| Basic Information | |
|---|---|
| Family ID | F068812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLI |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.42 % |
| % of genes near scaffold ends (potentially truncated) | 50.00 % |
| % of genes from short scaffolds (< 2000 bps) | 49.19 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.226 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.903 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.710 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF05065 | Phage_capsid | 27.42 |
| PF04586 | Peptidase_S78 | 1.61 |
| PF04860 | Phage_portal | 1.61 |
| PF01597 | GCV_H | 0.81 |
| PF03237 | Terminase_6N | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 27.42 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.61 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003493|JGI25923J51411_1090418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300004126|Ga0066179_10196296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300004763|Ga0007746_1072687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300004769|Ga0007748_11474458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300004793|Ga0007760_11333789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300004836|Ga0007759_10018378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300005517|Ga0070374_10140433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
| 3300006639|Ga0079301_1178638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300007559|Ga0102828_1206911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300007708|Ga0102859_1018831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1786 | Open in IMG/M |
| 3300007708|Ga0102859_1189982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300007973|Ga0105746_1365159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300007974|Ga0105747_1333299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300008119|Ga0114354_1026100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2609 | Open in IMG/M |
| 3300009068|Ga0114973_10154574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
| 3300009155|Ga0114968_10738618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300009163|Ga0114970_10162389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
| 3300009180|Ga0114979_10136076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1507 | Open in IMG/M |
| 3300009185|Ga0114971_10440492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300009684|Ga0114958_10438735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
| 3300010160|Ga0114967_10150276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
| 3300012666|Ga0157498_1021988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300012716|Ga0157605_1036385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300012763|Ga0138289_1050705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300012773|Ga0138290_1110569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300013004|Ga0164293_10855774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300015050|Ga0181338_1043604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300017736|Ga0181365_1044157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300017774|Ga0181358_1271973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300017777|Ga0181357_1044074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
| 3300017780|Ga0181346_1239235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300017785|Ga0181355_1109408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300019784|Ga0181359_1069104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1340 | Open in IMG/M |
| 3300021962|Ga0222713_10606728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300022200|Ga0196901_1036296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1900 | Open in IMG/M |
