKAPATEKTEE* |
NpDRAFT_105612502 | 3300000929 | Freshwater And Marine | MSLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKIEE* |
JGI24766J26685_100466812 | 3300002161 | Freshwater And Sediment | MSLTDEDIAFLIKVGQITEAPKKETKTNTPTTEKSEE* |
B570J40625_1005170901 | 3300002835 | Freshwater | VELSMSLTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSEE* |
JGI25925J51416_101337271 | 3300003497 | Freshwater Lake | LELSMSLTDEDIAFLIKIGQITEAPKKENKPKDTPTDENEE* |
Ga0070374_100012506 | 3300005517 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKPKDTPTDENEE* |
Ga0049081_100065092 | 3300005581 | Freshwater Lentic | MSYTEEDIAFLIKIGQITETDKKVTKTTAAPIEKTEE* |
Ga0049081_100119674 | 3300005581 | Freshwater Lentic | MSLTDEDIAFLIKIGQITEAPKKENKPKDTPTDKNEE* |
Ga0049081_100480144 | 3300005581 | Freshwater Lentic | MSYTDEDIAFLIKIGQIEAPPVKETKTKAPVTEQIEE* |
Ga0049080_101596883 | 3300005582 | Freshwater Lentic | MSYTDEDIAFLIKIGQITEAPKKETKTTAAPIEKTEE* |
Ga0049082_100605572 | 3300005584 | Freshwater Lentic | MSLTDEDIAFLIKIGQITEAPKKENKTKDTPTDKNEE* |
Ga0078894_100039649 | 3300005662 | Freshwater Lake | MSYTDEDIAFLIKIGQITEADKKVTKAAPAPIEKTEE* |
Ga0078894_102267063 | 3300005662 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSEE* |
Ga0078894_110558532 | 3300005662 | Freshwater Lake | MSYTDEDIAFLIKIGQIEAAPVKDTKPKAPATEKTEE* |
Ga0079957_100272717 | 3300005805 | Lake | MSYTDEDIAFLIKIGQITEAPVKETKTKAPVTEKIEE* |
Ga0075465_100691963 | 3300006037 | Aqueous | MSLTDEDIAFLIKIGQITEAPKKDTKATTPTTEKSEE* |
Ga0070744_100026645 | 3300006484 | Estuarine | MSYTDEDIAFLIKIGQIEAAPVKETKPKAPATEKTEE* |
Ga0070744_100162083 | 3300006484 | Estuarine | MSLTDEDIAFLIKIGQITEAPKKETKTKDTPTDKNEE* |
Ga0070744_100274754 | 3300006484 | Estuarine | MSLTDEDIAFLIKIGQITEAPKKETKTNTPTTEKSEE* |
Ga0070744_100290072 | 3300006484 | Estuarine | MTLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKTEE* |
Ga0075467_102586051 | 3300006803 | Aqueous | MTLTDNDIAFLIKIGQITEAPKKDTKATTPTTEKSEE* |
Ga0075464_103394592 | 3300006805 | Aqueous | MSLTDEDIAFLIKIGQITEAPKKETKTQSPTTEKSEE* |
Ga0075464_105751252 | 3300006805 | Aqueous | MSLTDEEIAFLIKIGQITEAPKKETKTKDTPTDKNEE* |
Ga0075464_106480582 | 3300006805 | Aqueous | MSYTDEDIAFLIKIGQITEAPVKETKPKAPATEKIEE* |
Ga0070748_13632702 | 3300006920 | Aqueous | MSYTDEDIAFLIKIGQITEAPVKETKPKAPATEKTEE* |
Ga0114363_10462064 | 3300008266 | Freshwater, Plankton | MSLTDEDIAFLIKIGQITEAPKKQTKTQTPTTTESEE* |
Ga0114880_10619003 | 3300008450 | Freshwater Lake | MTLTDEDIAFLIKVGQITEAPKKETKTHTPTTEKSEE* |
Ga0114880_10689261 | 3300008450 | Freshwater Lake | MSLTDEDIAFLIKSGQITEAPIKETKTHTPTTEKSEE* |
Ga0114973_100059286 | 3300009068 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKETKTKDTPTDNNEE* |
Ga0105103_108637632 | 3300009085 | Freshwater Sediment | MPYTDEDIAFLIKIGQITEAPKKETKTQTPTTEKSEE* |
Ga0114977_1000222310 | 3300009158 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKTKDTPTNKDEE* |
