| Basic Information | |
|---|---|
| Family ID | F068801 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RAWEALLRDKKRTGDAINLVLLGDDGPYVAARPADEVRAALDTLIA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 95.16 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.129 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.68% β-sheet: 24.32% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF01220 | DHquinase_II | 70.97 |
| PF01321 | Creatinase_N | 22.58 |
| PF02274 | ADI | 0.81 |
| PF09285 | Elong-fact-P_C | 0.81 |
| PF00351 | Biopterin_H | 0.81 |
| PF02786 | CPSase_L_D2 | 0.81 |
| PF01761 | DHQ_synthase | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 70.97 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 22.58 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.81 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.81 |
| COG3186 | Phenylalanine-4-hydroxylase | Amino acid transport and metabolism [E] | 0.81 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.97 % |
| Unclassified | root | N/A | 4.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918006|ConsensusfromContig8850 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 2140918008|ConsensusfromContig254292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 2166559005|cont_contig12813 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 2170459003|FZN2CUW02HKWGM | Not Available | 507 | Open in IMG/M |
| 3300000956|JGI10216J12902_110943513 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004114|Ga0062593_100088260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2133 | Open in IMG/M |
| 3300004153|Ga0063455_100467908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300004156|Ga0062589_101818491 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005093|Ga0062594_101041330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300005327|Ga0070658_10599413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300005332|Ga0066388_103367272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
| 3300005435|Ga0070714_101682251 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005436|Ga0070713_100845059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300005436|Ga0070713_101637077 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005437|Ga0070710_11434473 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005439|Ga0070711_100905442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300005447|Ga0066689_10759975 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005529|Ga0070741_10229366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1784 | Open in IMG/M |
| 3300005530|Ga0070679_100390647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1337 | Open in IMG/M |
| 3300005530|Ga0070679_101840767 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005540|Ga0066697_10197700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
| 3300005542|Ga0070732_10073283 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300005552|Ga0066701_10575430 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005569|Ga0066705_10535243 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005764|Ga0066903_106388323 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005834|Ga0068851_10860486 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006034|Ga0066656_11130219 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006575|Ga0074053_11254523 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006796|Ga0066665_10747486 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009093|Ga0105240_12304083 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009098|Ga0105245_10660665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300009137|Ga0066709_102397095 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009174|Ga0105241_10651924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300009174|Ga0105241_11610784 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300009174|Ga0105241_12179766 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300009651|Ga0105859_1165312 