| Basic Information | |
|---|---|
| Family ID | F068795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTKETTPLWVWLSVALLAIGALAYATTVYFVEYIIGFF |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.00 % |
| % of genes near scaffold ends (potentially truncated) | 26.61 % |
| % of genes from short scaffolds (< 2000 bps) | 83.87 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.968 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF04960 | Glutaminase | 25.00 |
| PF05977 | MFS_3 | 15.32 |
| PF07690 | MFS_1 | 15.32 |
| PF00793 | DAHP_synth_1 | 2.42 |
| PF14489 | QueF | 2.42 |
| PF04392 | ABC_sub_bind | 1.61 |
| PF06418 | CTP_synth_N | 1.61 |
| PF07519 | Tannase | 0.81 |
| PF13419 | HAD_2 | 0.81 |
| PF06779 | MFS_4 | 0.81 |
| PF02743 | dCache_1 | 0.81 |
| PF07045 | DUF1330 | 0.81 |
| PF00117 | GATase | 0.81 |
| PF13565 | HTH_32 | 0.81 |
| PF07992 | Pyr_redox_2 | 0.81 |
| PF00027 | cNMP_binding | 0.81 |
| PF01243 | Putative_PNPOx | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF00199 | Catalase | 0.81 |
| PF00034 | Cytochrom_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2066 | Glutaminase | Amino acid transport and metabolism [E] | 25.00 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 15.32 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 1.61 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.61 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.81 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.97 % |
| Unclassified | root | N/A | 4.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100123976 | Not Available | 506 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100401127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 631 | Open in IMG/M |
| 3300001661|JGI12053J15887_10540209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 556 | Open in IMG/M |
| 3300003322|rootL2_10083041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1332 | Open in IMG/M |
| 3300004479|Ga0062595_102281978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 533 | Open in IMG/M |
| 3300005353|Ga0070669_101787680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 536 | Open in IMG/M |
| 3300005356|Ga0070674_100089591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2217 | Open in IMG/M |
| 3300005445|Ga0070708_101348061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 666 | Open in IMG/M |
| 3300005459|Ga0068867_101682047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 595 | Open in IMG/M |
| 3300005511|Ga0077121_10319606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1134 | Open in IMG/M |
| 3300005539|Ga0068853_100320468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1437 | Open in IMG/M |
| 3300005543|Ga0070672_100192327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1704 | Open in IMG/M |
| 3300005548|Ga0070665_100176025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2140 | Open in IMG/M |
| 3300005548|Ga0070665_101899551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005552|Ga0066701_10003818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 5978 | Open in IMG/M |
| 3300005553|Ga0066695_10862292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
| 3300005559|Ga0066700_10567002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 792 | Open in IMG/M |
| 3300005614|Ga0068856_100431131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1338 | Open in IMG/M |
| 3300005616|Ga0068852_100438099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 1292 | Open in IMG/M |
| 3300005718|Ga0068866_10391552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 894 | Open in IMG/M |
| 3300005840|Ga0068870_10687269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
| 3300005844|Ga0068862_100311185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1452 | Open in IMG/M |
| 3300005937|Ga0081455_10019088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 6499 | Open in IMG/M |