| 3300024346|Ga0244775_11467750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300024853|Ga0255252_1006772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
| 3300025843|Ga0209182_10122422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300026417|Ga0256315_1009563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
| 3300027114|Ga0208009_1038520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300027193|Ga0208800_1040636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300027212|Ga0208554_1026210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300027213|Ga0208555_1070823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027518|Ga0208787_1120239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300027754|Ga0209596_1295567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300027754|Ga0209596_1324712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300027785|Ga0209246_10129977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300027798|Ga0209353_10114684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300027798|Ga0209353_10385469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300027805|Ga0209229_10301249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300027973|Ga0209298_10210700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300027974|Ga0209299_1105696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
| 3300028081|Ga0255260_1046170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300028113|Ga0255234_1094574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300031772|Ga0315288_10577961 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300031999|Ga0315274_11414115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300033992|Ga0334992_0370613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300034061|Ga0334987_0507926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300034062|Ga0334995_0248283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
| 3300034102|Ga0335029_0593454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034120|Ga0335056_0480360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300034283|Ga0335007_0562917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.29% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.84% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.03% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.42% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.42% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.61% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.61% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.81% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025843 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026417 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028081 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1221J15618_10018892 | 3300001523 | Hypersaline | MPATYVTEAELRANLGIENLYSSDVVETVCQSAQDLINQ |
| JGI24218J26658_10130382 | 3300002092 | Lentic | MAATFVTASELKTNLGIGTLYADSIVEEVCQASEDKIN |
| B570J40625_1007301761 | 3300002835 | Freshwater | MAATYVTVAELRANLGIGTLYTDATLDEVCQAAQDQINSFL |
| JGI25923J51411_10904181 | 3300003493 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAYLWH |
| Ga0066179_101962961 | 3300004126 | Freshwater Lake | MAASYVTMAELRSNLGIGTLYSDATVEECCQSAEDQLNAFLWFD |
| Ga0007746_10726872 | 3300004763 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYSDATVEECCQAAEDLIQGY |
| Ga0007748_114744581 | 3300004769 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAYLW |
| Ga0007760_113337892 | 3300004793 | Freshwater Lake | MAAVMVTMQELRNNLGIGTLYTDATVEECCQTAEDLVGAYLW |
| Ga0007764_116665142 | 3300004797 | Freshwater Lake | MAATYVTVAELRADLGIGTLYSDATVEEVCQTAEDLLNQYL |