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010373|Ga0134128_12792327 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010376|Ga0126381_104626449 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010399|Ga0134127_13350256 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010401|Ga0134121_11363787 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012008|Ga0120174_1063962 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012210|Ga0137378_11095276 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012211|Ga0137377_11126740 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012357|Ga0137384_10947149 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012882|Ga0157304_1052774 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012898|Ga0157293_10149390 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012927|Ga0137416_10483146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300012961|Ga0164302_10749407 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012982|Ga0168317_1059268 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300013104|Ga0157370_11396912 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300013307|Ga0157372_11058152 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300013763|Ga0120179_1077667 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300014058|Ga0120149_1055439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300014325|Ga0163163_11613935 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014969|Ga0157376_10687856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
| 3300015262|Ga0182007_10271203 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300015356|Ga0134073_10174079 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300015371|Ga0132258_10129896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6005 | Open in IMG/M |
| 3300015373|Ga0132257_103702645 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300015373|Ga0132257_104618687 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018058|Ga0187766_11227812 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018064|Ga0187773_10189456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300018476|Ga0190274_11832434 | Not Available | 702 | Open in IMG/M |
| 3300020069|Ga0197907_10993581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1468 | Open in IMG/M |
| 3300020075|Ga0206349_1784311 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300021363|Ga0193699_10131895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300021377|Ga0213874_10034333 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300024279|Ga0247692_1075938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300025909|Ga0207705_10043798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3215 | Open in IMG/M |
| 3300025909|Ga0207705_10938892 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025911|Ga0207654_10984750 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025913|Ga0207695_10306603 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300025924|Ga0207694_11626770 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025927|Ga0207687_11948111 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300025929|Ga0207664_11226185 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025949|Ga0207667_10574780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300025949|Ga0207667_12184162 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026530|Ga0209807_1159268 | Not Available | 851 | Open in IMG/M |
| 3300026530|Ga0209807_1289417 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300026550|Ga0209474_10612860 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027829|Ga0209773_10290158 | Not Available | 683 | Open in IMG/M |