| 3300005937|Ga0081455_10912420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 546 | Open in IMG/M |
| 3300005983|Ga0081540_1055124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1938 | Open in IMG/M |
| 3300005985|Ga0081539_10027695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3583 | Open in IMG/M |
| 3300005985|Ga0081539_10029559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3421 | Open in IMG/M |
| 3300006028|Ga0070717_11442974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 625 | Open in IMG/M |
| 3300006031|Ga0066651_10686734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 549 | Open in IMG/M |
| 3300006047|Ga0075024_100592140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 595 | Open in IMG/M |
| 3300006581|Ga0074048_12570174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 619 | Open in IMG/M |
| 3300006796|Ga0066665_10160155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1715 | Open in IMG/M |
| 3300006797|Ga0066659_10112384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1874 | Open in IMG/M |
| 3300006800|Ga0066660_10086328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 2179 | Open in IMG/M |
| 3300006904|Ga0075424_101787685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 650 | Open in IMG/M |
| 3300009012|Ga0066710_100171872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3048 | Open in IMG/M |
| 3300009143|Ga0099792_10157896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1256 | Open in IMG/M |
| 3300009143|Ga0099792_10489852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 768 | Open in IMG/M |
| 3300009177|Ga0105248_10045064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 4946 | Open in IMG/M |
| 3300009551|Ga0105238_11021368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 848 | Open in IMG/M |
| 3300009553|Ga0105249_11216678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 824 | Open in IMG/M |
| 3300009806|Ga0105081_1090096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 508 | Open in IMG/M |
| 3300010044|Ga0126310_10340912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1047 | Open in IMG/M |
| 3300010045|Ga0126311_11111898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157 | 650 | Open in IMG/M |
| 3300010166|Ga0126306_11165939 | Not Available | 632 | Open in IMG/M |
| 3300010320|Ga0134109_10127289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
| 3300010371|Ga0134125_11998789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 630 | Open in IMG/M |
| 3300010375|Ga0105239_10708379 | Not Available | 1151 | Open in IMG/M |
| 3300012204|Ga0137374_10387304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
| 3300012210|Ga0137378_10554676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1058 | Open in IMG/M |
| 3300012349|Ga0137387_10107807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1949 | Open in IMG/M |
| 3300012355|Ga0137369_10576309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 786 | Open in IMG/M |
| 3300012359|Ga0137385_10185161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1823 | Open in IMG/M |
| 3300012361|Ga0137360_10953586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300012362|Ga0137361_10432488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1209 | Open in IMG/M |
| 3300012500|Ga0157314_1043474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300012915|Ga0157302_10530018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300012922|Ga0137394_10077770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2772 | Open in IMG/M |
| 3300012924|Ga0137413_10177124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1416 | Open in IMG/M |
| 3300012924|Ga0137413_10487032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 904 | Open in IMG/M |
| 3300012929|Ga0137404_10552744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1031 | Open in IMG/M |
| 3300012958|Ga0164299_10020883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 2680 | Open in IMG/M |