| Ga0007759_100183781 | 3300004836 | Freshwater Lake | MAAAMVTMQELRTNLGIGTLYTDATVEECCQSAEDLIQGYLWHNDA |
| Ga0070374_101404332 | 3300005517 | Freshwater Lake | MAASYVTMAELRTNLGIGTLYSDPTVEECCQAAEDQLNAFLWFD |
| Ga0068885_10152842 | 3300005565 | Freshwater Lake | MPATYVTEAELRSNLGIGSLYTSATVEECCQTAED |
| Ga0070744_102378321 | 3300006484 | Estuarine | MAATYVTEAELRANLGIGTLYSSDIVETCCQTAEDL |
| Ga0079301_11786381 | 3300006639 | Deep Subsurface | MVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQGYLWHNDAPVV |
| Ga0070749_107845642 | 3300006802 | Aqueous | MPAQYVTTAELRSNLGIGTLYSDATVEEVCQTSEDLINQY |
| Ga0075464_105809261 | 3300006805 | Aqueous | VAATYVTTAELKANIGIGSLFADSIVEEVCQTAEDL |
| Ga0102828_12069111 | 3300007559 | Estuarine | MAAAMVTMQELRTNLGIGTLYTDATVEECCQSAEDLIQGYLW |
| Ga0102859_10188312 | 3300007708 | Estuarine | MAATYVTMAELRTNLGIGTLYADATVEEVCQSAQDIIDAYLWYNSALV |
| Ga0102859_11899822 | 3300007708 | Estuarine | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLIQGYLWHN |
| Ga0105746_13651591 | 3300007973 | Estuary Water | MPSVMVTEAELRTNLGIETLYSSATVEECCQAAEDL |
| Ga0105747_13332992 | 3300007974 | Estuary Water | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLIQGYLWH |
| Ga0114354_10261001 | 3300008119 | Freshwater, Plankton | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQSYLWHND |
| Ga0114880_10957492 | 3300008450 | Freshwater Lake | MAATYVTEAELRANLQLGNLYSSATVEEVCQAAEN |
| Ga0114880_12331121 | 3300008450 | Freshwater Lake | MTATYVTEAELRSNLGIGSLYSSATVEEVCQTAQDLLNQ |
| Ga0105093_101313002 | 3300009037 | Freshwater Sediment | MAATYVTEAELRSNLGIENLYSSDIVETVCQTAQDLL |
| Ga0105093_108352982 | 3300009037 | Freshwater Sediment | MAATYVTEAELRSNLGIENLYRSAVVEEVCQTAQDLLNQFLWFDS |
| Ga0114973_101545741 | 3300009068 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAYLWHND |
| Ga0105099_107786761 | 3300009082 | Freshwater Sediment | MAATYVTEAELRSNLGFENLYSSAVVEEVCQTAQDLLNQF |
| Ga0114968_107386181 | 3300009155 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAY |
| Ga0114970_101623891 | 3300009163 | Freshwater Lake | MQELRDNLGIGTLYADATVEEVCQTAQDLLNQYLW |
| Ga0114979_101360762 | 3300009180 | Freshwater Lake | MAATYVTMAELRSNLGIGTLYSDSTVEECCQTAEDLINSYLWFDSVP |
| Ga0114971_104404922 | 3300009185 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYSDATVEECCQAAEDL |
| Ga0114958_104387351 | 3300009684 | Freshwater Lake | MAATYVTATELRTNLGIGALYSDTIVEECCQTSED |
| Ga0114967_101502762 | 3300010160 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAED |
| Ga0129318_100861091 | 3300011009 | Freshwater To Marine Saline Gradient | MAASYVTVAQLRSNLGIGTLYSDADLESICQTSEDLLNSY |
| Ga0157498_10219882 | 3300012666 | Freshwater, Surface Ice | MAATYVTVAELRSNLGIGTLYSDSTVEECCQAAQDQIN |
| Ga0157623_10108932 | 3300012707 | Freshwater | MPATYVTVAELRANLGIGTLYSDSDVESVCQTSQD |
| Ga0157598_10919941 | 3300012712 | Freshwater | MPAQFVTVAELRANLGIGSLYSDATVEEVCQTAED |
| Ga0157605_10363852 | 3300012716 | Freshwater | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDL |
| Ga0138289_10507052 | 3300012763 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLVGAYLWH |
| Ga0138290_11105692 | 3300012773 | Freshwater Lake | MAAAMVTMQELRTNLGIGTLYTDATVEECCQAAEDLIQGYL |
| Ga0138290_12189242 | 3300012773 | Freshwater Lake | MAAVYVTKSELRTNLGIGNLYSDSTVEEVCQTAEDIL |
| Ga0164293_108557741 | 3300013004 | Freshwater | MAATYVTVAELRSNLGIGTLYTDATLEEVCQTSEDLISEY |
| Ga0164294_106776311 | 3300013006 | Freshwater | MPAVYVTTAELRSNLGIGTLYTDATVEEVCQTAEDLI |
| Ga0181338_10436041 | 3300015050 | Freshwater Lake | MAAVMVTMQELRTNLGIGTLYTDATVEECCQSAEDLVGAYL |
| Ga0181364_10703401 | 3300017701 | Freshwater Lake | MPASYVTVAELRANLGIGTLYTDPTVEDCCQAAQDQINSFL |
| Ga0181363_10884151 | 3300017707 | Freshwater Lake | MPASYVTEQELRDNLGIQNLYSDATVEEVCQAAQDQINSFLWF |