| 3300027869|Ga0209579_10427060 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027869|Ga0209579_10794687 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027911|Ga0209698_10344341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300027965|Ga0209062_1142996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300028587|Ga0247828_11146511 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300028778|Ga0307288_10462071 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300028778|Ga0307288_10481238 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300028828|Ga0307312_11029920 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300030007|Ga0311338_11917337 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031231|Ga0170824_108688961 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300031234|Ga0302325_11575214 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300031239|Ga0265328_10459256 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031247|Ga0265340_10510765 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031474|Ga0170818_105361626 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031572|Ga0318515_10288651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300031670|Ga0307374_10583714 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031682|Ga0318560_10459446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300031708|Ga0310686_115412278 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031712|Ga0265342_10027583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3546 | Open in IMG/M |
| 3300031712|Ga0265342_10553966 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300031712|Ga0265342_10659564 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031723|Ga0318493_10259709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300031724|Ga0318500_10684638 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031781|Ga0318547_10996139 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031782|Ga0318552_10134850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1235 | Open in IMG/M |
| 3300031798|Ga0318523_10116405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1319 | Open in IMG/M |
| 3300031798|Ga0318523_10585363 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031799|Ga0318565_10079372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1559 | Open in IMG/M |
| 3300031938|Ga0308175_100698612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300031942|Ga0310916_11284585 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032009|Ga0318563_10246617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300032009|Ga0318563_10721465 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300032039|Ga0318559_10409784 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032043|Ga0318556_10348034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300032067|Ga0318524_10384014 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032089|Ga0318525_10038031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2365 | Open in IMG/M |
| 3300032160|Ga0311301_12707101 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032261|Ga0306920_104447749 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032770|Ga0335085_11470737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 711 | Open in IMG/M |
| 3300032893|Ga0335069_12194480 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300033004|Ga0335084_12028826 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300033805|Ga0314864_0048583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.03% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_C_01758130 | 2140918006 | Soil | ALQRDKKRIGEEFNLVLLGDDGPRVEARPADEVRAALDSLIE |
| Bog_all_C_01501720 | 2140918008 | Soil | AWAALQRDKKRTGNAINLVLLGDDGPYVEARSPDEVRAALDTLIA |
| cont_0813.00001160 | 2166559005 | Simulated | MLRDKKRSGGEINVVLLGDDGPVVEPRPADEVRAALDTLIR |
| E4A_12317630 | 2170459003 | Grass Soil | TEAERGEINVVLLGDAGPVVEPRPADEVRAALDTLIR |
| JGI10216J12902_1109435131 | 3300000956 | Soil | ELAPKPVNVDPERAWQALLRDKKRAGDAINAVVLTDNGPAVEQRPPDEVRRELNRLIAS* |
| Ga0062593_1000882604 | 3300004114 | Soil | RDKKRSGDAINLVLLGEGGPCVEERPAAEVRRELERLIG* |
| Ga0063455_1004679081 | 3300004153 | Soil | DPDRAWQALLRDKKSTGGRINLVLLGKRGPYVEPRDPVEVRSELERLIA* |