Ga0114977_100044953 | 3300009158 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKTEE* |
Ga0114978_100022926 | 3300009159 | Freshwater Lake | MSLTEEEIAFLIKIGQITEAPKKENKSKDTPTDKDEE* |
Ga0114978_100098773 | 3300009159 | Freshwater Lake | MSYTDEDIAFLIKIGQITEPPVKETKPKAPATEKTEE* |
Ga0114975_106257272 | 3300009164 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKSKDTLTDKDEE* |
Ga0105097_106455941 | 3300009169 | Freshwater Sediment | MTLTDEDIAFLIKIGQIKEAPKKEAKTNTPTTEKSEE* |
Ga0114979_100136785 | 3300009180 | Freshwater Lake | MSYTDEDIAFLIKIGQITEPPVKETKPKAPVTEKTEE* |
Ga0114979_102661183 | 3300009180 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKETKPKPTEKIEE* |
Ga0114979_102874073 | 3300009180 | Freshwater Lake | VDIGEVMTLTDEDIAFLIKIGQITEAPKKETKTKDTTTDKTEE* |
Ga0114969_101471363 | 3300009181 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKTKDTQTDKNEE* |
Ga0114974_100084425 | 3300009183 | Freshwater Lake | MSYTEEDIAFLIKIGQISDTGKKETKTAAAPIEKTEE* |
Ga0114976_104927732 | 3300009184 | Freshwater Lake | MAYTEEDIAFLIKIGQIKEAPKEAKTKAPVTEQIEE* |
Ga0114976_105858251 | 3300009184 | Freshwater Lake | SLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKTEE* |
Ga0114976_106425752 | 3300009184 | Freshwater Lake | MSYTEEDIAFLIKVGQITEAPKKETKAPAAPIEKTEE* |
Ga0129333_113158972 | 3300010354 | Freshwater To Marine Saline Gradient | VGSKQMSYTEDDIAFLIKIGQITEADKKVTKAAPAPIEKTEE* |
Ga0133913_103396591 | 3300010885 | Freshwater Lake | MSLTEEEKAFLIKIGQVTEPDKKETKATSAPIEKTEE* |
Ga0133913_107802924 | 3300010885 | Freshwater Lake | MSYTEEDIAFLIKIGQITETDKKATKAAAPIEKTEE* |
Ga0138308_10869710 | 3300010965 | Lake Chemocline | MSYTDEDIAFLIKIGQITEAPVKETKTKAPATEKTEE* |
Ga0157596_11757154 | 3300012702 | Freshwater | MPYTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSEE* |
Ga0157623_10513681 | 3300012707 | Freshwater | MPYTYEDIAFLIKIGQITEAPKKETKTQTPTTEKSEE* |
Ga0157609_10132925 | 3300012717 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKQTKTQTPTTTESQE* |
Ga0157611_10214292 | 3300012724 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKQTKTNTPTIEKSEE* |
Ga0157628_10170072 | 3300012757 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKETKTNTPTIEKSEE* |
Ga0157628_10623102 | 3300012757 | Freshwater | LSMSLTDEDIAFLIKIGQITEAPKKQTKTQTPTTTESEE* |
Ga0164293_107259233 | 3300013004 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSE |
Ga0164293_110164141 | 3300013004 | Freshwater | NMSYTDEDIAFLIKIGQITEAPVKETKPKAPATEKTEE* |
Ga0177922_100187242 | 3300013372 | Freshwater | MSYTEEDIAFLIKIGQITEAPVKETKIKAPVTEKIEE* |
Ga0181362_10193381 | 3300017723 | Freshwater Lake | LTDEDIAFLIKIGQITEAPKKETKTKDTPTDKNEE |
Ga0181357_12991812 | 3300017777 | Freshwater Lake | MSYTDEDIAFLIKIGQITEAPVKETKPKAPVTEKIEE |
Ga0181346_12178892 | 3300017780 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKETKTKETPTEKDEE |
Ga0181359_10220482 | 3300019784 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKPKDTPTDENEE |
Ga0181359_10265061 | 3300019784 | Freshwater Lake | MSLTDEDIAFLIKIGQITQAPTKETKTKETKTKETPTEKDEE |
Ga0181359_10323133 | 3300019784 | Freshwater Lake | MSYTDEDIAFLIKIGQITETPVKETKTKAPATEKTEE |
Ga0181359_10609463 | 3300019784 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPTKETKTKETKTKETPTEKDEE |
Ga0207193_10380361 | 3300020048 | Freshwater Lake Sediment | MSLTDEDIAFLIKIGQITEAPKKDTKATTPTTEKSEE |
Ga0207193_10808194 | 3300020048 | Freshwater Lake Sediment | MSYTDEDIAFLIKIGQITEAPVKETKTKAPATEKTEE |
Ga0211734_101282773 | 3300020159 | Freshwater | MSYTDEDIAFLIKIGQITEAPKETKTKAPATEKTEE |
Ga0211731_102783541 | 3300020205 | Freshwater | MSYTDEDIAFLIKIGQIEAPPVKETKIKAPATEKTEE |
Ga0208091_10246902 | 3300020506 | Freshwater | MTLTDEDIAFLIKIGQIKEAPKKETKTHTPTTEKSEE |
Ga0208090_10178934 | 3300020513 | Freshwater | SMSLTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSEE |
Ga0208360_10247082 | 3300020551 | Freshwater | MSYTDEDIAFLIKIGQITEAPVKETKPKAPATEKTEE |
Ga0194048_100130364 | 3300021519 | Anoxic Zone Freshwater | MSLTDEDIAFLIKIGQITEAPKKEAKAKDTPTESNEE |
Ga0194048_101479201 | 3300021519 | Anoxic Zone Freshwater | MFTDEDIAFLIKVGQITEAPKKETKAKETTTATNEE |
Ga0213921_10178962 | 3300021952 | Freshwater | MTLTDNDIAFLIKIGQITEAPKKETKTQTPTTEKSEE |
Ga0181351_10387944 | 3300022407 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKTKDTPTDKNEE |
Ga0212119_10700852 | 3300022543 | Freshwater | MSYTDEDIAFLIKIGQIEAAPVKETKPKAPATEKTEE |
Ga0214921_100210903 | 3300023174 | Freshwater | MSLTDNDIAFLIKIGQITEAPKKETKTPTPTTEKSEE |
Ga0244775_101782384 | 3300024346 | Estuarine | MTLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKTEE |
Ga0244775_106364352 | 3300024346 | Estuarine | MSLTDEDIAFLIKIGQITEAPKKETKTNTPTTEKSEE |
Ga0244775_112474462 | 3300024346 | Estuarine | MSYTDEDIAFLIKIGQIKEAPKETKTKAPVTEQIEE |
Ga0209615_1013872 | 3300025075 | Freshwater | MPYTDEDIAFLIKIGQITEAPKKETKTQTPTTEKSEE |
Ga0208974_10782084 | 3300027608 | Freshwater Lentic | MSYTDEDIAFLIKIGQITEAPKKETKTTAAPIEKTEE |
Ga0208975_10042212 | 3300027659 | Freshwater Lentic | MSYTEEDIAFLIKIGQITEAPKKETKTTAAPIEKTEE |
Ga0208975_10821043 | 3300027659 | Freshwater Lentic | MSYTEEDIAFLIKIGQITETDKKVTKTTAAPIEKTEE |
Ga0209617_100004943 | 3300027720 | Freshwater And Sediment | MSLTDEDIAFLIKIGQITEAPKKETKIKDTPTDKNEE |
Ga0209297_10017276 | 3300027733 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKENKTKDTPTNKDEE |
Ga0209297_10230035 | 3300027733 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKEAKTKDTTTDKTEE |
Ga0209297_12258403 | 3300027733 | Freshwater Lake | TNELELSMSLTDEDIAFLIKIGQITEAPKKENKPKDTPTDKNEE |
Ga0209296_10062175 | 3300027759 | Freshwater Lake | MSYTEEDIAFLIKIGQISDTGKKETKTAAAPIEKTEE |
Ga0209598_100245245 | 3300027760 | Freshwater Lake | MSLTDEDIAFLIKIGQITEAPKKETKTKDTPTDNNEE |
Ga0209088_100234104 | 3300027763 | Freshwater Lake | MSYTDEDIAFLIKIGQITEPPVKETKPKAPATEKTEE |
Ga0209134_101896591 | 3300027764 | Freshwater Lake | MSYTDEDIAFLIKIGQITDAPKKETKTTAAPIEKTEE |