| Ga0181350_11259031 | 3300017716 | Freshwater Lake | MAATYVTVAELRSNLGICTLYTYATIEEVCQTSEDLINQYLW |
| Ga0181350_11319981 | 3300017716 | Freshwater Lake | MPASYVTEAELRSNLGIGTLYTSATVEECCQSAEDLVNQ |
| Ga0181365_10441571 | 3300017736 | Freshwater Lake | MAAAMVTMQELRTNLGIGTLYTDATVEECCQSAEDLIQGY |
| Ga0181365_10642992 | 3300017736 | Freshwater Lake | MAASYVTVAQLRSNLGIGTLYSDADLESICQTSED |
| Ga0181356_11763321 | 3300017761 | Freshwater Lake | MAATFVTEAELRSNLGIGTLYLSATVEEVCQTASP |
| Ga0181356_11807922 | 3300017761 | Freshwater Lake | MPASYVTEAELRSNLGIGTLYTSATVEECCQSAEDL |
| Ga0181358_12719732 | 3300017774 | Freshwater Lake | MAAAMVTMQELRTNLGIGTLYTDATVEECCQSAEDL |
| Ga0181357_10440742 | 3300017777 | Freshwater Lake | MAASYVTMAELRTNLGIGTLYSDATVEECCQAAEDQLNAFLWFDSA |
| Ga0181357_11839991 | 3300017777 | Freshwater Lake | MTASYVTVAQLRSNLGIGTLYSDADLESICQTSED |
| Ga0181349_10804311 | 3300017778 | Freshwater Lake | MPASYVTEAELRSNLGIENLYSSDIVETCCQAAQDLLNQFLW |
| Ga0181346_12392351 | 3300017780 | Freshwater Lake | MQELRDNLGIGTLYSNATVEECCQSAEDIINSYLWYNSALV |
| Ga0181355_11094081 | 3300017785 | Freshwater Lake | MAAVMVTMAELRSNLGIGTLYTDATVEECCQSAED |
| Ga0181359_10691042 | 3300019784 | Freshwater Lake | MAAAMVTMQELRTNLGIGTLYTDATVEECCQSAEDLVGAYL |
| Ga0207193_11192331 | 3300020048 | Freshwater Lake Sediment | MAATYVTEAELRANLGIENLYSSAIVEEVCQTAQDLVNQFLWF |
| Ga0194047_102058542 | 3300021354 | Anoxic Zone Freshwater | MTATYVTVAELKANLGIQNLYSDTIVEEVCQSAEDIV |
| Ga0194048_101985861 | 3300021519 | Anoxic Zone Freshwater | MTATYVTEAELRANLGIGTLYTSDIVETCCQTAEDLINQFLWFNTAPV |
| Ga0194048_103123462 | 3300021519 | Anoxic Zone Freshwater | MTASYVTVAQLRSNLGIGSLYSDADLESICQTSED |
| Ga0222713_101956452 | 3300021962 | Estuarine Water | MAATYVTVAELRANLGIGTLYTDATIDEVCQAAQD |
| Ga0222713_106067281 | 3300021962 | Estuarine Water | MAAAMVTMAELRSNLGIGTLYTDATVEECCQSAEDLIQGYLWHND |
| Ga0181354_10977602 | 3300022190 | Freshwater Lake | MPASYVTEAELRSNLGIGTLYTSATVEECCQSAEDLVNQYLW |
| Ga0181354_11898401 | 3300022190 | Freshwater Lake | MAASYVTVAQLRSNLGIGTLYSDADLESICQTSEDLLNS |
| Ga0196901_10362963 | 3300022200 | Aqueous | MPSSYVTQQELRTNLGIGTLYSNNDVEEVCQAAQDLIEKMLWFN |
| Ga0181351_12523412 | 3300022407 | Freshwater Lake | MAASYVTVAQLRSNLGIGTLYSDADLESICQTSEDLLN |
| Ga0236341_10871751 | 3300022591 | Freshwater | MTATYVTAAELKANLGIGTLYSDSIVEEVCQSAQDL |
| Ga0244775_102613591 | 3300024346 | Estuarine | MAATYVTEAELRANLGIENLYSSAIVEEVCQTAQDLL |
| Ga0244775_114454551 | 3300024346 | Estuarine | MAATYVTEAELRANLGIGTLYTSDIVETCCQTAEDLI |
| Ga0244775_114677502 | 3300024346 | Estuarine | MAAVMVTEAELRSNLGIGTLYSSATVEECCQSAEDLVGAY |
| Ga0256308_10659051 | 3300024549 | Freshwater | MAASYVTVAQLRTNLGIGSLYSDADLESICQTSEDLLNSY |
| Ga0255252_10067721 | 3300024853 | Freshwater | MVTMQELRTNLGIGTLYTDATVEECCQTAEDLVGAYLWHNDAPVV |
| Ga0208795_10834452 | 3300025655 | Aqueous | MPATFVTEAELRSALGIGALYSSAVVEECCQAAED |
| Ga0209182_101224221 | 3300025843 | Lake Sediment | MAASYVTMAELRTNLGIGTLYSDATVEECCQSAEDQLNAFLWFDSA |
| Ga0208916_103896901 | 3300025896 | Aqueous | MAATYVTAAELKANLGIGTLYSDSIVEEVCQTAEDMLNSYLWFDS |
| Ga0256315_10095631 | 3300026417 | Freshwater | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQGYLW |
| Ga0208009_10385202 | 3300027114 | Deep Subsurface | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLI |
| Ga0208800_10406362 | 3300027193 | Estuarine | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLV |
| Ga0208554_10262102 | 3300027212 | Estuarine | MAATYVTMAELRTNLGIGTLYADATVEEVCQSAQDIIDAYLWYNSALVYA |
| Ga0208555_10708232 | 3300027213 | Estuarine | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLVGA |
| Ga0208787_11202392 | 3300027518 | Deep Subsurface | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQG |
| Ga0208133_10041944 | 3300027631 | Estuarine | MAAVMVTMQQLRDNLGIGTLYSDATVEEVLPVCRRF |