| Ga0062589_1018184912 | 3300004156 | Soil | RDKKRTDDAINLVLLGEGGPRVEARPAAEVRRELERLIA* |
| Ga0062594_1010413301 | 3300005093 | Soil | LLRDKKSTGGQINLVLLGERGPFVERRDPDEVRRELERLIA* |
| Ga0070658_105994133 | 3300005327 | Corn Rhizosphere | VDRDRAWAALLRDKKRTGDAINLVLLGEDGPKVEARPADVVRAALDTLIA* |
| Ga0066388_1033672721 | 3300005332 | Tropical Forest Soil | LLRDKKRTGDAINLVLLGDDGPRVEERPAPEVRRELERLIG* |
| Ga0070714_1016822511 | 3300005435 | Agricultural Soil | LRDKKRTGDAINLVLLGEGGPYVEPRPADEVRRELDRLIA* |
| Ga0070713_1008450591 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PDRAWQALARDKKRTGEAINLVLLGDDGPYVEARPADEVRAALDTLIAS* |
| Ga0070713_1016370772 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ERAWQALLRDKKRTGDEINLVLLGDSGPYVEARPAEDVRRELERLIA* |
| Ga0070710_114344731 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LQRDKKRAGDEIRLVLLGDDGPYLEARPAAEVRAALDSLIAQ* |
| Ga0070711_1009054423 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DRGRAWEALLRDKKRSGDAVNLVLLGDDGPYVEARPPDEVRAALDTLIA* |
| Ga0066689_107599752 | 3300005447 | Soil | RAWQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK* |
| Ga0070741_102293661 | 3300005529 | Surface Soil | GGEINLVLLSDDGPYVAPRPAAEVRAALDTLIACKS* |
| Ga0070679_1003906473 | 3300005530 | Corn Rhizosphere | AVDRDRAWAALLRDKKRTGDAINLVLLDDDGPKVEARPADVVRAALDTLIA* |
| Ga0070679_1018407671 | 3300005530 | Corn Rhizosphere | RAWEALLRDKKRTGDAINLVLLGDDGPYVAARPADEVRAALDTLIA* |
| Ga0066697_101977001 | 3300005540 | Soil | RSGGEINLVLLGDDGPYVAARPAEEVRAALDTLIA* |
| Ga0070732_100732834 | 3300005542 | Surface Soil | WQALLRDKKRDGDAINVVLLGEDGPVVEARPAAEVRRALDRLIAG* |
| Ga0066701_105754303 | 3300005552 | Soil | AVDAERAWQALLRDKKRTGDAINLVLVGDGGPRVEERPAVEVRRELERLIK* |
| Ga0066705_105352431 | 3300005569 | Soil | WQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK* |
| Ga0066903_1063883231 | 3300005764 | Tropical Forest Soil | KKRTGDTINLVLLGDGGPRVEPRPADAVRAALDTLIR* |
| Ga0068851_108604861 | 3300005834 | Corn Rhizosphere | KKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA* |
| Ga0066656_111302192 | 3300006034 | Soil | WQALLRDKKRTGDAINLVLLGDGGPRVEKRPAAEVRPELERLIK* |
| Ga0074053_112545231 | 3300006575 | Soil | WQALLRDKKRTGDAINLVLLGDSGPYVEARPAEDVRRELERLIY* |
| Ga0066665_107474863 | 3300006796 | Soil | WQALLRDKKRTGEAINLVLLGDGGPRVEERPAAEVQRELERLIK* |
| Ga0105240_123040832 | 3300009093 | Corn Rhizosphere | RDKKRTDDAINLVLLGDDGPRVEPRPAAEVRAALDTLIA* |
| Ga0105245_106606653 | 3300009098 | Miscanthus Rhizosphere | ALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA* |
| Ga0066709_1023970951 | 3300009137 | Grasslands Soil | ELAPRPVHVDADRAWQALLRDKKRAGDAINVVVLTEDGPAVEARDPQEVRAQLDRLLA* |
| Ga0105241_106519243 | 3300009174 | Corn Rhizosphere | AALLRDKKRTGDAINLVLLDDDGPKVEARPADVVRAALDTLIA* |
| Ga0105241_116107842 | 3300009174 | Corn Rhizosphere | QRDKKRTGDAINLVLLGDDGPYVEARPAGEVKAALDRLIA* |
| Ga0105241_121797662 | 3300009174 | Corn Rhizosphere | ALLRDKKRTGEAINLVLLGDGGPRVEARPADAVRAALDTLIR* |
| Ga0105859_11653123 | 3300009651 | Permafrost Soil | RDKKVEGVDVHLVLLGADGPRVEVRPPAEVRAALDSLIA* |
| Ga0126309_104837031 | 3300010039 | Serpentine Soil | KKRTGDTVNVVVLTENGPELQPRDAAEVRRELARLIA* |
| Ga0134128_127923272 | 3300010373 | Terrestrial Soil | ALLRDKKRTGADINLVLLGDDGPYVEARSPDEVRAALDTLIR* |
| Ga0126381_1046264491 | 3300010376 | Tropical Forest Soil | DPERAWQALLRDKKRTGDEINLVLLGDSGPYVEARPADDVRRELERLIA* |
| Ga0134127_133502561 | 3300010399 | Terrestrial Soil | SGETINLVLLGDDGPVVEGRPAGEVRAALDTLIG* |
| Ga0134121_113637871 | 3300010401 | Terrestrial Soil | DPERAWRALTRDKKRTGEEINLVLLGDEGPYVQARAADEVRAALDTLIAS* |
| Ga0120174_10639621 | 3300012008 | Permafrost | LQRDKKRTGDEIQLVLLGDDGPLVEARPPDEVRAALDSLIAS* |
| Ga0137378_110952761 | 3300012210 | Vadose Zone Soil | PVVAALDPQPVEVDRDRAWEALLRDKKRSGDAINLVLLGERGPYVDARSPDEVRAALDTLLA* |
| Ga0137377_111267401 | 3300012211 | Vadose Zone Soil | APQPVRVDAERAWEALLRDKKRTGDAINLVLLGEHGPYVQERPAAEVRRELERLIA* |
| Ga0137384_109471493 | 3300012357 | Vadose Zone Soil | RDKKQRDGELNLVLLGDEGPYVAAHPADEVRAALDSLIR* |
