Metagenome / Metatranscriptome Family F068791

Basic Information
Family ID	F068791
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	44 residues
Representative Sequence	VDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Number of Associated Samples	89
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	73.39 %
% of genes near scaffold ends (potentially truncated)	24.19 %
% of genes from short scaffolds (< 2000 bps)	76.61 %
Associated GOLD sequencing projects	79
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (99.194 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (23.387 % of family members)
Environment Ontology (ENVO)	Unclassified (44.355 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (51.613 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF07885	Ion_trans_2	36.29
PF00116	COX2	23.39
PF00115	COX1	12.10
PF01435	Peptidase_M48	3.23
PF00211	Guanylate_cyc	1.61
PF00497	SBP_bac_3	0.81
PF13458	Peripla_BP_6	0.81
PF00873	ACR_tran	0.81
PF03737	RraA-like	0.81
PF04909	Amidohydro_2	0.81
PF04392	ABC_sub_bind	0.81
PF17158	MASE4	0.81
PF04280	Tim44	0.81
PF03264	Cytochrom_NNT	0.81
PF04831	Popeye	0.81

COG ID	Name	Functional Category	% Frequency in 124 Family Scaffolds
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	23.39
COG4263	Nitrous oxide reductase	Inorganic ion transport and metabolism [P]	23.39
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	1.61
COG0684	RNA degradosome component RraA (regulator of RNase E activity)	Translation, ribosomal structure and biogenesis [J]	0.81
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.81
COG3005	Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductase	Energy production and conversion [C]	0.81
COG4395	Predicted lipid-binding transport protein, Tim44 family	Lipid transport and metabolism [I]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.19 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.19 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.19 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	41.13 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	24.19 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	41.13 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	24.19 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	41.13 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	11.29 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	4.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	41.13 %
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	11.29 %
Sphaerobacteridae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae	4.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.13 %
Sphaerobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales	4.84 %
Roseiflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae	2.42 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.13 %
Sphaerobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae	4.84 %
Roseiflexaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae	2.42 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.13 %
Sphaerobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	4.84 %
Roseiflexus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus	2.42 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.13 %
Sphaerobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter	4.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
unclassified Roseiflexus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus	1.61 %
Roseiflexus castenholzii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii	0.81 %
Unclassified	root	N/A	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	41.13 %
Sphaerobacter thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	4.84 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.42 %
Roseiflexus sp. RS-1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	0.81 %
Roseiflexus sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.	0.81 %
Roseiflexus castenholzii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii	0.81 %
Unclassified	root	N/A	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2228664022\|INPgaii200_c0936134	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	820	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_14492293	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101242856	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	697	Open in IMG/M
3300004114\|Ga0062593_100299938	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	1368	Open in IMG/M
3300004267\|Ga0066396_10048398	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300004268\|Ga0066398_10010196	All Organisms → cellular organisms → Bacteria	1359	Open in IMG/M
3300004281\|Ga0066397_10071816	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300004281\|Ga0066397_10103415	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	600	Open in IMG/M
3300004479\|Ga0062595_102050335	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	554	Open in IMG/M
3300004633\|Ga0066395_10020671	All Organisms → cellular organisms → Bacteria	2613	Open in IMG/M
3300004633\|Ga0066395_10741655	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	586	Open in IMG/M
3300004633\|Ga0066395_10800430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	566	Open in IMG/M