| Ga0208133_11434362 | 3300027631 | Estuarine | MAATYVTEAELRANLSIGTLYSSDIVETCCQTAEDLLN |
| Ga0209769_10697101 | 3300027679 | Freshwater Lake | MAAVMVTEAELRSNLGIGTLYSSATVEECCQSAED |
| Ga0209499_10382961 | 3300027712 | Freshwater Lake | VAATYVTTAELKANLGIGSLYADSIVENVCQTAEDL |
| Ga0209499_12668721 | 3300027712 | Freshwater Lake | MAATYVTATELRTNLGIGALYSDTIVEECCQTSEDLLN |
| Ga0209297_10129504 | 3300027733 | Freshwater Lake | MAATYVTEAELRANLGIGTLYTSDIVETCCQTAEDLINQFLWFNTAPV |
| Ga0209087_11054001 | 3300027734 | Freshwater Lake | MAATYVTVAELRADLGIGTLYSDATVEEVCQTSQDLLNQYL |
| Ga0209190_13693101 | 3300027736 | Freshwater Lake | MTASYVTVAQLRSNLGIGNLYSDADLESICQTSEDLLN |
| Ga0209597_10640611 | 3300027746 | Freshwater Lake | MAATFCTEAELRANLTLGSLYSSPTVEEVCQAGENI |
| Ga0209596_12955671 | 3300027754 | Freshwater Lake | MVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAYLW |
| Ga0209596_13247121 | 3300027754 | Freshwater Lake | MVTMAELRSNLGIGTLYTDATVEECCQSAEDLISAYLWHN |
| Ga0209770_101080982 | 3300027769 | Freshwater Lake | MAATYVTEAELRANLGIENLYSSAIVEEVCQTAQDLVNQFLWFDSAPV |
| Ga0209829_101512492 | 3300027777 | Freshwater Lake | MAATYVTASELKANLGIGTLYADSIVEEVCQTAQDLLNQYLW |
| Ga0209246_101299772 | 3300027785 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQ |
| Ga0209353_101146842 | 3300027798 | Freshwater Lake | MVTMQELRNNLGIGTLYTDATVEECCQTAEDLVGAYLW |
| Ga0209353_103854692 | 3300027798 | Freshwater Lake | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLVGAYLW |
| Ga0209229_103012491 | 3300027805 | Freshwater And Sediment | MAATYVTMAELRTNLGIGTLYSDATVEEVCQSAEDIVSSYL |
| Ga0209354_101162821 | 3300027808 | Freshwater Lake | MPASYVTEAELRSNLGIGTLYTSATVEECCQSAEDLVN |
| Ga0209354_103041381 | 3300027808 | Freshwater Lake | VPATYVTEAELRANLGIENLYSSDIVETCCQAAQDLIN |
| Ga0209668_112282941 | 3300027899 | Freshwater Lake Sediment | MAATYVTTAELRANLGIGSLYSDATVEECCQSSED |
| Ga0209298_102107002 | 3300027973 | Freshwater Lake | MAATYVTEAELRANLGIGTLYTSDIVETCCQTAEDLINQFLWFNTA |
| Ga0209299_11056962 | 3300027974 | Freshwater Lake | MEMAATFVTVAELRANLGIGTLYSDPIVEEVCMSAEDLIQSQLWYNR |
| Ga0209299_11663552 | 3300027974 | Freshwater Lake | MAATYVTEAELRANLGIGTLYTSDIVETCCQTAEDLINQFL |
| Ga0255260_10461702 | 3300028081 | Freshwater | MVTMQELRTNLGIGTLYTDATVEECCQTAEDLIGAYLWHNDAPV |
| Ga0255234_10945742 | 3300028113 | Freshwater | MVTQAELRTNLGIGTLYSDSTVEECCQSAEDLINSYL |
| Ga0315288_105779611 | 3300031772 | Sediment | MAAAMVTMQELRNNLGIGTLYTDATVEECCQSAEDLVG |
| Ga0315274_114141151 | 3300031999 | Sediment | MAAAMVTMQELRNNLGIGTLYTDATVEECCQSAEDLIQGYLW |
| Ga0315284_116153602 | 3300032053 | Sediment | MAASYVTVAQLRSNLGIGTLYSDADLESICQTSEDLLNSYL |
| Ga0315903_104920061 | 3300032116 | Freshwater | MPATYVTEAELRANLGIENLYSSDIVETCCQTAQDLL |
| Ga0315903_105899371 | 3300032116 | Freshwater | MAATYVTEAELRSALGIGALYSSAVVEEVCQAAEN |
| Ga0334992_0370613_2_121 | 3300033992 | Freshwater | MVTEAELRSNLGIGTLYSSATVEECCQSAEDLVGAYLWHN |
| Ga0334992_0399985_3_107 | 3300033992 | Freshwater | MPATYVTVAELRANLGIGTLYSDSDVETCCQAAQD |
| Ga0334985_0641052_465_584 | 3300034018 | Freshwater | MPATYVTEAELRANLGIENLYSSDIVETCCQAAQDLLNQF |
| Ga0334987_0507926_3_110 | 3300034061 | Freshwater | MPASYVTVAELRSNLGIGTLYSDSTVEECCQAAQDQ |
| Ga0334995_0248283_1094_1198 | 3300034062 | Freshwater | MVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQG |
| Ga0335029_0593454_1_138 | 3300034102 | Freshwater | MAAAMVTMAELRSNLGIGTLYSDATVEECCQSAEDLIQGYLWHNDA |
| Ga0335036_0352711_853_960 | 3300034106 | Freshwater | MPASFVTVAELRANLGIGSLYSDATVEECCQSAEDL |
| Ga0335056_0480360_518_655 | 3300034120 | Freshwater | MVTEAELRSNLGIGTLYSSATVEECCQSAEDLVGAYLWHNDAPVVG |
| Ga0335007_0562917_539_667 | 3300034283 | Freshwater | MVTEAELRSNLGIGTLYSSATVEECCQSAEDLVGAYLWHNDAP |
| ⦗Top⦘ |