| Ga0157304_10527742 | 3300012882 | Soil | DPGRAWEALLRDKKRTGDAINVVLLGEDGPRVEERPAGDVRRELERLIA* |
| Ga0157293_101493903 | 3300012898 | Soil | LLRDKKSTAGRINLVLLGESGPYVEPREADEVRRELERLIA* |
| Ga0137416_104831463 | 3300012927 | Vadose Zone Soil | RDKKRTGEAINVVVLGDDGPRVEERPAADVRRELERLIA* |
| Ga0164302_107494071 | 3300012961 | Soil | PKPVAVDRDRAWEALLRDKKRTDETINLVLLGEDGPVVAARPPDVVRAALDTLIA* |
| Ga0168317_10592683 | 3300012982 | Weathered Mine Tailings | EALLRDKKRSGATINLVLLADGGPVVEARSADEVRAALDTLIA* |
| Ga0157370_113969121 | 3300013104 | Corn Rhizosphere | KRSGNVINLVLLGDDGPVVEPRPADDVRAALDSLIR* |
| Ga0157372_110581521 | 3300013307 | Corn Rhizosphere | ALLRDKKRTGADINLVLLGNDGPYVEARSPDEVRAALDTLIL* |
| Ga0120179_10776671 | 3300013763 | Permafrost | AWEALLRDKKRERDEINLVLLGDDGPYVEARPPDEVRAALDTLIA* |
| Ga0120149_10554393 | 3300014058 | Permafrost | LLLDKKRTGDAINLVLLGDDGPRLEARPAHEVRAALDSLIR* |
| Ga0163163_116139353 | 3300014325 | Switchgrass Rhizosphere | AWQALLRDKKRSGDEIVLVLLGADGPTVEPRPADEVRQALYTLIR* |
| Ga0157376_106878561 | 3300014969 | Miscanthus Rhizosphere | RSGDEIVLVLLGDDGPTVESRPADEVRQALYTLIS* |
| Ga0182007_102712031 | 3300015262 | Rhizosphere | KRSGDTINLVLLGDAGPYLEARSPEEVRAALDTLIAD* |
| Ga0134073_101740791 | 3300015356 | Grasslands Soil | GDAINLVLLGDDGPYVEARPADDVRAALDRLIVS* |
| Ga0132258_101298961 | 3300015371 | Arabidopsis Rhizosphere | SGVERELDPQPVGLDPERAWQALLRDKKRTGDAINVVVLTGDGAKVEPRPPEEVRRELNRLIA* |
| Ga0132257_1037026451 | 3300015373 | Arabidopsis Rhizosphere | VSVDRERAWQALLRDKKRTGEAINLVLLGDEGPYVEARPADEVRRELERLIA* |
| Ga0132257_1046186872 | 3300015373 | Arabidopsis Rhizosphere | DKKRTGDAVNVVLLGEDGPVVEERPAAEVRRELQRLIT* |
| Ga0187766_112278121 | 3300018058 | Tropical Peatland | DKKRTGDAINLVLLGADGPYVEPRPADEVRRELERLIA |
| Ga0187773_101894561 | 3300018064 | Tropical Peatland | ALLRDKKRSGDAVNVVLLGPGGPVVEERPAAAVRRELDRLIA |
| Ga0190274_118324342 | 3300018476 | Soil | ERAWQALLRDKKHIGGDINIVLLGDGGPVVEARPADEVRRELERLIVGAG |
| Ga0197907_109935811 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | KRAAGEINLVLLSDDGPTLEARSAEEVRAALDTLIR |
| Ga0206349_17843111 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | KKRAGGEINLVLLSDDGPTLEARSAEEVRAALDTLIR |
| Ga0193699_101318951 | 3300021363 | Soil | EALQRDKKRTGDEINLVLLGDDGPYVEARSADEVRAALDRLLR |
| Ga0213874_100343333 | 3300021377 | Plant Roots | RAWRALLRDKKRAGDTINLVLLGDAGPVVESRPADEVRAALDTLII |
| Ga0247692_10759382 | 3300024279 | Soil | DTAPMIEALDPQPVQVDRDRAWEALQRDKKRTGDEINLVLLGEDGPYVEARSPDEVRAALDTLIL |
| Ga0207705_100437981 | 3300025909 | Corn Rhizosphere | VAVDRRRAWEALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA |
| Ga0207705_109388922 | 3300025909 | Corn Rhizosphere | DRDRAWAALLRDKKRTGESINLVLLGDDGPKVEARPADEVRAFFAELI |
| Ga0207654_109847501 | 3300025911 | Corn Rhizosphere | VAVDRDDAWAALLRDKKRTGEAINLVLLGDGGPRVEARPADAVRAALDTLIR |
| Ga0207695_103066031 | 3300025913 | Corn Rhizosphere | ARVDVDRAWEALLRDKKRAGAEINVVLLGADGPVVEPRPADEVRRELERLIA |
| Ga0207694_116267702 | 3300025924 | Corn Rhizosphere | LRDKKRSGETINLVLLGDDGPVVEGRPAGEVRAALDTLIG |
| Ga0207687_119481112 | 3300025927 | Miscanthus Rhizosphere | ALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA |
| Ga0207664_112261851 | 3300025929 | Agricultural Soil | PVSVDRERAWEALLRDKKRTGDAINVVVLGEDGPRVEERPAADLRRELERLIA |
| Ga0207667_105747803 | 3300025949 | Corn Rhizosphere | RRRAWEALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA |
| Ga0207667_121841622 | 3300025949 | Corn Rhizosphere | RAWAALLRDKKRSGGEINLVLLGADGPLVEARPEAEVRAALATLIA |
| Ga0209807_11592681 | 3300026530 | Soil | WQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK |
| Ga0209807_12894172 | 3300026530 | Soil | DPERAWQALLRDKKRTGDAINLVLLGGDGPLVEERPAADVRRELERLIA |
| Ga0209474_106128602 | 3300026550 | Soil | DPAPIVDALDPQPVAVDRDVAWEALQRDKKRSGGQINLVLLGEDGPYVAARPAEEVRAALDTLIRH |
| Ga0209773_102901583 | 3300027829 | Bog Forest Soil | DKKRSGEEINLVLLGDGGPYVEARPAAEVRRELERLIA |
| Ga0209579_104270601 | 3300027869 | Surface Soil | DADRAWAALLRDKKRTGDAINVVLLGEDGPFVDERPAADVRRELERLIQ |
