| Basic Information | |
|---|---|
| Family ID | F068701 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAHVADHLSFETLADLEHVVTERCRVLNGDQLKPGTNFHWWPKPDIPA |
| Number of Associated Samples | 61 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.15 % |
| % of genes near scaffold ends (potentially truncated) | 31.45 % |
| % of genes from short scaffolds (< 2000 bps) | 95.16 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.452 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (45.161 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.05% β-sheet: 0.00% Coil/Unstructured: 78.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00805 | Pentapeptide | 4.03 |
| PF10090 | HPTransfase | 3.23 |
| PF03594 | BenE | 2.42 |
| PF03401 | TctC | 1.61 |
| PF02371 | Transposase_20 | 1.61 |
| PF13358 | DDE_3 | 1.61 |
| PF13384 | HTH_23 | 0.81 |
| PF06078 | DUF937 | 0.81 |
| PF04352 | ProQ | 0.81 |
| PF01027 | Bax1-I | 0.81 |
| PF03775 | MinC_C | 0.81 |
| PF01497 | Peripla_BP_2 | 0.81 |
| PF13551 | HTH_29 | 0.81 |
| PF05974 | DUF892 | 0.81 |
| PF14031 | D-ser_dehydrat | 0.81 |
| PF07750 | GcrA | 0.81 |
| PF03734 | YkuD | 0.81 |
| PF08352 | oligo_HPY | 0.81 |
| PF02530 | Porin_2 | 0.81 |
| PF12840 | HTH_20 | 0.81 |
| PF01548 | DEDD_Tnp_IS110 | 0.81 |
| PF07508 | Recombinase | 0.81 |
| PF01433 | Peptidase_M1 | 0.81 |
| PF00575 | S1 | 0.81 |
| PF13924 | Lipocalin_5 | 0.81 |
| PF01464 | SLT | 0.81 |
| PF04020 | Phage_holin_4_2 | 0.81 |
| PF03480 | DctP | 0.81 |
| PF00989 | PAS | 0.81 |
| PF07729 | FCD | 0.81 |
| PF09557 | DUF2382 | 0.81 |
| PF03795 | YCII | 0.81 |
| PF13379 | NMT1_2 | 0.81 |
| PF13592 | HTH_33 | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF00440 | TetR_N | 0.81 |
| PF13472 | Lipase_GDSL_2 | 0.81 |
| PF02965 | Met_synt_B12 | 0.81 |
| PF02586 | SRAP | 0.81 |
| PF01209 | Ubie_methyltran | 0.81 |
| PF11959 | DUF3473 | 0.81 |
| PF00118 | Cpn60_TCP1 | 0.81 |
| PF00535 | Glycos_transf_2 | 0.81 |
| PF13565 | HTH_32 | 0.81 |
| PF13701 | DDE_Tnp_1_4 | 0.81 |
| PF01494 | FAD_binding_3 | 0.81 |
| PF04069 | OpuAC | 0.81 |
| PF17036 | CBP_BcsS | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 4.03 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 2.42 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 2.42 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 2.42 |
| COG3135 | Predicted benzoate:H+ symporter BenE | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.42 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.61 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.61 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG3109 | sRNA-binding protein ProQ | Signal transduction mechanisms [T] | 0.81 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.81 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.81 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.81 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.81 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.81 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.81 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.81 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0850 | Septum site-determining protein MinC | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.81 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.81 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.81 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.45 % |