3300005166\|Ga0066674_10218692	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300005172\|Ga0066683_10227997	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1153	Open in IMG/M
3300005177\|Ga0066690_10049117	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2563	Open in IMG/M
3300005180\|Ga0066685_10001422	All Organisms → cellular organisms → Bacteria → Proteobacteria	10331	Open in IMG/M
3300005180\|Ga0066685_10055015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	2565	Open in IMG/M
3300005186\|Ga0066676_10159926	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1422	Open in IMG/M
3300005330\|Ga0070690_101666896	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300005332\|Ga0066388_100085137	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3556	Open in IMG/M
3300005332\|Ga0066388_100377393	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2064	Open in IMG/M
3300005332\|Ga0066388_100410674	All Organisms → cellular organisms → Bacteria	1998	Open in IMG/M
3300005332\|Ga0066388_103734899	All Organisms → cellular organisms → Bacteria	777	Open in IMG/M
3300005347\|Ga0070668_100591055	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300005546\|Ga0070696_100845538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	756	Open in IMG/M
3300005563\|Ga0068855_102345284	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	533	Open in IMG/M
3300005713\|Ga0066905_100055483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2455	Open in IMG/M
3300005713\|Ga0066905_100547686	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300005713\|Ga0066905_100660794	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	892	Open in IMG/M
3300005713\|Ga0066905_100785203	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus	825	Open in IMG/M
3300005713\|Ga0066905_101098119	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300005713\|Ga0066905_102018694	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	535	Open in IMG/M
3300005764\|Ga0066903_100068267	All Organisms → cellular organisms → Bacteria	4520	Open in IMG/M
3300005764\|Ga0066903_100332185	All Organisms → cellular organisms → Bacteria	2439	Open in IMG/M
3300005764\|Ga0066903_100336300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2427	Open in IMG/M
3300005764\|Ga0066903_102847277	All Organisms → cellular organisms → Bacteria	938	Open in IMG/M
3300005764\|Ga0066903_107417302	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300006049\|Ga0075417_10014108	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3055	Open in IMG/M
3300006049\|Ga0075417_10115402	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1229	Open in IMG/M
3300006058\|Ga0075432_10313204	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300006606\|Ga0074062_11657930	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300006797\|Ga0066659_10019613	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3840	Open in IMG/M
3300006844\|Ga0075428_100001674	All Organisms → cellular organisms → Bacteria → Proteobacteria	23616	Open in IMG/M
3300006846\|Ga0075430_101146957	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	640	Open in IMG/M
3300006854\|Ga0075425_101710707	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	707	Open in IMG/M
3300006871\|Ga0075434_100110867	All Organisms → cellular organisms → Bacteria	2754	Open in IMG/M
3300007076\|Ga0075435_101949428	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	516	Open in IMG/M
3300007255\|Ga0099791_10295949	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	771	Open in IMG/M
3300009147\|Ga0114129_10040047	All Organisms → cellular organisms → Bacteria	6609	Open in IMG/M
3300009147\|Ga0114129_10292870	All Organisms → cellular organisms → Bacteria	2172	Open in IMG/M
3300009162\|Ga0075423_10069760	All Organisms → cellular organisms → Bacteria	3647	Open in IMG/M
3300009553\|Ga0105249_11054662	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	882	Open in IMG/M
3300009792\|Ga0126374_10125185	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1511	Open in IMG/M
3300009814\|Ga0105082_1100551	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	545	Open in IMG/M
3300010043\|Ga0126380_10257152	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1213	Open in IMG/M
3300010043\|Ga0126380_11211523	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	651	Open in IMG/M
3300010047\|Ga0126382_10778383	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300010359\|Ga0126376_10440950	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1187	Open in IMG/M
3300010360\|Ga0126372_10388432	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1268	Open in IMG/M
3300010362\|Ga0126377_13100743	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	537	Open in IMG/M
3300010362\|Ga0126377_13590294	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	502	Open in IMG/M
3300010366\|Ga0126379_11112666	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	896	Open in IMG/M
3300010366\|Ga0126379_11754903	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	725	Open in IMG/M
3300012205\|Ga0137362_10036188	All Organisms → cellular organisms → Bacteria	3946	Open in IMG/M