| Ga0209579_107946871 | 3300027869 | Surface Soil | ALQRDKKVEGGAVKLVLLGEHGPTLEERPPAEVRAALDSLIA |
| Ga0209698_103443411 | 3300027911 | Watersheds | KRSGAAINLVLLGEDGPFVAERPAAEVREALEALIAAEP |
| Ga0209062_11429963 | 3300027965 | Surface Soil | REGGEILLVLLGDDGPVVEARPADEVRAALDTLMA |
| Ga0247828_111465112 | 3300028587 | Soil | QALLRDKKRSGDEIVLVLLGDDGPTVESRPADEVRQALYTLIS |
| Ga0307288_104620711 | 3300028778 | Soil | AWQALLRDKKRSGDEIVLVLLGDDGPTVESRPADEVQQALYTLIS |
| Ga0307288_104812382 | 3300028778 | Soil | DKKRTGEEINLVLLGDDGPYVEARSPDEVRAALDTLIR |
| Ga0307312_110299202 | 3300028828 | Soil | LLRDKKRTGNAINVVVLGDDGPRVEERSAPDVRRELERLIA |
| Ga0311338_119173372 | 3300030007 | Palsa | GGAINLVLLGPDGPVVEERPAAEVRGALEELIADPALNGAH |
| Ga0170824_1086889611 | 3300031231 | Forest Soil | VHVDRERAWAALLRDKKRSGETINLVLLGEDGPYLDARSPDEVRAALDTLIS |
| Ga0302325_115752143 | 3300031234 | Palsa | KPVAVDADRAWEALLRDKKRSGDEINLVLLGEDGPYVEARPAVEVRAELERLIA |
| Ga0265328_104592562 | 3300031239 | Rhizosphere | DPERAWAALQRDKKRTGSDINLVLLGDDGPFVEARSPDEVRAALDTLIS |
| Ga0265340_105107652 | 3300031247 | Rhizosphere | KKVEGGAVKLVLLGADGPTVEERPPAEVRAALDSLIA |
| Ga0170818_1053616261 | 3300031474 | Forest Soil | PVHVDPERAWQALLRDKKRTGDTINLVLLGDKGPYVAPRPADEVRRELERLIA |
| Ga0318515_102886511 | 3300031572 | Soil | AWSALQRDKKRAGGEINLVLLGSDGPIVEPRPPHEVRTALDSLIAD |
| Ga0307374_105837142 | 3300031670 | Soil | ERAWQALLRDKKRTGEAINLVLLGPDGPFVEERPPEEVRRELERLIA |
| Ga0318560_104594463 | 3300031682 | Soil | KKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA |
| Ga0310686_1154122782 | 3300031708 | Soil | AWQALLRDKKRSGEAIKLVLLGDDGPYVAERPAAEVREALETLIAKPSLSRAS |
| Ga0265342_100275831 | 3300031712 | Rhizosphere | KRTGSDINLVLLGDDGPFVEARSPDEVRAALDTLIS |
| Ga0265342_105539662 | 3300031712 | Rhizosphere | ALQRDKKVEGGAVKLVLLGADGPTVEERPPAEVRAALDSLIA |
| Ga0265342_106595642 | 3300031712 | Rhizosphere | DRAWEALLRDKKGQDGAINLVLLSPDGPTVESRPHAEVRAALDSLIA |
| Ga0318493_102597091 | 3300031723 | Soil | ERAWQALLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA |
| Ga0318500_106846381 | 3300031724 | Soil | VRRDKKRAGGEIRLVLLGEDGPVVEARPEGEVRAALDTLIR |
| Ga0318547_109961392 | 3300031781 | Soil | AWEALRRDKKRAGGEIRLVLLGEDGPVVEARPEGEVRAALDTLIR |
| Ga0318552_101348503 | 3300031782 | Soil | VAADHERAWAALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA |
| Ga0318523_101164053 | 3300031798 | Soil | RAWAALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA |
| Ga0318523_105853632 | 3300031798 | Soil | VRVDPERAWQAVLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA |
| Ga0318565_100793721 | 3300031799 | Soil | ERAWSALQRDKKRAGGEINLVLLGSDGPIVEPRPPHEVRTALDSLIAD |
| Ga0308175_1006986121 | 3300031938 | Soil | LLRDKKRTGDAINVVLVGDGGPRIEERPAAEVRRELERLIA |
| Ga0310916_112845852 | 3300031942 | Soil | ALLRDKKRSDGEINLVLLGDDGPFVEPRPEADVRAALDDLIV |
| Ga0318563_102466173 | 3300032009 | Soil | RPVRVDRDRAWDALLRDKKRSAGAINLVLLGATGPVVESRPADEVRAALYSLTLD |
| Ga0318563_107214651 | 3300032009 | Soil | LLRDKKRSGEAINLVLLGDAGPYVEARPAAEVRRELERLIA |
| Ga0318559_104097842 | 3300032039 | Soil | SERAWQALLRDKKRSGDAINLVLLGDDGPYVEPRPADDVRRELERLIA |
| Ga0318556_103480343 | 3300032043 | Soil | DALLRDKKRSAGAINLVLLGATGPVVESRPADEVRAALYSLTLD |
| Ga0318524_103840143 | 3300032067 | Soil | AWQALLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA |
| Ga0318525_100380311 | 3300032089 | Soil | ALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA |
| Ga0311301_127071011 | 3300032160 | Peatlands Soil | RAWEALLRDKKRSGADVNLVLLGDDGPYLATRPAAEVRAALESLIAVG |
| Ga0306920_1044477491 | 3300032261 | Soil | VRVDPERAWQALLRDKKRSGEAINLVLLGDAGPYVEARPAADVRRELERLIA |
| Ga0335085_114707371 | 3300032770 | Soil | LRDKKRSGDAINLVLLGDEGPYVEARPADEVRRELERLIA |
| Ga0335069_121944801 | 3300032893 | Soil | RAWQALLRDKKRERGEILLVLLGDGGPVVEPRAADVVRAALETLIV |
| Ga0335084_120288261 | 3300033004 | Soil | DRDRAWQALLRDKKRSGDSINLVLLGDQGPYVDARPPDEVRAALDTLIS |
| Ga0314864_0048583_2_121 | 3300033805 | Peatland | DKKRAGGAINLVLLGADGPTVEPRPPDEVRAALDSLIRD |
| ⦗Top⦘ |