| 3300012961|Ga0164302_10007598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4068 | Open in IMG/M |
| 3300013306|Ga0163162_10393621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1518 | Open in IMG/M |
| 3300013308|Ga0157375_11872404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 712 | Open in IMG/M |
| 3300014166|Ga0134079_10436967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 617 | Open in IMG/M |
| 3300014322|Ga0075355_1108717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 697 | Open in IMG/M |
| 3300015242|Ga0137412_10329283 | Not Available | 1192 | Open in IMG/M |
| 3300015264|Ga0137403_10224215 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300015264|Ga0137403_10702732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 871 | Open in IMG/M |
| 3300015356|Ga0134073_10276179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
| 3300015373|Ga0132257_100291945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1957 | Open in IMG/M |
| 3300017792|Ga0163161_11287769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 635 | Open in IMG/M |
| 3300018000|Ga0184604_10378403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300018028|Ga0184608_10229269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 816 | Open in IMG/M |
| 3300018053|Ga0184626_10038484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1984 | Open in IMG/M |
| 3300018061|Ga0184619_10108276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1252 | Open in IMG/M |
| 3300018083|Ga0184628_10056466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1986 | Open in IMG/M |
| 3300018465|Ga0190269_10160868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1173 | Open in IMG/M |
| 3300018465|Ga0190269_10854286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 664 | Open in IMG/M |
| 3300018469|Ga0190270_12052042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 631 | Open in IMG/M |
| 3300018920|Ga0190273_10222455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1201 | Open in IMG/M |
| 3300019877|Ga0193722_1002964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4131 | Open in IMG/M |
| 3300020199|Ga0179592_10512229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 513 | Open in IMG/M |
| 3300022756|Ga0222622_10446242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
| 3300025315|Ga0207697_10122121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1122 | Open in IMG/M |
| 3300025899|Ga0207642_10074771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1625 | Open in IMG/M |
| 3300025899|Ga0207642_10845921 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300025913|Ga0207695_11702377 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025930|Ga0207701_10888976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
| 3300025941|Ga0207711_10047860 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300025942|Ga0207689_11469709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157 | 570 | Open in IMG/M |
| 3300026041|Ga0207639_10238334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1580 | Open in IMG/M |
| 3300026067|Ga0207678_10099651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2482 | Open in IMG/M |
| 3300026067|Ga0207678_10563564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 997 | Open in IMG/M |
| 3300026095|Ga0207676_12241602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 544 | Open in IMG/M |
| 3300026118|Ga0207675_100281591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1616 | Open in IMG/M |
| 3300026319|Ga0209647_1038327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2716 | Open in IMG/M |
| 3300026322|Ga0209687_1185804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 647 | Open in IMG/M |
| 3300026538|Ga0209056_10193119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1499 | Open in IMG/M |
