NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068795

Metagenome / Metatranscriptome Family F068795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068795
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 39 residues
Representative Sequence MTKETTPLWVWLSVALLAIGALAYATTVYFVEYIIGFF
Number of Associated Samples 110
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 50.00 %
% of genes near scaffold ends (potentially truncated) 26.61 %
% of genes from short scaffolds (< 2000 bps) 83.87 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.968 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(16.129 % of family members)
Environment Ontology (ENVO) Unclassified
(45.968 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.839 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.45%    β-sheet: 0.00%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF04960Glutaminase 25.00
PF05977MFS_3 15.32
PF07690MFS_1 15.32
PF00793DAHP_synth_1 2.42
PF14489QueF 2.42
PF04392ABC_sub_bind 1.61
PF06418CTP_synth_N 1.61
PF07519Tannase 0.81
PF13419HAD_2 0.81
PF06779MFS_4 0.81
PF02743dCache_1 0.81
PF07045DUF1330 0.81
PF00117GATase 0.81
PF13565HTH_32 0.81
PF07992Pyr_redox_2 0.81
PF00027cNMP_binding 0.81
PF01243Putative_PNPOx 0.81
PF00903Glyoxalase 0.81
PF00199Catalase 0.81
PF00034Cytochrom_C 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2066GlutaminaseAmino acid transport and metabolism [E] 25.00
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 15.32
COG0504CTP synthase (UTP-ammonia lyase)Nucleotide transport and metabolism [F] 1.61
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.61
COG0753CatalaseInorganic ion transport and metabolism [P] 0.81
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.81
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.97 %
UnclassifiedrootN/A4.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100123976Not Available506Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100401127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium631Open in IMG/M
3300001661|JGI12053J15887_10540209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei556Open in IMG/M
3300003322|rootL2_10083041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1332Open in IMG/M
3300004479|Ga0062595_102281978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002533Open in IMG/M
3300005353|Ga0070669_101787680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002536Open in IMG/M
3300005356|Ga0070674_100089591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2217Open in IMG/M
3300005445|Ga0070708_101348061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium666Open in IMG/M
3300005459|Ga0068867_101682047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium595Open in IMG/M
3300005511|Ga0077121_10319606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1134Open in IMG/M
3300005539|Ga0068853_100320468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1437Open in IMG/M
3300005543|Ga0070672_100192327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1704Open in IMG/M
3300005548|Ga0070665_100176025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2140Open in IMG/M
3300005548|Ga0070665_101899551All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300005552|Ga0066701_10003818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00025978Open in IMG/M
3300005553|Ga0066695_10862292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium519Open in IMG/M
3300005559|Ga0066700_10567002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium792Open in IMG/M
3300005614|Ga0068856_100431131All Organisms → cellular organisms → Bacteria → Proteobacteria1338Open in IMG/M
3300005616|Ga0068852_100438099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00021292Open in IMG/M
3300005718|Ga0068866_10391552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.894Open in IMG/M
3300005840|Ga0068870_10687269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium705Open in IMG/M
3300005844|Ga0068862_100311185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1452Open in IMG/M
3300005937|Ga0081455_10019088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii6499Open in IMG/M
3300005937|Ga0081455_10912420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium546Open in IMG/M
3300005983|Ga0081540_1055124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1938Open in IMG/M