| All Organisms | root | All Organisms | 43.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2119805011|FNTS010_GJ857YP01BXIW8 | Not Available | 502 | Open in IMG/M |
| 3300002568|C688J35102_120849823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300005329|Ga0070683_100803850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 901 | Open in IMG/M |
| 3300005330|Ga0070690_100441850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300005334|Ga0068869_100803535 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005347|Ga0070668_100939588 | Not Available | 775 | Open in IMG/M |
| 3300005347|Ga0070668_101184730 | Not Available | 692 | Open in IMG/M |
| 3300005356|Ga0070674_100829150 | Not Available | 801 | Open in IMG/M |
| 3300005366|Ga0070659_101099642 | Not Available | 700 | Open in IMG/M |
| 3300005457|Ga0070662_100472845 | Not Available | 1043 | Open in IMG/M |
| 3300005543|Ga0070672_100830204 | Not Available | 814 | Open in IMG/M |
| 3300005618|Ga0068864_101177486 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005719|Ga0068861_102405937 | Not Available | 529 | Open in IMG/M |
| 3300006755|Ga0079222_10813542 | Not Available | 765 | Open in IMG/M |
| 3300006806|Ga0079220_10564321 | Not Available | 798 | Open in IMG/M |
| 3300006876|Ga0079217_10777365 | Not Available | 660 | Open in IMG/M |
| 3300006881|Ga0068865_100277339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 1333 | Open in IMG/M |
| 3300007790|Ga0105679_10388389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1591 | Open in IMG/M |
| 3300009036|Ga0105244_10580808 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009098|Ga0105245_10474826 | Not Available | 1263 | Open in IMG/M |
| 3300009156|Ga0111538_11677352 | Not Available | 801 | Open in IMG/M |
| 3300009553|Ga0105249_11369714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 779 | Open in IMG/M |
| 3300009789|Ga0126307_10042210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 3545 | Open in IMG/M |
| 3300009789|Ga0126307_10194009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1629 | Open in IMG/M |
| 3300009789|Ga0126307_10290957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300009789|Ga0126307_10321916 | Not Available | 1245 | Open in IMG/M |
| 3300009789|Ga0126307_10386199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300009789|Ga0126307_10699639 | Not Available | 818 | Open in IMG/M |
| 3300009789|Ga0126307_11073074 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009789|Ga0126307_11489597 | Not Available | 549 | Open in IMG/M |
| 3300009840|Ga0126313_10492445 | Not Available | 981 | Open in IMG/M |
| 3300009840|Ga0126313_10677246 | Not Available | 834 | Open in IMG/M |
| 3300009840|Ga0126313_10751026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300009840|Ga0126313_11243508 | Not Available | 614 | Open in IMG/M |
| 3300009840|Ga0126313_11371267 | Not Available | 585 | Open in IMG/M |
| 3300009840|Ga0126313_11699095 | Not Available | 527 | Open in IMG/M |
| 3300010036|Ga0126305_10102255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. Leaf466 | 1723 | Open in IMG/M |
| 3300010036|Ga0126305_10294335 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010036|Ga0126305_10450644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300010036|Ga0126305_10477987 | Not Available | 829 | Open in IMG/M |