| 3300027303|Ga0208999_1036089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 753 | Open in IMG/M |
| 3300027512|Ga0209179_1048742 | Not Available | 904 | Open in IMG/M |
| 3300027761|Ga0209462_10129329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300027903|Ga0209488_10011049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6618 | Open in IMG/M |
| 3300027903|Ga0209488_10123340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1950 | Open in IMG/M |
| 3300027915|Ga0209069_10576388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
| 3300028744|Ga0307318_10148477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 804 | Open in IMG/M |
| 3300028786|Ga0307517_10004197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 22221 | Open in IMG/M |
| 3300028786|Ga0307517_10250411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1040 | Open in IMG/M |
| 3300029990|Ga0311336_11436739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 606 | Open in IMG/M |
| 3300029990|Ga0311336_11670697 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300030339|Ga0311360_10742501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 781 | Open in IMG/M |
| 3300031184|Ga0307499_10000715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10811 | Open in IMG/M |
| 3300031198|Ga0307500_10195411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 601 | Open in IMG/M |
| 3300031455|Ga0307505_10365473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 683 | Open in IMG/M |
| 3300031507|Ga0307509_10121100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2594 | Open in IMG/M |
| 3300031521|Ga0311364_11584948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 646 | Open in IMG/M |
| 3300031720|Ga0307469_11938051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300031740|Ga0307468_101303933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157 | 661 | Open in IMG/M |
| 3300031858|Ga0310892_10746945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300031938|Ga0308175_100622639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 1164 | Open in IMG/M |
| 3300031938|Ga0308175_101239381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 830 | Open in IMG/M |
| 3300032174|Ga0307470_10596216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 825 | Open in IMG/M |
| 3300034820|Ga0373959_0052119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 886 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.03% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.23% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1001239761 | 3300000364 | Soil | MWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIEYIMIFF |
| INPhiseqgaiiFebDRAFT_1004011272 | 3300000364 | Soil | MGKETAPLWVRLSVALLAIGVVAYVTTVYFVEYIVGFF* |
| JGI12053J15887_105402091 | 3300001661 | Forest Soil | MQKEATPXWVWLAVALLAIGTLAYATSVYFVEHILALF |
| rootL2_100830412 | 3300003322 | Sugarcane Root And Bulk Soil | MSIGMTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYIIGLF* |
| Ga0062595_1022819781 | 3300004479 | Soil | MGMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0070669_1017876801 | 3300005353 | Switchgrass Rhizosphere | MSIRMTKETTPLWVWLSVALLAIGTLAYLTMVYFIEYIIGFF* |
| Ga0070674_1000895913 | 3300005356 | Miscanthus Rhizosphere | MSLPMTKETTPLWVWLSVALLAIGTLAYLTMVYFIEYIIGFF* |
| Ga0070708_1013480611 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IRMTKETTPLWVWLSVALLAIGGFTYAVTVYFVEYIIGFF* |
| Ga0068867_1016820471 | 3300005459 | Miscanthus Rhizosphere | RMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0077121_103196062 | 3300005511 | Arabidopsis Rhizosphere | MGIDMTKETKPLWVWLSLALLAIGSVAYITTVFLFEYIIGLF* |
| Ga0068853_1003204682 | 3300005539 | Corn Rhizosphere | VLDIGAIKMEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF* |
| Ga0070672_1001923272 | 3300005543 | Miscanthus Rhizosphere | MTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIM* |