Ga0209500_100033795 | 3300027782 | Freshwater Lake | MSLTEEEIAFLIKIGQITEAPKKENKSKDTPTDKDEE |
Ga0209107_100081866 | 3300027797 | Freshwater And Sediment | MSLTDEDIAFLIKIGQITEAPKKETKIKDTPTEKNEE |
Ga0209229_100149104 | 3300027805 | Freshwater And Sediment | MSLTDEDIAFLIKVGQITEAPKKETKTNTPTTEKSEE |
Ga0247723_10199583 | 3300028025 | Deep Subsurface Sediment | MSYTDEDIAFLIKIGQITESDKKATKTAAAPIEKTEE |
Ga0334980_0023555_482_595 | 3300033816 | Freshwater | MSYTDEDIAFLIKIGQIEAAPVKETKTKAPVTEQIEE |
Ga0334982_0359517_88_201 | 3300033981 | Freshwater | MSLTDEDIAFLIKVGQITEAPKKEAKTNTPTTEKSEE |
Ga0334994_0099450_871_984 | 3300033993 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKETKTPTPTTQKSEE |
Ga0334994_0154532_3_110 | 3300033993 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKQTKTNTPTIEKSE |
Ga0334979_0004055_2545_2658 | 3300033996 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKQTKTQTPTTTESEE |
Ga0334979_0006925_5431_5544 | 3300033996 | Freshwater | MTLTDEDIAFLIKIGQIKEAPKKEAKTHTPTTEKSEE |
Ga0334979_0041240_1335_1448 | 3300033996 | Freshwater | MSYTEEDIAFLIKVGQITEAPKKETKAPAAPIEKTEE |
Ga0334985_0768384_402_512 | 3300034018 | Freshwater | SLTDEDIAFLIKIGQIKEAPKKEAKTNTPTTEKSEE |
Ga0334983_0597330_21_134 | 3300034060 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKETKTNTPTIEKSEE |
Ga0334987_0535230_491_604 | 3300034061 | Freshwater | MSYTDEDIAFLIKIGQITEAPVKETKPKAPATEKIEE |
Ga0334995_0097417_1534_1647 | 3300034062 | Freshwater | MSLTDEDIAFLIKIGQIKEAPKKEAKTNTPTTEKSEE |
Ga0335019_0696661_273_383 | 3300034066 | Freshwater | MSLTKEDIAFLIKIGQITEAPTEPKTKAPATEKTEE |
Ga0335010_0690389_1_105 | 3300034092 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKVCGTHTPTTEKS |
Ga0335012_0493894_434_547 | 3300034093 | Freshwater | MSYTEDDIAFLIKIGQITEADKKVTKAAPAPIEKTEE |
Ga0335027_0135743_117_230 | 3300034101 | Freshwater | MSYTDEDIAFLIKIGQITETDKKATKTTAAPIEKTEE |
Ga0335027_0253220_658_771 | 3300034101 | Freshwater | MSYTDEDIAFLIKIGQITEAPVKETKTKAPVTEQIEE |
Ga0335027_0774521_260_373 | 3300034101 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKETKTKDTSLDKNEE |
Ga0335031_0342163_93_206 | 3300034104 | Freshwater | MSLTDEDIAFLIKIGQITEAPKKQTKTHTPTTEKSEE |
Ga0335031_0762065_123_236 | 3300034104 | Freshwater | MSYTDEDIAFLIKIGQITETDKKVTKTTAAPIEKTEE |
Ga0335035_0085394_135_248 | 3300034105 | Freshwater | MSYTEEDIAFLIKIGQIPEAPKKETKTTAAPIEKTEE |
Ga0335035_0267550_1_111 | 3300034105 | Freshwater | SLTDEDIAFLIKIGQITEAPKKETKTHTPTTEKSEE |
Ga0335036_0727417_476_583 | 3300034106 | Freshwater | MSYTDEDIAFLIKIGQITETDKKVTKTTAAPIEKTE |
Ga0335036_0817786_430_537 | 3300034106 | Freshwater | YTDEDIAFLIKIGQIKEAPKKEAKTNTPTTEKSEE |
Ga0335068_0150408_645_755 | 3300034116 | Freshwater | MSYTEDDIAFLIKIGQITEADKKSTKTAAPIEKTEE |
Ga0335068_0363982_1_108 | 3300034116 | Freshwater | LTDEDIAFLIKIGQITEAPKKQTKTNTPTIEKSEE |
Ga0335007_0081625_480_593 | 3300034283 | Freshwater | MSYTDEDIAFLIKIGQITEADKKVTKAVPAPIEKTEE |
⦗Top⦘ |