| 3300010036|Ga0126305_10866013 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010037|Ga0126304_10063080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2277 | Open in IMG/M |
| 3300010037|Ga0126304_10462190 | Not Available | 850 | Open in IMG/M |
| 3300010037|Ga0126304_10565443 | Not Available | 765 | Open in IMG/M |
| 3300010037|Ga0126304_10816535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 633 | Open in IMG/M |
| 3300010038|Ga0126315_10614652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 703 | Open in IMG/M |
| 3300010039|Ga0126309_10162228 | Not Available | 1210 | Open in IMG/M |
| 3300010039|Ga0126309_10382064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300010039|Ga0126309_10751111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300010039|Ga0126309_11166781 | Not Available | 527 | Open in IMG/M |
| 3300010039|Ga0126309_11220638 | Not Available | 517 | Open in IMG/M |
| 3300010040|Ga0126308_10308655 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300010040|Ga0126308_10615327 | Not Available | 742 | Open in IMG/M |
| 3300010041|Ga0126312_10062655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2501 | Open in IMG/M |
| 3300010041|Ga0126312_10116841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1834 | Open in IMG/M |
| 3300010041|Ga0126312_11001883 | Not Available | 611 | Open in IMG/M |
| 3300010041|Ga0126312_11271944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300010042|Ga0126314_10320339 | Not Available | 1109 | Open in IMG/M |
| 3300010042|Ga0126314_10359348 | Not Available | 1046 | Open in IMG/M |
| 3300010042|Ga0126314_10716157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300010044|Ga0126310_10548901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 853 | Open in IMG/M |
| 3300010044|Ga0126310_11189046 | Not Available | 611 | Open in IMG/M |
| 3300010044|Ga0126310_11358730 | Not Available | 577 | Open in IMG/M |
| 3300010044|Ga0126310_11631054 | Not Available | 533 | Open in IMG/M |
| 3300010044|Ga0126310_11693871 | Not Available | 525 | Open in IMG/M |
| 3300010045|Ga0126311_10746447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300010045|Ga0126311_10986390 | Not Available | 688 | Open in IMG/M |
| 3300010045|Ga0126311_11423035 | Not Available | 579 | Open in IMG/M |
| 3300010045|Ga0126311_11740655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300010045|Ga0126311_11875738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Aminobacter → unclassified Aminobacter → Aminobacter sp. AP02 | 509 | Open in IMG/M |
| 3300010045|Ga0126311_11925955 | Not Available | 502 | Open in IMG/M |
| 3300010166|Ga0126306_10710920 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010166|Ga0126306_10848484 | Not Available | 739 | Open in IMG/M |
| 3300010166|Ga0126306_10883211 | Not Available | 724 | Open in IMG/M |
| 3300010166|Ga0126306_11414503 | Not Available | 576 | Open in IMG/M |
| 3300010166|Ga0126306_11458029 | Not Available | 567 | Open in IMG/M |
| 3300010166|Ga0126306_11556876 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010166|Ga0126306_11848533 | Not Available | 506 | Open in IMG/M |
| 3300010373|Ga0134128_12186790 | Not Available | 609 | Open in IMG/M |
| 3300012212|Ga0150985_101142371 | Not Available | 598 | Open in IMG/M |
| 3300012212|Ga0150985_102595000 | Not Available | 692 | Open in IMG/M |
| 3300012212|Ga0150985_108939349 | Not Available | 793 | Open in IMG/M |
| 3300012212|Ga0150985_110917263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1992 | Open in IMG/M |