| Ga0070665_1001760252 | 3300005548 | Switchgrass Rhizosphere | MTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0070665_1018995512 | 3300005548 | Switchgrass Rhizosphere | MAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL* |
| Ga0066701_100038185 | 3300005552 | Soil | MTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIGFF* |
| Ga0066695_108622921 | 3300005553 | Soil | MTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIG |
| Ga0066700_105670021 | 3300005559 | Soil | PEGVGNQMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF* |
| Ga0068856_1004311312 | 3300005614 | Corn Rhizosphere | GRYMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL* |
| Ga0068852_1004380991 | 3300005616 | Corn Rhizosphere | TKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0068866_103915522 | 3300005718 | Miscanthus Rhizosphere | MTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF* |
| Ga0068870_106872692 | 3300005840 | Miscanthus Rhizosphere | MTKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL* |
| Ga0068862_1003111852 | 3300005844 | Switchgrass Rhizosphere | MAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0081455_100190883 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTKETKPLWVWLSLALLAIGTLAYVTTAFLFESIMGLF* |
| Ga0081455_109124202 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSIGMTKETKPLWVWLSLALLAIGSLAYVTTVFLFESIMGLF* |
| Ga0081540_10551242 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGKERAPLWVRLSVALLAIGVVAYVTTIYFVEYIVGFF* |
| Ga0081539_100276952 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTKETKPLWVWLSLALLAIGSVAYFTTVFLFEYIIGLF* |
| Ga0081539_100295592 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYIIGLF* |
| Ga0070717_114429742 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKEATPLWVWLSVALLALGAVGYAMSVYFVEYMMAMF* |
| Ga0066651_106867341 | 3300006031 | Soil | GVGNQMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF* |
| Ga0075024_1005921402 | 3300006047 | Watersheds | MTKETTPLWVWVSVALLAIGALAYATAVYFVEYIIGFF* |
| Ga0074048_125701741 | 3300006581 | Soil | MAKESTPLWVWLSVALLAIGAVTYGTTVFFVEYVLGFF* |
| Ga0066665_101601552 | 3300006796 | Soil | MTKETTPLWVWLSAALLAIGTLAYVTTVYLVEYVIGFF* |
| Ga0066659_101123842 | 3300006797 | Soil | MTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF* |
| Ga0066660_100863283 | 3300006800 | Soil | MGNSMQKEATPMWVWLSVALLAIGTVAYAITVYFVEYILALF* |
| Ga0075424_1017876851 | 3300006904 | Populus Rhizosphere | MTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYIIGFF* |
| Ga0066710_1001718724 | 3300009012 | Grasslands Soil | MTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIGFF |
| Ga0099792_101578962 | 3300009143 | Vadose Zone Soil | MARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLTFF* |
| Ga0099792_104898522 | 3300009143 | Vadose Zone Soil | LRTWAIRMTKETTPLWVWLSVGLLAIGTLAYFTMVYLVEYIIGFF* |
| Ga0105248_100450645 | 3300009177 | Switchgrass Rhizosphere | MEKESTPLWVWLSAGLLAIGAAIYATTVYFLEHFLGLF* |
| Ga0105238_110213682 | 3300009551 | Corn Rhizosphere | MEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF* |
| Ga0105249_112166782 | 3300009553 | Switchgrass Rhizosphere | MGMAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL* |
| Ga0105081_10900961 | 3300009806 | Groundwater Sand | MSIRMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYIIGFF* |
| Ga0126310_103409122 | 3300010044 | Serpentine Soil | MTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF* |
| Ga0126311_111118981 | 3300010045 | Serpentine Soil | MTKETTPLWVWLSVALLAIGALAYVTAVYLIEHIMGFF* |
| Ga0126306_111659391 | 3300010166 | Serpentine Soil | TTPLWVWLSVALLALGTLAYFTMVYLVEYIIGFL* |
| Ga0134109_101272891 | 3300010320 | Grasslands Soil | MTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYILALF* |
| Ga0134125_119987891 | 3300010371 | Terrestrial Soil | KETMPLWVWLSVALLPIGTLAYLTTIYLIEYIIGFF* |
| Ga0105239_107083792 | 3300010375 | Corn Rhizosphere | MEKESTPLWVWLSLVLLVIGAATYVTAGYFIEYILTFF* |
| Ga0137374_103873042 | 3300012204 | Vadose Zone Soil | MTKETTPLWVWLSVALLTIGTLAYVTTVYLVEYVIGFF* |