3300005985|Ga0081539_10027695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii3583Open in IMG/M
3300005985|Ga0081539_10029559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3421Open in IMG/M
3300006028|Ga0070717_11442974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002625Open in IMG/M
3300006031|Ga0066651_10686734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium549Open in IMG/M
3300006047|Ga0075024_100592140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium595Open in IMG/M
3300006581|Ga0074048_12570174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium619Open in IMG/M
3300006796|Ga0066665_10160155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1715Open in IMG/M
3300006797|Ga0066659_10112384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1874Open in IMG/M
3300006800|Ga0066660_10086328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00022179Open in IMG/M
3300006904|Ga0075424_101787685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002650Open in IMG/M
3300009012|Ga0066710_100171872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3048Open in IMG/M
3300009143|Ga0099792_10157896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1256Open in IMG/M
3300009143|Ga0099792_10489852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales768Open in IMG/M
3300009177|Ga0105248_10045064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00024946Open in IMG/M
3300009551|Ga0105238_11021368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei848Open in IMG/M
3300009553|Ga0105249_11216678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium824Open in IMG/M
3300009806|Ga0105081_1090096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium508Open in IMG/M
3300010044|Ga0126310_10340912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1047Open in IMG/M
3300010045|Ga0126311_11111898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157650Open in IMG/M
3300010166|Ga0126306_11165939Not Available632Open in IMG/M
3300010320|Ga0134109_10127289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales904Open in IMG/M
3300010371|Ga0134125_11998789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales630Open in IMG/M
3300010375|Ga0105239_10708379Not Available1151Open in IMG/M
3300012204|Ga0137374_10387304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1115Open in IMG/M
3300012210|Ga0137378_10554676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1058Open in IMG/M
3300012349|Ga0137387_10107807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1949Open in IMG/M
3300012355|Ga0137369_10576309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales786Open in IMG/M
3300012359|Ga0137385_10185161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1823Open in IMG/M
3300012361|Ga0137360_10953586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300012362|Ga0137361_10432488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1209Open in IMG/M
3300012500|Ga0157314_1043474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales551Open in IMG/M
3300012915|Ga0157302_10530018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium515Open in IMG/M
3300012922|Ga0137394_10077770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2772Open in IMG/M
3300012924|Ga0137413_10177124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1416Open in IMG/M
3300012924|Ga0137413_10487032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei904Open in IMG/M
3300012929|Ga0137404_10552744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1031Open in IMG/M
3300012958|Ga0164299_10020883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00022680Open in IMG/M
3300012961|Ga0164302_10007598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4068Open in IMG/M
3300013306|Ga0163162_10393621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1518Open in IMG/M
3300013308|Ga0157375_11872404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales712Open in IMG/M
3300014166|Ga0134079_10436967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales617Open in IMG/M
3300014322|Ga0075355_1108717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales697Open in IMG/M
3300015242|Ga0137412_10329283Not Available1192Open in IMG/M
3300015264|Ga0137403_10224215All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300015264|Ga0137403_10702732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium871Open in IMG/M
3300015356|Ga0134073_10276179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales590Open in IMG/M
3300015373|Ga0132257_100291945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1957Open in IMG/M
3300017792|Ga0163161_11287769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae635Open in IMG/M
3300018000|Ga0184604_10378403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300018028|Ga0184608_10229269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei816Open in IMG/M
3300018053|Ga0184626_10038484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1984Open in IMG/M
3300018061|Ga0184619_10108276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1252Open in IMG/M
3300018083|Ga0184628_10056466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1986Open in IMG/M
3300018465|Ga0190269_10160868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1173Open in IMG/M
3300018465|Ga0190269_10854286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium664Open in IMG/M
3300018469|Ga0190270_12052042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium631Open in IMG/M
3300018920|Ga0190273_10222455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1201Open in IMG/M
3300019877|Ga0193722_1002964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4131Open in IMG/M
3300020199|Ga0179592_10512229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei513Open in IMG/M
3300022756|Ga0222622_10446242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales917Open in IMG/M
3300025315|Ga0207697_10122121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1122Open in IMG/M
3300025899|Ga0207642_10074771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1625Open in IMG/M
3300025899|Ga0207642_10845921All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025913|Ga0207695_11702377All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025930|Ga0207701_10888976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales746Open in IMG/M
3300025941|Ga0207711_10047860All Organisms → cellular organisms → Bacteria3658Open in IMG/M
3300025942|Ga0207689_11469709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157570Open in IMG/M
3300026041|Ga0207639_10238334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1580Open in IMG/M
3300026067|Ga0207678_10099651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2482Open in IMG/M
3300026067|Ga0207678_10563564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium997Open in IMG/M
3300026095|Ga0207676_12241602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales544Open in IMG/M
3300026118|Ga0207675_100281591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1616Open in IMG/M
3300026319|Ga0209647_1038327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2716Open in IMG/M
3300026322|Ga0209687_1185804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei647Open in IMG/M
3300026538|Ga0209056_10193119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1499Open in IMG/M
3300027303|Ga0208999_1036089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002753Open in IMG/M
3300027512|Ga0209179_1048742Not Available904Open in IMG/M
3300027761|Ga0209462_10129329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium599Open in IMG/M
3300027903|Ga0209488_10011049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6618Open in IMG/M
3300027903|Ga0209488_10123340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1950Open in IMG/M
3300027915|Ga0209069_10576388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium645Open in IMG/M
3300028744|Ga0307318_10148477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales804Open in IMG/M
3300028786|Ga0307517_10004197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae22221Open in IMG/M
3300028786|Ga0307517_10250411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1040Open in IMG/M
3300029990|Ga0311336_11436739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002606Open in IMG/M
3300029990|Ga0311336_11670697All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300030339|Ga0311360_10742501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium781Open in IMG/M
3300031184|Ga0307499_10000715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium10811Open in IMG/M
3300031198|Ga0307500_10195411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales601Open in IMG/M
3300031455|Ga0307505_10365473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales683Open in IMG/M
3300031507|Ga0307509_10121100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2594Open in IMG/M
3300031521|Ga0311364_11584948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium646Open in IMG/M
3300031720|Ga0307469_11938051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300031740|Ga0307468_101303933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 157661Open in IMG/M
3300031858|Ga0310892_10746945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales675Open in IMG/M
3300031938|Ga0308175_100622639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00021164Open in IMG/M
3300031938|Ga0308175_101239381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei830Open in IMG/M
3300032174|Ga0307470_10596216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium825Open in IMG/M
3300034820|Ga0373959_0052119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium886Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.03%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere4.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.23%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.42%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.42%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.81%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005511Combined assembly of arab plate scrape MF_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027303Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027761Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10012397613300000364SoilMWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIEYIMIFF
INPhiseqgaiiFebDRAFT_10040112723300000364SoilMGKETAPLWVRLSVALLAIGVVAYVTTVYFVEYIVGFF*
JGI12053J15887_1054020913300001661Forest SoilMQKEATPXWVWLAVALLAIGTLAYATSVYFVEHILALF
rootL2_1008304123300003322Sugarcane Root And Bulk SoilMSIGMTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYIIGLF*
Ga0062595_10228197813300004479SoilMGMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0070669_10178768013300005353Switchgrass RhizosphereMSIRMTKETTPLWVWLSVALLAIGTLAYLTMVYFIEYIIGFF*
Ga0070674_10008959133300005356Miscanthus RhizosphereMSLPMTKETTPLWVWLSVALLAIGTLAYLTMVYFIEYIIGFF*
Ga0070708_10134806113300005445Corn, Switchgrass And Miscanthus RhizosphereIRMTKETTPLWVWLSVALLAIGGFTYAVTVYFVEYIIGFF*
Ga0068867_10168204713300005459Miscanthus RhizosphereRMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0077121_1031960623300005511Arabidopsis RhizosphereMGIDMTKETKPLWVWLSLALLAIGSVAYITTVFLFEYIIGLF*
Ga0068853_10032046823300005539Corn RhizosphereVLDIGAIKMEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF*
Ga0070672_10019232723300005543Miscanthus RhizosphereMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIM*
Ga0070665_10017602523300005548Switchgrass RhizosphereMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0070665_10189955123300005548Switchgrass RhizosphereMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL*
Ga0066701_1000381853300005552SoilMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIGFF*
Ga0066695_1086229213300005553SoilMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIG
Ga0066700_1056700213300005559SoilPEGVGNQMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF*
Ga0068856_10043113123300005614Corn RhizosphereGRYMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL*
Ga0068852_10043809913300005616Corn RhizosphereTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0068866_1039155223300005718Miscanthus RhizosphereMTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF*
Ga0068870_1068726923300005840Miscanthus RhizosphereMTKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL*
Ga0068862_10031118523300005844Switchgrass RhizosphereMAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0081455_1001908833300005937Tabebuia Heterophylla RhizosphereMTKETKPLWVWLSLALLAIGTLAYVTTAFLFESIMGLF*
Ga0081455_1091242023300005937Tabebuia Heterophylla RhizosphereMSIGMTKETKPLWVWLSLALLAIGSLAYVTTVFLFESIMGLF*
Ga0081540_105512423300005983Tabebuia Heterophylla RhizosphereMGKERAPLWVRLSVALLAIGVVAYVTTIYFVEYIVGFF*
Ga0081539_1002769523300005985Tabebuia Heterophylla RhizosphereMTKETKPLWVWLSLALLAIGSVAYFTTVFLFEYIIGLF*
Ga0081539_1002955923300005985Tabebuia Heterophylla RhizosphereMTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYIIGLF*
Ga0070717_1144297423300006028Corn, Switchgrass And Miscanthus RhizosphereMQKEATPLWVWLSVALLALGAVGYAMSVYFVEYMMAMF*
Ga0066651_1068673413300006031SoilGVGNQMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF*
Ga0075024_10059214023300006047WatershedsMTKETTPLWVWVSVALLAIGALAYATAVYFVEYIIGFF*
Ga0074048_1257017413300006581SoilMAKESTPLWVWLSVALLAIGAVTYGTTVFFVEYVLGFF*
Ga0066665_1016015523300006796SoilMTKETTPLWVWLSAALLAIGTLAYVTTVYLVEYVIGFF*
Ga0066659_1011238423300006797SoilMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF*
Ga0066660_1008632833300006800SoilMGNSMQKEATPMWVWLSVALLAIGTVAYAITVYFVEYILALF*
Ga0075424_10178768513300006904Populus RhizosphereMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYIIGFF*
Ga0066710_10017187243300009012Grasslands SoilMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYVIGFF
Ga0099792_1015789623300009143Vadose Zone SoilMARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLTFF*
Ga0099792_1048985223300009143Vadose Zone SoilLRTWAIRMTKETTPLWVWLSVGLLAIGTLAYFTMVYLVEYIIGFF*
Ga0105248_1004506453300009177Switchgrass RhizosphereMEKESTPLWVWLSAGLLAIGAAIYATTVYFLEHFLGLF*
Ga0105238_1102136823300009551Corn RhizosphereMEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF*
Ga0105249_1121667823300009553Switchgrass RhizosphereMGMAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL*
Ga0105081_109009613300009806Groundwater SandMSIRMTKETTPLWVWLSVALLAIGTLAYVTTVYLVEYIIGFF*
Ga0126310_1034091223300010044Serpentine SoilMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF*
Ga0126311_1111189813300010045Serpentine SoilMTKETTPLWVWLSVALLAIGALAYVTAVYLIEHIMGFF*
Ga0126306_1116593913300010166Serpentine SoilTTPLWVWLSVALLALGTLAYFTMVYLVEYIIGFL*
Ga0134109_1012728913300010320Grasslands SoilMTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYILALF*
Ga0134125_1199878913300010371Terrestrial SoilKETMPLWVWLSVALLPIGTLAYLTTIYLIEYIIGFF*
Ga0105239_1070837923300010375Corn RhizosphereMEKESTPLWVWLSLVLLVIGAATYVTAGYFIEYILTFF*
Ga0137374_1038730423300012204Vadose Zone SoilMTKETTPLWVWLSVALLTIGTLAYVTTVYLVEYVIGFF*
Ga0137378_1055467623300012210Vadose Zone SoilMWATKMEKESTPLWVWLSVGLLAIGAATYVTFVFFIEYIMTFF*
Ga0137387_1010780723300012349Vadose Zone SoilMTKETTPLWVWLSVALLAIVTLAYVPTVYLVEYIIGFF*
Ga0137369_1057630913300012355Vadose Zone SoilIRMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF*
Ga0137385_1018516123300012359Vadose Zone SoilMEKESTPLWVWLSVALLAIGAVAYVTTVYLVEYFLTFF*
Ga0137360_1095358633300012361Vadose Zone SoilMARESTPLWVWLTVALMAIGGVVYAAMVFFIEYVLTFF*
Ga0137361_1043248823300012362Vadose Zone SoilMTKETTPLWVWLSVALLAIGGFTYAVTVYFVEYIIGFF*
Ga0157314_104347423300012500Arabidopsis RhizospherePEGVGNQMTKESTPLWVWLAVGLLAIGTIAYFTAVFLIEYIMALS*
Ga0157302_1053001823300012915SoilMGMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF*
Ga0137394_1007777033300012922Vadose Zone SoilMTKETTPLWVWLAVALLAIGAFSYAVTVYFVEYIIGFF*
Ga0137413_1017712423300012924Vadose Zone SoilMQKESTPLWVWLAVALLAIGTAAYVTTVYFVEFIAALF*
Ga0137413_1048703223300012924Vadose Zone SoilMEKESTPLWVWLSVALLAIGAATYITMVYLIEYILTFF*
Ga0137404_1055274423300012929Vadose Zone SoilMEKESTPLWVWLSVALLVIGAVTYVTMVYFIEFVMTFF*
Ga0164299_1002088323300012958SoilMGMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGVF*
Ga0164302_1000759823300012961SoilMGMTKETAPLWVWLSVALLAIGALAYATAVYFVEYIIGVF*
Ga0163162_1039362113300013306Switchgrass RhizosphereIRMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFF*
Ga0157375_1187240423300013308Miscanthus RhizosphereLRTWAIRMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFL*
Ga0134079_1043696713300014166Grasslands SoilTKESTPLWVWLAVGLLAIGTVAYVTAVFLIEYIMALF*
Ga0075355_110871713300014322Natural And Restored WetlandsMEKETTPLWVWLAVALLAIGGVVYVASMYLLEYLMAFL*
Ga0137412_1032928323300015242Vadose Zone SoilMQKESTPLWVWLAVGLLAIGTVAYVTTVFFVEFIMALF*
Ga0137403_1022421533300015264Vadose Zone SoilMGNHMGKETTPLWVWLSVALLAIGAVTYVTTVYFVEYILALF*
Ga0137403_1070273223300015264Vadose Zone SoilMWAIKMEKESTPLWVWLSVALLVIGAVTYVTMVYFIEFVMTFF*
Ga0134073_1027617913300015356Grasslands SoilMTKESTLLWVWLAVGLLAIGTVAYVTAVFLIEYILALF*
Ga0132257_10029194513300015373Arabidopsis RhizosphereRMQRVTGMSIRMTKETTPLWVWLSLALFAIGALAYVTAVYLTEYVLGLL*
Ga0163161_1128776923300017792Switchgrass RhizosphereMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL
Ga0184604_1037840323300018000Groundwater SedimentWAIRMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIVGFF
Ga0184608_1022926913300018028Groundwater SedimentMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF
Ga0184626_1003848423300018053Groundwater SedimentMTKETTPLWVWLSLALLAIGALTYAITVYFVEYIVGFF
Ga0184619_1010827613300018061Groundwater SedimentMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIM
Ga0184628_1005646623300018083Groundwater SedimentMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFF
Ga0190269_1016086823300018465SoilMTKETKPLWVWLSLALLAIGSLTYVTTVFLFEYITGLF
Ga0190269_1085428613300018465SoilDAAYYRMSIRMTKETTPMWVWLSVALLAIGTLAYVMAVYLIEHIMGFF
Ga0190270_1205204213300018469SoilMTKETTPLWVWLSVALLAIGTLAYLTTVYLVEYIIGFF
Ga0190273_1022245523300018920SoilMTKETTPLWVWLSVALLDIGTLAYVTAVYLIEHIM
Ga0193722_100296423300019877SoilMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEYILAWL
Ga0179592_1051222913300020199Vadose Zone SoilMQKESTPLWVWLAVALLAIGTAAYVTAVYFVEFIAALF
Ga0222622_1044624223300022756Groundwater SedimentMTKETTPLWVWLSVGLLAIGTLAYFTIVYLVEYIIGFF
Ga0207697_1012212123300025315Corn, Switchgrass And Miscanthus RhizosphereMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL
Ga0207642_1007477123300025899Miscanthus RhizosphereMTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF
Ga0207642_1084592113300025899Miscanthus RhizosphereRYMAKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL
Ga0207695_1170237723300025913Corn RhizosphereKESTPLWVWLSVALLAIGAVTYLTTVYFVEHILAWL
Ga0207701_1088897623300025930Corn, Switchgrass And Miscanthus RhizosphereQIKMTKESTPLWVWLSVALLAIGAVTYVTTVFFVEYILGFF
Ga0207711_1004786023300025941Switchgrass RhizosphereMEKESTPLWVWLSAGLLAIGAAIYATTVYFLEHFLGLF
Ga0207689_1146970923300025942Miscanthus RhizosphereMAKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL
Ga0207639_1023833423300026041Corn RhizosphereMEKESTPLWVWLSLVLLVIGAATYVTAVYFIEYILTFF
Ga0207678_1009965123300026067Corn RhizosphereMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGFL
Ga0207678_1056356423300026067Corn RhizosphereMTKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL
Ga0207676_1224160223300026095Switchgrass RhizosphereAFEDMGMTKETTPLWVWLSVALLAIGALTYATAVYFVEYIIGVL
Ga0207675_10028159123300026118Switchgrass RhizosphereMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF
Ga0209647_103832723300026319Grasslands SoilMQKEATPLWVWLAVALLAIGTVAYVTTVYFVEFIMALF
Ga0209687_118580423300026322SoilMGKETTPLWVRLSIALLAIGTVTYVTTVYFVEYILALF
Ga0209056_1019311923300026538SoilMTKETTPLWVWLSAALLAIGTLAYVTTVYLVEYVIGFF
Ga0208999_103608913300027303Forest SoilMQKEATPLWVWLAVALLAIGTLAYATSVYFVEHILA
Ga0209179_104874213300027512Vadose Zone SoilMWASVMARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLT
Ga0209462_1012932923300027761AgaveIDMTKETKPLWVWLSLALLAIGSVAYVTTVFLFEYIIGLF
Ga0209488_1001104953300027903Vadose Zone SoilMWASVMARESTPLWVWLTVALMAIGGVVYAATVFFIEYVLTFF
Ga0209488_1012334033300027903Vadose Zone SoilMTKETTPLWVWLSVGLLAIGTLAYFTMVYLVEYIIGFF
Ga0209069_1057638823300027915WatershedsMTKETTPLWVWVSVALLAIGALAYATAVYFVEYIIGFF
Ga0307318_1014847723300028744SoilIRMTKETTPLWVWLSVALLAIGTLAYVTAVYLIEHIMGFF
Ga0307517_10004197213300028786EctomycorrhizaMWAIKMAKESKPLWVWLSVVLLVIGGVTYATTVFFVEYIVTLF
Ga0307517_1025041123300028786EctomycorrhizaMAKESTPLWVWLSVALLAIGAVTYGTTVFFVEYVLGFF
Ga0311336_1143673923300029990FenMQKEATPLWVWLSVALLVLGGVSYAMSVYFVEYMMAMF
Ga0311336_1167069723300029990FenMQKEATPLWVWLSIALLALGAISYATSVYFVEYMMAMF
Ga0311360_1074250133300030339BogMTKETTPLWVWLSVALLAIGAVAYATAVYFVEYIIGFF
Ga0307499_1000071553300031184SoilMTKETTPLWVWLSVALLAIGALTYATAVFFVEYIIGFF
Ga0307500_1019541113300031198SoilWAIRMTKETTPLWVWLSVALLAIGVVTYATLVYFVEYIVGFF
Ga0307505_1036547323300031455SoilMAKESTPLWVWLSVALLAIGAVTYATTVFFVEYVL
Ga0307509_1012110033300031507EctomycorrhizaMTKETTPLWVWLSVALLAIGTLAYFTMVYLVEYIIGFF
Ga0311364_1158494813300031521FenIRMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGFF
Ga0307469_1193805123300031720Hardwood Forest SoilMWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIE
Ga0307468_10130393323300031740Hardwood Forest SoilMWATKMEKETTPLWVWLSVGLMVIGAVTYVTTVYFIEYIMTFF
Ga0310892_1074694513300031858SoilRRVTGMSIRMTKETTPLWVWLPLALFAIGALAYVTAVYLTEYVLGLL
Ga0308175_10062263913300031938SoilMGNSMQKEATPMWVWLSVALLAIGTVAYAITVYFVEYILALF
Ga0308175_10123938123300031938SoilMGTSMQKEATPLWVWLAVALLAIGVASYVTSVFLLEYMMTLFN
Ga0307470_1059621623300032174Hardwood Forest SoilMTKETTPLWVWLSVALLAIGALAYATTVYFVEYIIGFF
Ga0373959_0052119_10_1263300034820Rhizosphere SoilMTKETTPLWVWLSVALLAIGALAYATAVYFVEYIIGVF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.