| 3300012212|Ga0150985_111675624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B1 | 786 | Open in IMG/M |
| 3300012212|Ga0150985_112055527 | Not Available | 905 | Open in IMG/M |
| 3300012212|Ga0150985_113233384 | Not Available | 580 | Open in IMG/M |
| 3300012212|Ga0150985_115486625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 661 | Open in IMG/M |
| 3300012212|Ga0150985_117564575 | Not Available | 516 | Open in IMG/M |
| 3300012212|Ga0150985_120080845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
| 3300012212|Ga0150985_120782423 | Not Available | 1407 | Open in IMG/M |
| 3300012212|Ga0150985_122017156 | Not Available | 2243 | Open in IMG/M |
| 3300012212|Ga0150985_122387123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1431 | Open in IMG/M |
| 3300012402|Ga0134059_1186274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 585 | Open in IMG/M |
| 3300012469|Ga0150984_101025353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300012469|Ga0150984_108530466 | Not Available | 519 | Open in IMG/M |
| 3300012469|Ga0150984_110026878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1210 | Open in IMG/M |
| 3300012469|Ga0150984_120901191 | Not Available | 1039 | Open in IMG/M |
| 3300012987|Ga0164307_10519980 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300013306|Ga0163162_12834793 | Not Available | 558 | Open in IMG/M |
| 3300014325|Ga0163163_10410095 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300014488|Ga0182001_10575418 | Not Available | 536 | Open in IMG/M |
| 3300014968|Ga0157379_11629814 | Not Available | 630 | Open in IMG/M |
| 3300015262|Ga0182007_10296948 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300015371|Ga0132258_12422368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300015371|Ga0132258_13673468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300015372|Ga0132256_100650376 | Not Available | 1169 | Open in IMG/M |
| 3300015372|Ga0132256_103013695 | Not Available | 566 | Open in IMG/M |
| 3300015373|Ga0132257_102516228 | Not Available | 669 | Open in IMG/M |
| 3300015373|Ga0132257_104339908 | Not Available | 516 | Open in IMG/M |
| 3300018465|Ga0190269_11822468 | Not Available | 520 | Open in IMG/M |
| 3300018466|Ga0190268_11387733 | Not Available | 601 | Open in IMG/M |
| 3300019767|Ga0190267_10436038 | Not Available | 747 | Open in IMG/M |
| 3300025901|Ga0207688_10307032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 971 | Open in IMG/M |
| 3300025907|Ga0207645_10532515 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300025932|Ga0207690_10203546 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300025935|Ga0207709_11253584 | Not Available | 612 | Open in IMG/M |
| 3300025972|Ga0207668_10501417 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300026023|Ga0207677_11700138 | Not Available | 585 | Open in IMG/M |
| 3300031091|Ga0308201_10056187 | Not Available | 1006 | Open in IMG/M |
| 3300032002|Ga0307416_103023882 | Not Available | 563 | Open in IMG/M |
| 3300032004|Ga0307414_11094381 | All Organisms → cellular organisms → Bacteria → Chrysiogenetes → Chrysiogenetes → Chrysiogenales → Chrysiogenaceae | 736 | Open in IMG/M |