3300012582\|Ga0137358_11016994	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	535	Open in IMG/M
3300012685\|Ga0137397_10076453	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2429	Open in IMG/M
3300012918\|Ga0137396_10710804	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	741	Open in IMG/M
3300012922\|Ga0137394_10540964	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	988	Open in IMG/M
3300012944\|Ga0137410_10091597	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.	2239	Open in IMG/M
3300012948\|Ga0126375_10141721	All Organisms → cellular organisms → Bacteria → Proteobacteria	1501	Open in IMG/M
3300012971\|Ga0126369_10242053	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1769	Open in IMG/M
3300014326\|Ga0157380_13044773	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	534	Open in IMG/M
3300015053\|Ga0137405_1233914	All Organisms → cellular organisms → Bacteria	3016	Open in IMG/M
3300015371\|Ga0132258_10302832	All Organisms → cellular organisms → Bacteria	3932	Open in IMG/M
3300015371\|Ga0132258_13313995	All Organisms → cellular organisms → Bacteria	1108	Open in IMG/M
3300015372\|Ga0132256_100834239	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1038	Open in IMG/M
3300015372\|Ga0132256_103916929	Not Available	501	Open in IMG/M
3300015374\|Ga0132255_101014447	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1245	Open in IMG/M
3300015374\|Ga0132255_101175900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1155	Open in IMG/M
3300018064\|Ga0187773_10066988	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1695	Open in IMG/M
3300018431\|Ga0066655_10017469	All Organisms → cellular organisms → Bacteria	3273	Open in IMG/M
3300018433\|Ga0066667_10000764	All Organisms → cellular organisms → Bacteria	11364	Open in IMG/M
3300020170\|Ga0179594_10039393	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1552	Open in IMG/M
3300025923\|Ga0207681_10170326	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1650	Open in IMG/M
3300025942\|Ga0207689_11666695	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	529	Open in IMG/M
3300025972\|Ga0207668_10646571	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300026324\|Ga0209470_1085452	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1438	Open in IMG/M
3300026329\|Ga0209375_1136432	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii	1057	Open in IMG/M
3300026342\|Ga0209057_1111002	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1064	Open in IMG/M
3300026497\|Ga0257164_1084344	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	539	Open in IMG/M
3300026536\|Ga0209058_1296233	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	557	Open in IMG/M
3300026537\|Ga0209157_1305423	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	582	Open in IMG/M
3300027527\|Ga0209684_1054452	All Organisms → cellular organisms → Bacteria	618	Open in IMG/M
3300027646\|Ga0209466_1004268	All Organisms → cellular organisms → Bacteria	2983	Open in IMG/M
3300027654\|Ga0209799_1011723	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1884	Open in IMG/M
3300027655\|Ga0209388_1159694	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	635	Open in IMG/M
3300027873\|Ga0209814_10049878	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1747	Open in IMG/M
3300027874\|Ga0209465_10024443	All Organisms → cellular organisms → Bacteria	2805	Open in IMG/M
3300027874\|Ga0209465_10158364	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1125	Open in IMG/M
3300027874\|Ga0209465_10530925	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300027874\|Ga0209465_10670977	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300027909\|Ga0209382_10000783	All Organisms → cellular organisms → Bacteria	51538	Open in IMG/M
3300028592\|Ga0247822_10740232	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	797	Open in IMG/M
3300030336\|Ga0247826_11193061	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	610	Open in IMG/M
3300031198\|Ga0307500_10048048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1022	Open in IMG/M
3300031543\|Ga0318516_10110601	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1559	Open in IMG/M
3300031561\|Ga0318528_10491590	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300031716\|Ga0310813_11432840	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	641	Open in IMG/M
3300031720\|Ga0307469_10041669	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2796	Open in IMG/M
3300031720\|Ga0307469_10112322	All Organisms → cellular organisms → Bacteria	1947	Open in IMG/M
3300031720\|Ga0307469_10377189	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1201	Open in IMG/M
3300031720\|Ga0307469_10613269	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	974	Open in IMG/M
3300031720\|Ga0307469_10634029	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	960	Open in IMG/M
3300031740\|Ga0307468_100179118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1404	Open in IMG/M
3300031820\|Ga0307473_10183864	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1225	Open in IMG/M
3300031820\|Ga0307473_11517366	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	508	Open in IMG/M
3300031832\|Ga0318499_10030623	All Organisms → cellular organisms → Bacteria	1938	Open in IMG/M