| Ga0137378_105546762 | 3300012210 | Vadose Zone Soil | MWATKMEKESTPLWVWLSVGLLAIGAATYVTFVFFIEYIMTFF* |
| Ga0137387_101078072 | 3300012349 | Vadose Zone Soil | MTKETTPLWVWLSVALLAIVTLAYVPTVYLVEYIIGFF* |
| Ga0137369_105763091 | 3300012355 | Vadose Zone Soil | IRMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF* |
| Ga0137385_101851612 | 3300012359 | Vadose Zone Soil | MEKESTPLWVWLSVALLAIGAVAYVTTVYLVEYFLTFF* |
| Ga0137360_109535863 | 3300012361 | Vadose Zone Soil | MARESTPLWVWLTVALMAIGGVVYAAMVFFIEYVLTFF* |
| Ga0137361_104324882 | 3300012362 | Vadose Zone Soil | MTKETTPLWVWLSVALLAIGGFTYAVTVYFVEYIIGFF* |
| Ga0157314_10434742 | 3300012500 | Arabidopsis Rhizosphere | PEGVGNQMTKESTPLWVWLAVGLLAIGTIAYFTAVFLIEYIMALS* |
| Ga0157302_105300182 | 3300012915 | Soil | MGMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF* |
| Ga0137394_100777703 | 3300012922 | Vadose Zone Soil | MTKETTPLWVWLAVALLAIGAFSYAVTVYFVEYIIGFF* |
| Ga0137413_101771242 | 3300012924 | Vadose Zone Soil | MQKESTPLWVWLAVALLAIGTAAYVTTVYFVEFIAALF* |
| Ga0137413_104870322 | 3300012924 | Vadose Zone Soil | MEKESTPLWVWLSVALLAIGAATYITMVYLIEYILTFF* |
| Ga0137404_105527442 | 3300012929 | Vadose Zone Soil | MEKESTPLWVWLSVALLVIGAVTYVTMVYFIEFVMTFF* |
| Ga0164299_100208832 | 3300012958 | Soil | MGMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGVF* |
| Ga0164302_100075982 | 3300012961 | Soil | MGMTKETAPLWVWLSVALLAIGALAYATAVYFVEYIIGVF* |
| Ga0163162_103936211 | 3300013306 | Switchgrass Rhizosphere | IRMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFF* |
| Ga0157375_118724042 | 3300013308 | Miscanthus Rhizosphere | LRTWAIRMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFL* |
| Ga0134079_104369671 | 3300014166 | Grasslands Soil | TKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF* |
| Ga0075355_11087171 | 3300014322 | Natural And Restored Wetlands | MEKETTPLWVWLAVALLAIGGVVYVASMYLLEYLMAFL* |
| Ga0137412_103292832 | 3300015242 | Vadose Zone Soil | MQKESTPLWVWLAVGLLAIGTVAYVTTVFFVEFIMALF* |
| Ga0137403_102242153 | 3300015264 | Vadose Zone Soil | MGNHMGKETTPLWVWLSVALLAIGAVTYVTTVYFVEYILALF* |
| Ga0137403_107027322 | 3300015264 | Vadose Zone Soil | MWAIKMEKESTPLWVWLSVALLVIGAVTYVTMVYFIEFVMTFF* |
| Ga0134073_102761791 | 3300015356 | Grasslands Soil | MTKESTLLWVWLAVGLLAIGTVAYVTAVFLIEYILALF* |
| Ga0132257_1002919451 | 3300015373 | Arabidopsis Rhizosphere | RMQRVTGMSIRMTKETTPLWVWLSLALFAIGALAYVTAVYLTEYVLGLL* |
| Ga0163161_112877692 | 3300017792 | Switchgrass Rhizosphere | MAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL |
| Ga0184604_103784032 | 3300018000 | Groundwater Sediment | WAIRMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIVGFF |
| Ga0184608_102292691 | 3300018028 | Groundwater Sediment | MTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF |
| Ga0184626_100384842 | 3300018053 | Groundwater Sediment | MTKETTPLWVWLSLALLAIGALTYAITVYFVEYIVGFF |
| Ga0184619_101082761 | 3300018061 | Groundwater Sediment | MTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIM |
| Ga0184628_100564662 | 3300018083 | Groundwater Sediment | MTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFF |
| Ga0190269_101608682 | 3300018465 | Soil | MTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYITGLF |
| Ga0190269_108542861 | 3300018465 | Soil | DAAYYRMSIRMTKETTPMWVWLSVALLAIGTLAYVMAVYLIEHIMGFF |
| Ga0190270_120520421 | 3300018469 | Soil | MTKETTPLWVWLSVALLAIGTLAYLTTVYLVEYIIGFF |
| Ga0190273_102224552 | 3300018920 | Soil | MTKETTPLWVWLSVALLDIGTLAYVTAVYLIEHIM |
| Ga0193722_10029642 | 3300019877 | Soil | MAKESTPLWVWLSVALLAIGAVTYLTTVYFVEYILAWL |
| Ga0179592_105122291 | 3300020199 | Vadose Zone Soil | MQKESTPLWVWLAVALLAIGTAAYVTAVYFVEFIAALF |
| Ga0222622_104462422 | 3300022756 | Groundwater Sediment | MTKETTPLWVWLSVGLLAIGTLAYFTIVYLVEYIIGFF |
| Ga0207697_101221212 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL |
| Ga0207642_100747712 | 3300025899 | Miscanthus Rhizosphere | MTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF |
| Ga0207642_108459211 | 3300025899 | Miscanthus Rhizosphere | RYMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL |
| Ga0207695_117023772 | 3300025913 | Corn Rhizosphere | KESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL |
| Ga0207701_108889762 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QIKMTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF |
| Ga0207711_100478602 | 3300025941 | Switchgrass Rhizosphere | MEKESTPLWVWLSAGLLAIGAAIYATTVYFLEHFLGLF |
| Ga0207689_114697092 | 3300025942 | Miscanthus Rhizosphere | MAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL |
| Ga0207639_102383342 | 3300026041 | Corn Rhizosphere | MEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF |
| Ga0207678_100996512 | 3300026067 | Corn Rhizosphere | MTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFL |
| Ga0207678_105635642 | 3300026067 | Corn Rhizosphere | MTKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL |
| Ga0207676_122416022 | 3300026095 | Switchgrass Rhizosphere | AFEDMGMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL |
| Ga0207675_1002815912 | 3300026118 | Switchgrass Rhizosphere | MTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF |
| Ga0209647_10383272 | 3300026319 | Grasslands Soil | MQKEATPLWVWLAVALLAIGTVAYVTTVYFVEFIMALF |
| Ga0209687_11858042 | 3300026322 | Soil | MGKETTPLWVRLSIALLAIGTVTYVTTVYFVEYILALF |
| Ga0209056_101931192 | 3300026538 | Soil | MTKETTPLWVWLSAALLAIGTLAYVTTVYLVEYVIGFF |
| Ga0208999_10360891 | 3300027303 | Forest Soil | MQKEATPLWVWLAVALLAIGTLAYATSVYFVEHILA |
| Ga0209179_10487421 | 3300027512 | Vadose Zone Soil | MWASVMARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLT |
| Ga0209462_101293292 | 3300027761 | Agave | IDMTKETKPLWVWLSLALLAIGSVAYVTTVFLFEYIIGLF |
| Ga0209488_100110495 | 3300027903 | Vadose Zone Soil | MWASVMARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLTFF |
| Ga0209488_101233403 | 3300027903 | Vadose Zone Soil | MTKETTPLWVWLSVGLLAIGTLAYFTMVYLVEYIIGFF |
| Ga0209069_105763882 | 3300027915 | Watersheds | MTKETTPLWVWVSVALLAIGALAYATAVYFVEYIIGFF |
| Ga0307318_101484772 | 3300028744 | Soil | IRMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF |
| Ga0307517_1000419721 | 3300028786 | Ectomycorrhiza | MWAIKMAKESKPLWVWLSVVLLVIGGVTYATTVFFVEYIVTLF |
| Ga0307517_102504112 | 3300028786 | Ectomycorrhiza | MAKESTPLWVWLSVALLAIGAVTYGTTVFFVEYVLGFF |
| Ga0311336_114367392 | 3300029990 | Fen | MQKEATPLWVWLSVALLVLGGVSYAMSVYFVEYMMAMF |
| Ga0311336_116706972 | 3300029990 | Fen | MQKEATPLWVWLSIALLALGAISYATSVYFVEYMMAMF |
| Ga0311360_107425013 | 3300030339 | Bog | MTKETTPLWVWLSVALLAIGAVAYATAVYFVEYIIGFF |
| Ga0307499_100007155 | 3300031184 | Soil | MTKETTPLWVWLSVALLAIGALTYATAVFFVEYIIGFF |
| Ga0307500_101954111 | 3300031198 | Soil | WAIRMTKETTPLWVWLSVALLAIGVVTYATLVYFVEYIVGFF |
| Ga0307505_103654732 | 3300031455 | Soil | MAKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL |
| Ga0307509_101211003 | 3300031507 | Ectomycorrhiza | MTKETTPLWVWLSVALLAIGTLAYFTMVYLVEYIIGFF |
| Ga0311364_115849481 | 3300031521 | Fen | IRMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF |
| Ga0307469_119380512 | 3300031720 | Hardwood Forest Soil | MWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIE |
| Ga0307468_1013039332 | 3300031740 | Hardwood Forest Soil | MWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIEYIMTFF |
| Ga0310892_107469451 | 3300031858 | Soil | RRVTGMSIRMTKETTPLWVWLPLALFAIGALAYVTAVYLTEYVLGLL |
| Ga0308175_1006226391 | 3300031938 | Soil | MGNSMQKEATPMWVWLSVALLAIGTVAYAITVYFVEYILALF |
| Ga0308175_1012393812 | 3300031938 | Soil | MGTSMQKEATPLWVWLAVALLAIGVASYVTSVFLLEYMMTLFN |
| Ga0307470_105962162 | 3300032174 | Hardwood Forest Soil | MTKETTPLWVWLSVALLAIGALAYATTVYFVEYIIGFF |
| Ga0373959_0052119_10_126 | 3300034820 | Rhizosphere Soil | MTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGVF |
| ⦗Top⦘ |