| 3300032013|Ga0310906_10717785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 45.16% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.23% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2119805011 | Soil microbial communities from sample at Multiple FACE and OTC sites | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FNTS010_02753080 | 2119805011 | Soil | MAHVADHLSFGTLAELEHVVTERCRVLNHDQLKPGTNFHWWPKPDIPA |
| C688J35102_1208498231 | 3300002568 | Soil | MAHVADHLSFGTLAELEQVVTERCRILTRDQRKPGTNFHWWPKPAVPA* |
| Ga0070683_1008038502 | 3300005329 | Corn Rhizosphere | MAHGADHLSFETLTELEQAVTERCGVLNGGQLKPGTNFHWWPNTNSPEV* |
| Ga0070690_1004418501 | 3300005330 | Switchgrass Rhizosphere | MAHVVDHLSFGTLAELEQVVTERCRILTRDQLKPGTNFYWWPKPAVPA* |
| Ga0068869_1008035351 | 3300005334 | Miscanthus Rhizosphere | EPLANQYFATLADLEHVVTERCRVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0070668_1009395882 | 3300005347 | Switchgrass Rhizosphere | MAHVPDHLSFATLADLERVVTEHCCILNRDQLKPGTNFHWWPTPAKPV* |
| Ga0070668_1011847301 | 3300005347 | Switchgrass Rhizosphere | MAHVADHVSFETLADLEQTVIERCCVLNSDQLKPGTNFHWWPKPSVPT* |
| Ga0070674_1008291502 | 3300005356 | Miscanthus Rhizosphere | MVHVPDHLSFATLADLERVVTEHCCILNRDQLKPGTNFHWWP |
| Ga0070659_1010996422 | 3300005366 | Corn Rhizosphere | MAHVADHLSFETLTDLEQVVTERCRILNRDQLKPGTDFHWW |
| Ga0070662_1004728452 | 3300005457 | Corn Rhizosphere | MAHVPDHLSFATLADLERVVTEHCCILNRDQLKPGTNFHWWP |
| Ga0070672_1008302043 | 3300005543 | Miscanthus Rhizosphere | MAHVADHVSFETLADLEQTVIERCCVLNSDKLKPGTNFHWWPKPSVPT* |
| Ga0068864_1011774862 | 3300005618 | Switchgrass Rhizosphere | MAHVVDHLSVSALEEKGPLLLEQVVTQRCRILNRDQLKPGTNFYWWPKPAIPA* |
| Ga0068861_1024059372 | 3300005719 | Switchgrass Rhizosphere | MAHVADHVSFETLADLEQTVIERCCVLNSDQLKPGTNFHWWPKPSVPA* |
| Ga0079222_108135421 | 3300006755 | Agricultural Soil | MAHVADHLSFATLADLEHVVTERCRVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0079220_105643212 | 3300006806 | Agricultural Soil | MAHVADPLSFATLADLEHVVTEPCRVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0079217_107773651 | 3300006876 | Agricultural Soil | MAHVADHLSFATLADLERAVADRCRVLNGHQLSLGTNFHWWPKPAKPA* |
| Ga0068865_1002773391 | 3300006881 | Miscanthus Rhizosphere | MAHVADHLSFETLTDLEQVVTERCRILNRDQLKPGTDFHWWP |
| Ga0105679_103883893 | 3300007790 | Soil | MAHVADHLSFATLADLEQAVTERCRVLNRDQLKPGTSFHWWPKPAIPA* |
| Ga0105244_105808081 | 3300009036 | Miscanthus Rhizosphere | MAHVVDHLSFATLADLEHVVTERCRVLHRDQLKPGTNFHWWPKPDIPA* |
| Ga0105245_104748261 | 3300009098 | Miscanthus Rhizosphere | MAHVADHLSFETLTDLEQVVTERCRILNRDQLKPGTDFHWWPKPAIPI* |
| Ga0111538_116773521 | 3300009156 | Populus Rhizosphere | MAHVVDHLSFGTLAELEQVVTERCRILTRDQLKPGTNFSWWPKPAVPA* |
| Ga0105249_113697142 | 3300009553 | Switchgrass Rhizosphere | MAHVADHLSFATLADLERVVTEHCCILNRDQLKPGTNFHWWPTPAKPV* |
| Ga0126307_100422101 | 3300009789 | Serpentine Soil | MAHVADHLSFGTLAELEQVVTERCRILNRDQLKPGTNFHWWPTPAIPA* |
| Ga0126307_101940093 | 3300009789 | Serpentine Soil | MAHVADHLSFATLADLERAVADRCRVLNGHQLSLGTNFHWWPKPIKPA* |
| Ga0126307_102909572 | 3300009789 | Serpentine Soil | MAHVADHLSFETVADLEQAVTERCLVLDGDQLKLGTNSHW* |
| Ga0126307_103219161 | 3300009789 | Serpentine Soil | LANQYFETLADLEHVVTERCRVLNGDQLKPGTNFHWWPKPDIPA* |
| Ga0126307_103861992 | 3300009789 | Serpentine Soil | MAHVADHLSFATLADLERAVADRCRVLEGDQLSLATNFHWWPKPTKPA* |
| Ga0126307_106996391 | 3300009789 | Serpentine Soil | MAHVADRLSFATLADLERVVTERCRILNGDQLKPGTNFHWWPKPDIPA* |
| Ga0126307_110730742 | 3300009789 | Serpentine Soil | MALVADHLSFATLAELEHVVTERCRILNRDQLKPGTNFHWWPKPDVPA* |