3300032052\|Ga0318506_10168892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	961	Open in IMG/M
3300032180\|Ga0307471_100060037	All Organisms → cellular organisms → Bacteria	3204	Open in IMG/M
3300032180\|Ga0307471_100470256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1400	Open in IMG/M
3300032180\|Ga0307471_101439729	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	848	Open in IMG/M
3300032180\|Ga0307471_101700068	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	785	Open in IMG/M
3300032205\|Ga0307472_101910092	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	592	Open in IMG/M
3300034150\|Ga0364933_139241	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	625	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.03%
Host-Associated	Host-Associated	20.97%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.03%
Plants	Host-Associated → Plants	20.97%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.23%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.13%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.84%
Floodplain	Environmental → Terrestrial → Floodplain	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	51.61%
Loam	Environmental → Terrestrial → Soil → Loam	25.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.10%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.23%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.81%
Sand	Environmental → Terrestrial → Soil → Sand	0.81%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.81%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	23.39%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.52%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.23%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.61%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	23.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	12.10%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	10.48%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.48%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.68%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	8.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.03%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.23%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.61%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.81%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.81%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.81%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004281	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009814	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300027527	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031832	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F068791

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPgaii200_09361341	2228664022	Soil	VDDPVHDDEPKPWGALLFILIYLLVLAVFWTNTYLRIWRS
ICChiseqgaiiFebDRAFT_144922931	3300000363	Soil	RARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
INPhiseqgaiiFebDRAFT_1012428562	3300000364	Soil	VDDPVHDDEPKPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0062593_1002999382	3300004114	Soil	VDENPSDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066396_100483982	3300004267	Tropical Forest Soil	VDDNAHDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0066398_100101963	3300004268	Tropical Forest Soil	MEAPVDDNAHHEEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066397_100718162	3300004281	Tropical Forest Soil	VDDNVHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066397_101034152	3300004281	Tropical Forest Soil	VDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0062595_1020503352	3300004479	Soil	VDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066395_100206713	3300004633	Tropical Forest Soil	VNENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS*
Ga0066395_107416552	3300004633	Tropical Forest Soil	VIELAESGRRSTVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066395_108004302	3300004633	Tropical Forest Soil	GRRPTVDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066674_102186923	3300005166	Soil	VDDPAHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0066683_102279973	3300005172	Soil	VDDPAYDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0066690_100491173	3300005177	Soil	VDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS*
Ga0066685_100014222	3300005180	Soil	MVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS*
Ga0066685_100550153	3300005180	Soil	VTVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS*
Ga0066676_101599262	3300005186	Soil	VDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0070690_1016668962	3300005330	Switchgrass Rhizosphere	VDENASDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066388_1000851373	3300005332	Tropical Forest Soil	VDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066388_1003773933	3300005332	Tropical Forest Soil	LAEPGRRSTVGDPMRDDEPRPWGALIFILIYLLVLAAFWTNTYLRIWRS*
Ga0066388_1004106743	3300005332	Tropical Forest Soil	VIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066388_1037348992	3300005332	Tropical Forest Soil	MDDDSRPDDPQPRGALLLILIYLMILLGFWLNTYLRIWRS*
Ga0070668_1005910552	3300005347	Switchgrass Rhizosphere	VDDPVHDDEPKPWGALLLILSYLLVLAVFWTNTYLRIWRS*