| Ga0126307_114895971 | 3300009789 | Serpentine Soil | MAHVADHLSFATLADLEHVVTARCRVLNRDQLKPGTNFHWWPKPDIPA* |
| Ga0126313_104924452 | 3300009840 | Serpentine Soil | MAHVADHLSFDSLADLEQVVTERCRVLNGDQLKPGTNFYWWPKPAKPA* |
| Ga0126313_106772461 | 3300009840 | Serpentine Soil | SRRRTMAHVADHLSFGTLAELEQVVTERCRILNRDQLKPGTNFHWWPTPAIPA* |
| Ga0126313_107510262 | 3300009840 | Serpentine Soil | MAHVADHLSFATLADRERAVADRCRVFDGDQLSLGTSFHWWPKPAKPA* |
| Ga0126313_112435081 | 3300009840 | Serpentine Soil | MAHVADHLSFGTLADLEQVVTERCRILNRDQLKPGTNFHWWPKPTKPA* |
| Ga0126313_113712671 | 3300009840 | Serpentine Soil | MAHVADHLSFATLADLEHVVTARCRVLNRDQLKPGTNFHWWP |
| Ga0126313_116990951 | 3300009840 | Serpentine Soil | MVHVADHLSFETLADLEHVVTERCRVLNRDQLKPGTNFYWWPKPIKSA* |
| Ga0126305_101022553 | 3300010036 | Serpentine Soil | MAHVADHLSFGTLAELEHVVTERCRVLNRDQLKLGTNFYWWPKPDIPA* |
| Ga0126305_102943352 | 3300010036 | Serpentine Soil | MAHVVDHLSFETLADVEQAVAERCRILNGDQLKPGTNFHWWPKPDIPA* |
| Ga0126305_104506442 | 3300010036 | Serpentine Soil | MAHVADHLSFDTLADLERAVTDRCLVLDSDQLKPGTNFHWWPKPIIPA* |
| Ga0126305_104779873 | 3300010036 | Serpentine Soil | MAHGADHLSFATLADLEHVITARCRVLNRDQLKSGTNFHGWPKPDISA* |
| Ga0126305_108660131 | 3300010036 | Serpentine Soil | MAHVADHLSFATLADRERAVADRCRVFDGDQLSLGTSFHWWPKPAKPAKPAKPAKSA* |
| Ga0126304_100630804 | 3300010037 | Serpentine Soil | MAHVAGHLSFDSLADLEQVVTERCRVLNSNQLKPGTNFHWWPKPIMPA* |
| Ga0126304_104621902 | 3300010037 | Serpentine Soil | MAHVADHLSFATVSDLEQVITARCRVLNRDQLKSGTNFHGWPKPNISA* |
| Ga0126304_105654431 | 3300010037 | Serpentine Soil | MAHVADHLSFETVADLEQAVTERCLVLDGDQLKLGTNSHWWPKPIAPA* |
| Ga0126304_108165352 | 3300010037 | Serpentine Soil | SFDTLADLERAVTDRCLVLDSDQLKPGTNFHCWPKPIIPA* |
| Ga0126315_106146522 | 3300010038 | Serpentine Soil | MAHVADHLSFDTLADLERAVTDRCLVLDSDQLKPGTNFHWWPKPTKPA* |
| Ga0126309_101622282 | 3300010039 | Serpentine Soil | MAHVADHVSFETLTDLEQTVVERCRVLNSDQLKPGTNFHWWPKPIVPT* |
| Ga0126309_103820642 | 3300010039 | Serpentine Soil | MAHVADHLSFATLADLEHVVTERCRILNRDQLRPGTNFHWWPKPDIPA* |
| Ga0126309_107511112 | 3300010039 | Serpentine Soil | TMAHVADHLSFETLADLERAIADRCRVLDGDQLPLGTNFHWWPKPAKPA* |
| Ga0126309_111667812 | 3300010039 | Serpentine Soil | MAHVADHLSFATLADLEQVVTERCRVLNGDQLEPGTNFYWWPKPAKPA* |
| Ga0126309_112206381 | 3300010039 | Serpentine Soil | MAHGADHLSFATLADLEQVITARCRVLNRDQLKSGTTSHGWPKPDISA* |
| Ga0126308_103086552 | 3300010040 | Serpentine Soil | MAHVADHLSFATLADLEQVVTARCRVLNRDQLKPGTTFHWWPKPAIPA* |
| Ga0126308_106153272 | 3300010040 | Serpentine Soil | MAHVADHLSFGTLADLEQVVTERCRILNRDQLKPGTNFHWWPTPAIPA* |
| Ga0126312_100626551 | 3300010041 | Serpentine Soil | QSFETLADLERAVAERCLVLDGDPLRLGTNFYWWPKPAIPS* |
| Ga0126312_101168413 | 3300010041 | Serpentine Soil | VADHLSFATLADLERAVADRCWVLEGDQLSLGTNFHWWPKPTKPA* |
| Ga0126312_110018832 | 3300010041 | Serpentine Soil | MAHVADHLSFETLANLERAVADRCRVLEGDQLKPGTNFHWWPKPIMPA* |
| Ga0126312_112719441 | 3300010041 | Serpentine Soil | DLLSVSALLSFETLADLEHVVTERCRVLNRDQLKPGTNFYWWPKPDIPA* |
| Ga0126314_103203392 | 3300010042 | Serpentine Soil | MAHVADHLSFDTLADLERAVTDRCLVLDSDQLKPGTNFHWWPKPDIPA* |
| Ga0126314_103593482 | 3300010042 | Serpentine Soil | MAHVADRLSFATLADLERVVTERCRILNGNPLKPGTNFHWWPKPDIPA* |
| Ga0126314_107161572 | 3300010042 | Serpentine Soil | MAHVADHLSFATLADLEHVVTERCRVLNHDQLKPGTNFHWWPRPDIPA* |
| Ga0126310_105489011 | 3300010044 | Serpentine Soil | MAQVADHLSFATLADLERAVTERCRILNSDQLKPGTNFHWWPKPAIPA* |
| Ga0126310_111890462 | 3300010044 | Serpentine Soil | RTMAHVADHLSFATLADLEHVVTERCRVLNHDQLKPGTTFHWWPKPDIPA* |
| Ga0126310_113587301 | 3300010044 | Serpentine Soil | SFATLADLEQVITARCRVLNRDPLKPGANFHWWPKLDIPA* |
| Ga0126310_116310541 | 3300010044 | Serpentine Soil | MAHVADHLSFATLADLEQVITVRCRVLNRDQLKPGTNFHWWPKPDISA* |
| Ga0126310_116938712 | 3300010044 | Serpentine Soil | MAHVADHLSFGTLAELEHVVTARCRVLNRDQLKLGTNFYWWPKPDWWPK |
| Ga0126311_107464472 | 3300010045 | Serpentine Soil | MAHVADHLSFETLTDLEQVVTERCRVLNSDQLKPGTNFHWWPKPATPA* |
| Ga0126311_109863901 | 3300010045 | Serpentine Soil | RRTMAHVADHLSFDTLADLERAVTERCLVLDSDQLKPGTNFHWWPKPIIPA* |
| Ga0126311_114230352 | 3300010045 | Serpentine Soil | MAHGADHLSFATLADLEQVITVRCRVLNRDQLKPGTNFHWWPKPDISA* |
| Ga0126311_117406551 | 3300010045 | Serpentine Soil | GRRTMVHVADHLSFETLADLEHVVTERCRVLNRDQLKPGTNFYWWPKPATPS* |
| Ga0126311_118757381 | 3300010045 | Serpentine Soil | AHRSFGTLAELEQVVTERCRILNSDQLKPGTTFHWWPKPAIPA* |
| Ga0126311_119259551 | 3300010045 | Serpentine Soil | EPGRRTMAHVADHLSFATLADLAQAVTERCRVLNSDQLKPGTNFHWWPKPIVPT* |
| Ga0126306_107109203 | 3300010166 | Serpentine Soil | MAHVADHLSFGTRAELEQVVTERCRILNRDQLKPGTNFHWGPTPAIPA* |
| Ga0126306_108484841 | 3300010166 | Serpentine Soil | MAHVADHLSFATLADLKHVVTERCRVLNRDQLKPGTN |
| Ga0126306_108832111 | 3300010166 | Serpentine Soil | MAHVADHLSFKTLADLEQAVTERCLVLDSDQLKLGTNFHW* |
| Ga0126306_114145032 | 3300010166 | Serpentine Soil | MAQVADHLSFETLADLEHVVTARCRVLNRDQLKPGTNFYWWSKPAIPA* |
| Ga0126306_114580291 | 3300010166 | Serpentine Soil | MAHVADHLSFATLSDLEQVITARCRVLNRDQLKPGTNFHWWPKLDIPA* |
| Ga0126306_115568761 | 3300010166 | Serpentine Soil | MAHVADHLSFETLADLEHVVTARCRVLNRDQLKPGTDFHWWPKPDIPA* |
| Ga0126306_118485331 | 3300010166 | Serpentine Soil | MAHVADHLSFETFAGLEQAVTQRCIPLEGDQLKPGTDFHWWPKPI |
| Ga0134128_121867901 | 3300010373 | Terrestrial Soil | MAHVVDHLSFGTLAELEQVVTERCRILTRDQLKPGTNFYWWPKPA |
| Ga0150985_1011423711 | 3300012212 | Avena Fatua Rhizosphere | MAHVADHLSFATLADLERVVTKRCCIINRDQIKPGTNFHWWPKP |
| Ga0150985_1025950002 | 3300012212 | Avena Fatua Rhizosphere | PIWRTMAHVADHLSFGTLAELEQVVTERCRILTRDQLKPGTTFHWWPKPAAPA* |
| Ga0150985_1089393492 | 3300012212 | Avena Fatua Rhizosphere | MAQVAHHLSFATFADLEQVITARCRVLNRDQLKPSTKFHWWPKPDIQA* |
| Ga0150985_1109172631 | 3300012212 | Avena Fatua Rhizosphere | MAPVADHLSFETLTDLDHAATERCRILNGDQLKLGTTVHWWPKPIAPT* |
| Ga0150985_1116756241 | 3300012212 | Avena Fatua Rhizosphere | PLANQYFDTLADLERAIADRCRVLDGDQLSLGTNFHWWPKPDIPA* |
| Ga0150985_1120555272 | 3300012212 | Avena Fatua Rhizosphere | MAHGADHLSFEILADLERAATERCRALEGDQLKLGTNFHGWPKPIPPA* |
| Ga0150985_1132333841 | 3300012212 | Avena Fatua Rhizosphere | LSFETLADLERVVADRCRVLDGDQLSLGTNFHWWPKPAKPV* |
| Ga0150985_1154866253 | 3300012212 | Avena Fatua Rhizosphere | MAHVADHLSFETLADLEHVVTERCRVLNGDQLKPGTNFHWWPKPDIPA* |
| Ga0150985_1175645752 | 3300012212 | Avena Fatua Rhizosphere | ANQYFATLAELEHVVTERCRVLNHDQLKPGKNFHWWPKPDIPA* |
| Ga0150985_1200808453 | 3300012212 | Avena Fatua Rhizosphere | LANRYFATLADLERTVADRCRVLDGDQLSLGTNFHWWPKPDIPA* |
| Ga0150985_1207824232 | 3300012212 | Avena Fatua Rhizosphere | MAHVADHLSFETLADLERAVADRCRVLDGHQLSLATNLRWWPKSATPA* |
| Ga0150985_1220171562 | 3300012212 | Avena Fatua Rhizosphere | MAHVVDHLSFATFAELEQVVTGRCRILNRDQLKPGTNFHWWPKPATPA* |
| Ga0150985_1223871233 | 3300012212 | Avena Fatua Rhizosphere | LDEPLGNRYFEALADLEQAVTERCLVLDGDQLKPGTNFRWWPKPSIPA* |
| Ga0134059_11862742 | 3300012402 | Grasslands Soil | MWPITHVADHLSFGTLADLEHVVTERCRVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0150984_1010253532 | 3300012469 | Avena Fatua Rhizosphere | MAHAADHLSFATLADLEQVITARCRVLNRDQLKSGTNFHGWPKPDISA* |
| Ga0150984_1085304661 | 3300012469 | Avena Fatua Rhizosphere | MGHVADHLSFETLADLEQAVTERCLVLDGEQLKPGTNFYWWSKPTNSA* |
| Ga0150984_1100268783 | 3300012469 | Avena Fatua Rhizosphere | MVHVADHLSFAPLADLERAVTERCLVLDSDQLKPGTNFHWWPKPSIPA* |
| Ga0150984_1209011911 | 3300012469 | Avena Fatua Rhizosphere | MAHVVDHLSFATFAELEQVVTDRCRILNRDQLKPGTNFHWWPKPATPA* |
| Ga0164307_105199801 | 3300012987 | Soil | MAHVVDHLSFGTLAELEQVVTERCRILTRDQLKPGTNFYWWPKPATPI* |
| Ga0157374_119525592 | 3300013296 | Miscanthus Rhizosphere | MAHVADHLSFATIAELEHVVTERCRVLHRDQLKPGTNF |
| Ga0163162_128347931 | 3300013306 | Switchgrass Rhizosphere | MAHVADHLSFETLADLEQVITAGCCVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0163163_104100952 | 3300014325 | Switchgrass Rhizosphere | MAHVPDHLSFATLADLERVVTERCCILNRDQLKPGTNFHWWPTPAKPV* |
| Ga0182001_105754182 | 3300014488 | Soil | LANHYFATLADLEHVVTERCRVLNHDQLKPGTNFHWWPKPDIPA* |
| Ga0157379_116298142 | 3300014968 | Switchgrass Rhizosphere | MAQVADHLSFATFAELEHVVTERCRVLNRDQLKPGTNFHGWPKPDIPA* |
| Ga0182007_102969481 | 3300015262 | Rhizosphere | LANSYFETLADLEQTVIERCCVLNGDQLKPGTNFHWWPKPSVPA* |
| Ga0132258_124223682 | 3300015371 | Arabidopsis Rhizosphere | MAHVVDHLSFETLADLEHVVTARCRVLNSDQLKPGSNFHWWPKPSVPT* |
| Ga0132258_136734682 | 3300015371 | Arabidopsis Rhizosphere | MAQVADHLSFAALADLERVVAQRCRVLHRDQLKPGTNFHWWPKPDIPA* |
| Ga0132256_1006503764 | 3300015372 | Arabidopsis Rhizosphere | MAHVPDHLSFATLADLERVVTEHCCILHRDQLKPGT |
| Ga0132256_1030136951 | 3300015372 | Arabidopsis Rhizosphere | MAHVVDHLSFGTLAELEQVVTERCRILTRDQLKPGINFSWWPKPAVPA* |
| Ga0132257_1025162282 | 3300015373 | Arabidopsis Rhizosphere | MAHVVDHLSFETLADLEHVVTARCRVLNSDQLKPGSNFHWWPTPSVPN* |
| Ga0132257_1043399081 | 3300015373 | Arabidopsis Rhizosphere | MAHVVDHLSFGTLAELEQVVTEHCRILTRDQLKPGTNFSWWPKPAVPA* |
| Ga0190269_118224682 | 3300018465 | Soil | MAHVADHLSFETLAGLEQAVADRCRVLDGHQLSLGTNFHWWPKPAKPA |
| Ga0190268_113877332 | 3300018466 | Soil | MAHVADHLSFGTLAELEHVVTARCRVRNRDQLKLGTNFYWWPKPG |
| Ga0190267_104360382 | 3300019767 | Soil | MAHVADHLSFGTLAELEQVVTERCRILNRDQLKPGTNFHWWPTPAIPA |
| Ga0207688_103070322 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHVADHVSFETLADLEQTVIERCCVLNSDQLKPGTNFHWWPKPSVPT |
| Ga0207645_105325151 | 3300025907 | Miscanthus Rhizosphere | MAHVADHLSFATLADLEHVVAQRCRVLNRDQLKPGTNFHWWPKPDIPA |
| Ga0207690_102035463 | 3300025932 | Corn Rhizosphere | MAHVPDHLSFATLADLERVVTERCCILTRDQLKPGTNFHWWP |
| Ga0207709_112535841 | 3300025935 | Miscanthus Rhizosphere | MAHVPDHLSFATLADLERVVTEHCRILNRDQLKPGTNFHWWPTP |
| Ga0207668_105014172 | 3300025972 | Switchgrass Rhizosphere | MAHVPDHLSFATLADLERVVTEHCCILNRDQLKPGTNFHWWPTPAKPV |
| Ga0207677_117001381 | 3300026023 | Miscanthus Rhizosphere | MAHVADHVSFETLADLEQTVIERCCVLYSDQLKPGTNFHWWPKPSVPT |
| Ga0308201_100561871 | 3300031091 | Soil | MAHVADHLSFETLADLERAVADRCRVLDGDQLSLGTNFHWWPKPAKPA |
| Ga0307405_119499852 | 3300031731 | Rhizosphere | MAHVADHLSFETLADLEHVVTARCRVLNRDQLKPG |
| Ga0307416_1030238822 | 3300032002 | Rhizosphere | MAHVADHLSFETVADLEQAVTERCLVLDGDQLKFGTNSHW |
| Ga0307414_110943811 | 3300032004 | Rhizosphere | MAHVADHLSFASHGDLEQVITARCRVLNGNPLKPGTSFHGWPKPDIPA |
| Ga0310906_107177851 | 3300032013 | Soil | MAHVADHLSVSTLADLEHVVTERCRVLNADQLKPGTNFHWWPKPAIPV |
| ⦗Top⦘ |