Ga0070696_1008455382	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MDESSRDEEPRPRGALVFILIYLAVLAGFWLNTYLRIWRS*
Ga0068855_1023452842	3300005563	Corn Rhizosphere	EGRATVDENPSDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066905_1000554832	3300005713	Tropical Forest Soil	MDDPAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066905_1005476862	3300005713	Tropical Forest Soil	LAESGRRSTVGDPGHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066905_1006607943	3300005713	Tropical Forest Soil	STVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066905_1007852032	3300005713	Tropical Forest Soil	VDNNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066905_1010981192	3300005713	Tropical Forest Soil	VSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS*
Ga0066905_1020186942	3300005713	Tropical Forest Soil	MNEPAHDDEQQPRGALLLILIYLAVLAAFWINTYLRIWRS*
Ga0066903_1000682674	3300005764	Tropical Forest Soil	VGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066903_1003321852	3300005764	Tropical Forest Soil	MMDHNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066903_1003363003	3300005764	Tropical Forest Soil	VDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066903_1028472773	3300005764	Tropical Forest Soil	LAESGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066903_1074173021	3300005764	Tropical Forest Soil	VSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLSLEEL
Ga0075417_100141081	3300006049	Populus Rhizosphere	VNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS*
Ga0075417_101154023	3300006049	Populus Rhizosphere	VDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075432_103132042	3300006058	Populus Rhizosphere	LAEPGRRSTVDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0074062_116579302	3300006606	Soil	VDENSSDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0066659_100196132	3300006797	Soil	VDEKPSDDEPRPRGALLLIMIYLAVLAAFWLNTYLRIWRS*
Ga0075428_10000167416	3300006844	Populus Rhizosphere	VDDDTYEPEPRPRGALVLILIYLVILAAFWINTYLRLWRS*
Ga0075430_1011469572	3300006846	Populus Rhizosphere	DKVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075425_1017107072	3300006854	Populus Rhizosphere	LAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075434_1001108674	3300006871	Populus Rhizosphere	VDDPVHADEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075435_1019494281	3300007076	Populus Rhizosphere	VGRSAGRRLAVSDDTHDDEPRPRGALVLIMIYLAVLAAFWLNTYLRIWRS*
Ga0099791_102959492	3300007255	Vadose Zone Soil	VDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS*
Ga0114129_100400474	3300009147	Populus Rhizosphere	MVRTAVPQRRRPTVNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS*
Ga0114129_102928703	3300009147	Populus Rhizosphere	VIELAEPGRRSTVDDPAHDDEPRQWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075423_100697603	3300009162	Populus Rhizosphere	VIELAEPGRRSTVDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0105249_110546623	3300009553	Switchgrass Rhizosphere	KVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126374_101251851	3300009792	Tropical Forest Soil	PVAISLFGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0105082_11005512	3300009814	Groundwater Sand	VDGNAHDDEPRPWGALLLILIYLLVLAVFWVNTYLRVWRS*
Ga0126380_102571522	3300010043	Tropical Forest Soil	VDDNAHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126380_112115232	3300010043	Tropical Forest Soil	VDNNAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126382_107783832	3300010047	Tropical Forest Soil	VDEPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126376_104409501	3300010359	Tropical Forest Soil	VDDNAHGDEPRPRGALVLIMIYLLGLAAFWLNTYLRIWRS*
Ga0126372_103884323	3300010360	Tropical Forest Soil	VNDNGNDDEPRPRGALVLIMIYLVVLAAFWLNTYLRIWRS*
Ga0126377_131007432	3300010362	Tropical Forest Soil	VNEPANDDEPQPRGALLLILIYLAVLAAFWLNTYLRIWRS*
Ga0126377_135902941	3300010362	Tropical Forest Soil	ASMDDHAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126379_111126663	3300010366	Tropical Forest Soil	RARGKVEVIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126379_117549032	3300010366	Tropical Forest Soil	VAISLFGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0137362_100361884	3300012205	Vadose Zone Soil	MDHDANDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0137358_110169942	3300012582	Vadose Zone Soil	VDDPVHDDEPRPWGALLFILIYLYVLAGFWTTTYLRIWRS*
Ga0137397_100764533	3300012685	Vadose Zone Soil	VDENANGDEPRPRGALVLIMIYLTVLAAFWLNTYLRIWRS*
Ga0137396_107108041	3300012918	Vadose Zone Soil	VDDPVHDDEPRPWGALLFILVYLFVLAVVWTNSYLRIWSG*
Ga0137394_105409642	3300012922	Vadose Zone Soil	VDENPSDGEPRPRGALLLIMIYLVVLAAFWLNTYMRI
Ga0137410_100915971	3300012944	Vadose Zone Soil	RRTTVDDPVHDDEPRPWGALLFILIYLFVLAVFWTNTYLRIWRS*
Ga0126375_101417211	3300012948	Tropical Forest Soil	VNENGHDDEPRPRGALVLIMIYLFVLAAFWLNTYLRIWRS*
Ga0126369_102420532	3300012971	Tropical Forest Soil	VAISLIGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0157380_130447731	3300014326	Switchgrass Rhizosphere	VDENPTDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0137405_12339144	3300015053	Vadose Zone Soil	VDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWR
Ga0132258_103028323	3300015371	Arabidopsis Rhizosphere	VDENSNNDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0132258_133139952	3300015371	Arabidopsis Rhizosphere	MDDDSGHDEPQPRGALLFILIYLMILLGFWLNTYLRIWRS*
Ga0132256_1008342392	3300015372	Arabidopsis Rhizosphere	MDDDSRNGEEPQPRGALLRILIYLVILLGFWLNTYLRIWRS*
Ga0132256_1039169292	3300015372	Arabidopsis Rhizosphere	VDDDSRDDEPRPRGALVLILIYLSILTAFWLNTYLRIWRS*
Ga0132255_1010144471	3300015374	Arabidopsis Rhizosphere	VDDTVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0132255_1011759001	3300015374	Arabidopsis Rhizosphere	PSPGVKETDMDDDNRNGEEPQPRGALLLILIYLVILLGFWLNTYLRIWRS*
Ga0187773_100669883	3300018064	Tropical Peatland	VSDDTHDDEPRPLGALVLIVIYLAVLAAFWLNTYLRIWRS
Ga0066655_100174693	3300018431	Grasslands Soil	MVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0066667_100007648	3300018433	Grasslands Soil	VDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS
Ga0179594_100393932	3300020170	Vadose Zone Soil	VDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0207681_101703263	3300025923	Switchgrass Rhizosphere	VDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0207689_116666952	3300025942	Miscanthus Rhizosphere	SFKPGRRAAVDENPTDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0207668_106465712	3300025972	Switchgrass Rhizosphere	VDDPVHDDEPKPWGALLLILSYLLVLAVFWTNTYLRIWRS
Ga0209470_10854521	3300026324	Soil	GRRTTVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209375_11364321	3300026329	Soil	DPRRVTVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS
Ga0209057_11110024	3300026342	Soil	MVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYL
Ga0257164_10843442	3300026497	Soil	VDENANGDEPRPRGALLLIMIYLLVLAAFWLNTYLRIWRS
Ga0209058_12962331	3300026536	Soil	PVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209157_13054231	3300026537	Soil	VDDPAHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209684_10544522	3300027527	Tropical Forest Soil	VDDNAHDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS
Ga0209466_10042681	3300027646	Tropical Forest Soil	NPISETRGTLVEWRSAGRRPTVDDNAHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWR
Ga0209799_10117233	3300027654	Tropical Forest Soil	MEAPVDDNAHHEEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209388_11596942	3300027655	Vadose Zone Soil	VDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0209814_100498781	3300027873	Populus Rhizosphere	MVRTAVPQRRRPTVNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS
Ga0209465_100244432	3300027874	Tropical Forest Soil	VDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209465_101583641	3300027874	Tropical Forest Soil	DACGRGRQSAGRGTIVSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS
Ga0209465_105309252	3300027874	Tropical Forest Soil	VDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209465_106709772	3300027874	Tropical Forest Soil	VIELAESGRRSTVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0209382_1000078318	3300027909	Populus Rhizosphere	VDDDTYEPEPRPRGALVLILIYLVILAAFWINTYLRLWRS
Ga0247822_107402321	3300028592	Soil	SDRRVLEGFRQPSRGPTVDDDSRDDEPRPRGALLLILIYLAILTAFWLNTYLRIWRS
Ga0247826_111930612	3300030336	Soil	VDDPLHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307500_100480481	3300031198	Soil	KGQRREHGDQPMDDDGHDEEPQPRGALLFILIYLAALLAFWLNTYLRIWRS
Ga0318516_101106012	3300031543	Soil	VAVSLIDDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0318528_104915902	3300031561	Soil	VAVSLIGDQREGVPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0310813_114328402	3300031716	Soil	VDENSSDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS
Ga0307469_100416694	3300031720	Hardwood Forest Soil	VDEKPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307469_101123223	3300031720	Hardwood Forest Soil	VDDPVHADEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307469_103771893	3300031720	Hardwood Forest Soil	MIDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307469_106132693	3300031720	Hardwood Forest Soil	WEATDPDRVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307469_106340292	3300031720	Hardwood Forest Soil	VGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307468_1001791183	3300031740	Hardwood Forest Soil	RWILVEFPEPGRRSTVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0307473_101838643	3300031820	Hardwood Forest Soil	VNENDDEPRPRGALVLIMIYLCVLAAFWLNTYLRIWRS
Ga0307473_115173662	3300031820	Hardwood Forest Soil	RPTVDENSNDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0318499_100306233	3300031832	Soil	VDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRLWRS
Ga0318506_101688923	3300032052	Soil	AVSLIGDQREGVPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0307471_1000600374	3300032180	Hardwood Forest Soil	MDENGNGNEPRPRGALVLITIYLAVLAAFWLNTYLRIWRS
Ga0307471_1004702563	3300032180	Hardwood Forest Soil	RPGRRTTVDEKPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307471_1014397291	3300032180	Hardwood Forest Soil	VNENDDEPRPRGALILIMIYLCVLAAFWLNTYLRIWRS
Ga0307471_1017000681	3300032180	Hardwood Forest Soil	GQARRRPTVDENSNDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0307472_1019100922	3300032205	Hardwood Forest Soil	VIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0364933_139241_391_513	3300034150	Sediment	VDDPVHDDEPKPWGALLLILLYLLVLAVFWTNTYLRIWRS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign