| Basic Information | |
|---|---|
| Family ID | F068696 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PPGVDTSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 85.48 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (50.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (49.194 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 17.74 |
| PF01613 | Flavin_Reduct | 11.29 |
| PF02582 | DUF155 | 5.65 |
| PF00196 | GerE | 4.03 |
| PF00005 | ABC_tran | 3.23 |
| PF10262 | Rdx | 2.42 |
| PF08924 | DUF1906 | 2.42 |
| PF00300 | His_Phos_1 | 2.42 |
| PF08402 | TOBE_2 | 1.61 |
| PF13343 | SBP_bac_6 | 1.61 |
| PF12867 | DinB_2 | 0.81 |
| PF00483 | NTP_transferase | 0.81 |
| PF04909 | Amidohydro_2 | 0.81 |
| PF02776 | TPP_enzyme_N | 0.81 |
| PF00067 | p450 | 0.81 |
| PF00378 | ECH_1 | 0.81 |
| PF07978 | NIPSNAP | 0.81 |
| PF02900 | LigB | 0.81 |
| PF01593 | Amino_oxidase | 0.81 |
| PF14373 | Imm_superinfect | 0.81 |
| PF02775 | TPP_enzyme_C | 0.81 |
| PF00873 | ACR_tran | 0.81 |
| PF04392 | ABC_sub_bind | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 11.29 |
| COG1723 | Mitochondrial translation protein, Rmd1/RMND1/DUF155 family | Translation, ribosomal structure and biogenesis [J] | 5.65 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.81 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10040854 | Not Available | 940 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10157207 | Not Available | 919 | Open in IMG/M |
| 3300004635|Ga0062388_101752072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300005332|Ga0066388_103735884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 777 | Open in IMG/M |
| 3300005439|Ga0070711_100951937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 735 | Open in IMG/M |
| 3300005445|Ga0070708_102275400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 3300005552|Ga0066701_10442081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300005764|Ga0066903_101259422 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005764|Ga0066903_101698428 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300006046|Ga0066652_101184037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 724 | Open in IMG/M |
| 3300006755|Ga0079222_11342324 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300007076|Ga0075435_101676282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300010043|Ga0126380_11748809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300010154|Ga0127503_10451614 | Not Available | 537 | Open in IMG/M |
| 3300010361|Ga0126378_10116347 | Not Available | 2669 | Open in IMG/M |
| 3300010362|Ga0126377_10978872 | Not Available | 911 | Open in IMG/M |
| 3300010366|Ga0126379_12644552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 599 | Open in IMG/M |
| 3300010376|Ga0126381_101571809 | Not Available | 950 | Open in IMG/M |
| 3300010376|Ga0126381_103763426 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010937|Ga0137776_1111504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300011120|Ga0150983_11382150 | Not Available | 522 | Open in IMG/M |
| 3300011120|Ga0150983_15423821 | Not Available | 510 | Open in IMG/M |
| 3300012202|Ga0137363_11494542 | Not Available | 566 | Open in IMG/M |
| 3300012209|Ga0137379_10630692 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012349|Ga0137387_10665016 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300012971|Ga0126369_10440780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1349 | Open in IMG/M |
| 3300012971|Ga0126369_11416281 | Not Available | 785 | Open in IMG/M |
| 3300016270|Ga0182036_10159836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1614 | Open in IMG/M |
| 3300016294|Ga0182041_10215491 | Not Available | 1539 | Open in IMG/M |
| 3300016294|Ga0182041_11815030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
| 3300016319|Ga0182033_10031244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3405 | Open in IMG/M |
| 3300016319|Ga0182033_10277640 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300016341|Ga0182035_11470261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300016341|Ga0182035_11837118 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300016341|Ga0182035_12182499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300016387|Ga0182040_10040962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2808 | Open in IMG/M |
| 3300016387|Ga0182040_10373666 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300016422|Ga0182039_10451988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300017933|Ga0187801_10480997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300020581|Ga0210399_11308194 | Not Available | 570 | Open in IMG/M |
| 3300021178|Ga0210408_11251850 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021180|Ga0210396_10917325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300021404|Ga0210389_10017544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5536 | Open in IMG/M |
| 3300021444|Ga0213878_10161037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300021478|Ga0210402_10120276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2373 | Open in IMG/M |
| 3300021559|Ga0210409_10162719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2042 | Open in IMG/M |
| 3300022532|Ga0242655_10004479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2314 | Open in IMG/M |
| 3300022717|Ga0242661_1022191 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300022722|Ga0242657_1122810 | Not Available | 661 | Open in IMG/M |
| 3300025898|Ga0207692_10541610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
| 3300026326|Ga0209801_1019527 | All Organisms → cellular organisms → Bacteria | 3345 | Open in IMG/M |
| 3300026333|Ga0209158_1022612 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300026538|Ga0209056_10267075 | Not Available | 1205 | Open in IMG/M |
| 3300026555|Ga0179593_1036369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2642 | Open in IMG/M |
| 3300027502|Ga0209622_1041203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300027698|Ga0209446_1000391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 9941 | Open in IMG/M |
| 3300031231|Ga0170824_122563014 | Not Available | 583 | Open in IMG/M |
| 3300031231|Ga0170824_127967104 | Not Available | 517 | Open in IMG/M |
| 3300031446|Ga0170820_16915322 | Not Available | 511 | Open in IMG/M |
| 3300031469|Ga0170819_15856973 | Not Available | 649 | Open in IMG/M |
| 3300031543|Ga0318516_10715276 | Not Available | 568 | Open in IMG/M |
| 3300031572|Ga0318515_10216891 | Not Available | 1026 | Open in IMG/M |
| 3300031573|Ga0310915_10517774 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031573|Ga0310915_10927554 | Not Available | 609 | Open in IMG/M |
| 3300031640|Ga0318555_10665683 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031679|Ga0318561_10096503 | Not Available | 1548 | Open in IMG/M |
| 3300031679|Ga0318561_10191430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1108 | Open in IMG/M |
| 3300031679|Ga0318561_10822899 | Not Available | 510 | Open in IMG/M |
| 3300031682|Ga0318560_10205901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300031708|Ga0310686_101612829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300031719|Ga0306917_11215081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300031736|Ga0318501_10016289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3020 | Open in IMG/M |
| 3300031736|Ga0318501_10598967 | Not Available | 605 | Open in IMG/M |
| 3300031747|Ga0318502_11016306 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031764|Ga0318535_10568677 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031770|Ga0318521_10524651 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031770|Ga0318521_10854388 | Not Available | 555 | Open in IMG/M |
| 3300031771|Ga0318546_11022228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300031779|Ga0318566_10127699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1256 | Open in IMG/M |
| 3300031781|Ga0318547_10519271 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031798|Ga0318523_10004350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5256 | Open in IMG/M |
| 3300031799|Ga0318565_10535578 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031805|Ga0318497_10709247 | Not Available | 564 | Open in IMG/M |
| 3300031832|Ga0318499_10394474 | Not Available | 530 | Open in IMG/M |
| 3300031845|Ga0318511_10164659 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031880|Ga0318544_10387009 | Not Available | 543 | Open in IMG/M |
| 3300031890|Ga0306925_10739135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. 4M-Z18 | 1026 | Open in IMG/M |
| 3300031890|Ga0306925_12007534 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031893|Ga0318536_10253831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300031894|Ga0318522_10252862 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031896|Ga0318551_10539138 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031897|Ga0318520_10092392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1684 | Open in IMG/M |
| 3300031897|Ga0318520_10898408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300031910|Ga0306923_12530331 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031912|Ga0306921_12563799 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031941|Ga0310912_10077878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2402 | Open in IMG/M |
| 3300031942|Ga0310916_10045477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3328 | Open in IMG/M |
| 3300031946|Ga0310910_10675298 | Not Available | 817 | Open in IMG/M |
| 3300031946|Ga0310910_11107886 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031946|Ga0310910_11229535 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031947|Ga0310909_10260490 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300031947|Ga0310909_11623348 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031959|Ga0318530_10109812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1102 | Open in IMG/M |
| 3300031981|Ga0318531_10057151 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300031981|Ga0318531_10426853 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300032001|Ga0306922_10929684 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300032025|Ga0318507_10204469 | Not Available | 852 | Open in IMG/M |
| 3300032035|Ga0310911_10891327 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300032039|Ga0318559_10417721 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032039|Ga0318559_10531067 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032043|Ga0318556_10563796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300032055|Ga0318575_10694059 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032059|Ga0318533_10112182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1899 | Open in IMG/M |
| 3300032063|Ga0318504_10136650 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300032063|Ga0318504_10415381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300032076|Ga0306924_10726249 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300032090|Ga0318518_10045994 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300032090|Ga0318518_10407876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300032091|Ga0318577_10013702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3252 | Open in IMG/M |
| 3300032094|Ga0318540_10605990 | Not Available | 527 | Open in IMG/M |
| 3300032180|Ga0307471_100641500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1224 | Open in IMG/M |
| 3300032205|Ga0307472_100796454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300033134|Ga0335073_11245142 | Not Available | 742 | Open in IMG/M |
| 3300033290|Ga0318519_10041986 | Not Available | 2238 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 50.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.81% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100408542 | 3300001545 | Forest Soil | PPGADASYYSARAIEKIFPRDDTWRQTVLPEMYAEELPVAAK* |
| JGIcombinedJ51221_101572072 | 3300003505 | Forest Soil | AVKTVQTGGSPPGADASYYSARAIEKIFPREDTWRRTVLPEMYAEELPVAAK* |
| Ga0062388_1017520722 | 3300004635 | Bog Forest Soil | PGVDTSYYSARAIEKIFPRQETWRETVLPEMYAEELPVAAK* |
| Ga0066388_1037358841 | 3300005332 | Tropical Forest Soil | LLLDAVKTVQAGGNPPGADASYYSARAIEKIFPRHDTWRQTVLPEMYAERIPVAAK* |
| Ga0070711_1009519372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PPGVDTSYYSARAIEKIFPREITWRQTVLPEMYAENIPVAAK* |
| Ga0070708_1022754001 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TDDSYYSARAIEKIFPREITWRETVLPEMYAEEVPIAAK* |
| Ga0066701_104420811 | 3300005552 | Soil | RRLLLDAVKTVQTGGNPPGADASYYSARAIEKIFPREDTWRRTVLPEMYAEELPVAAK* |
| Ga0066903_1012594221 | 3300005764 | Tropical Forest Soil | SYYSARAIEKIFPREMTWRDTVLADMYADEFSIAAK* |
| Ga0066903_1016984284 | 3300005764 | Tropical Forest Soil | DTSYYSARAIEKIFPRHDTWRRTVLPDMYAEELPIAAK* |
| Ga0066652_1011840372 | 3300006046 | Soil | PPGVDTSYYSARAIEKIFPREITWRETVLPEMYAEDMLVAAK* |
| Ga0079222_113423242 | 3300006755 | Agricultural Soil | YSARAIEKIFPREITWRETVLPEMYAEENMPVAAK* |
| Ga0075435_1016762822 | 3300007076 | Populus Rhizosphere | YSARAIERIFPREMTWRETVLPEMYAEELPVAAK* |
| Ga0126380_117488091 | 3300010043 | Tropical Forest Soil | DTSYYSARAIERIFPREMTWRDTVLPEMYAEELPVTAK* |
| Ga0127503_104516141 | 3300010154 | Soil | DASYYSARAIEKIFPREDTWRQTVLPEMYAEELPVAAK* |
| Ga0126378_101163471 | 3300010361 | Tropical Forest Soil | GVDTSYYSARAIEKIFPREMTWRDTVLADMYADEFSIAAK* |
| Ga0126377_109788721 | 3300010362 | Tropical Forest Soil | SYYSARAIERIFPREMTWRDTVLPEMYAEELPVAAK* |
| Ga0126379_126445523 | 3300010366 | Tropical Forest Soil | PPGADTSYYSARAIERVFPREMTWRETVLPEMYAEEVPAAAK* |
| Ga0126381_1015718092 | 3300010376 | Tropical Forest Soil | YSARAIERIFPREMTWRDTVLPEMYAEELPVAAK* |
| Ga0126381_1037634261 | 3300010376 | Tropical Forest Soil | YSARAIEKIFPREITWRQTVLPEMYAEKVPVGAK* |
| Ga0137776_11115041 | 3300010937 | Sediment | YYQARAIEKIFPRQETWRDTVLPEMYAEELPVAAK* |
| Ga0150983_113821501 | 3300011120 | Forest Soil | VDTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK* |
| Ga0150983_154238211 | 3300011120 | Forest Soil | DTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK* |
| Ga0137363_114945422 | 3300012202 | Vadose Zone Soil | KTVQAGGNPPGVDTSYYSARAIEKIFPRHDTWRQTVLPEMYVERIPVAAK* |
| Ga0137379_106306923 | 3300012209 | Vadose Zone Soil | EGGNPLGVDTSYYSARAIEKIFPREITWRETVLPDMYAEDIPVAAK* |
| Ga0137387_106650161 | 3300012349 | Vadose Zone Soil | NPLGVDTSYYSARAIEKIFPREITWRETVLPDMYAEDIPVAAK* |
| Ga0126369_104407803 | 3300012971 | Tropical Forest Soil | LLDAVKTVQTGGNPPAVDDSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK* |
| Ga0126369_114162811 | 3300012971 | Tropical Forest Soil | PPGVDTSYYSARAIERIFPREMTWRDTVLPDMYAEELPVAAK* |
| Ga0182036_101598363 | 3300016270 | Soil | GVDTSYYSARAIEKIFPREITWRETVLPEMYAEEMPIAAK |
| Ga0182041_102154914 | 3300016294 | Soil | AGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0182041_118150301 | 3300016294 | Soil | VDTSYYSARAIEKIFPREITWRETVLPEMYAEDHVPVAAK |
| Ga0182033_100312441 | 3300016319 | Soil | DTSYYSARAIEKIFPREITWRETVLPEMYAEEMPVAAK |
| Ga0182033_102776401 | 3300016319 | Soil | RLLLDAVKTVQAGGSPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0182035_114702612 | 3300016341 | Soil | GNPPGADDSYYSARAIEKIFPCHDTWRQTVLPEMYAEELPVAAK |
| Ga0182035_118371182 | 3300016341 | Soil | RLLLDAVTTVQAGGNPPGVDTSYYSARAIEKIFPRQDTWRQTVLPEMYAEELPVAAK |
| Ga0182035_121824991 | 3300016341 | Soil | DTSYYSARAIEKIFPRQETWRQTVLPEMYAEELPAAAK |
| Ga0182040_100409621 | 3300016387 | Soil | SYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0182040_103736661 | 3300016387 | Soil | SYYSARAIEKIFPRHDTWRETVLPEMYAEELPAAAK |
| Ga0182039_104519883 | 3300016422 | Soil | VTTVQAGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYGEALPVAAK |
| Ga0187801_104809972 | 3300017933 | Freshwater Sediment | GNPPGVDASYYSARAIEKIFPRQETWRETVLPEMYAEELPVAAK |
| Ga0210399_113081941 | 3300020581 | Soil | VDTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK |
| Ga0210408_112518502 | 3300021178 | Soil | VKTVQAGGSPPGVDTSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPAAAK |
| Ga0210396_109173251 | 3300021180 | Soil | LDAVKTVQAGGNPPGADTSYYSARAIEKVFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0210389_100175448 | 3300021404 | Soil | DTSYYSARAIEKIFPREITWRETVLPEMYAEEMPVAVK |
| Ga0213878_101610371 | 3300021444 | Bulk Soil | PGVDTSYYTARAIEKIFPRQDTWRQTVLPEMYAEEVPIAAK |
| Ga0210402_101202761 | 3300021478 | Soil | TSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK |
| Ga0210409_101627191 | 3300021559 | Soil | PPGADASYYSARAIEKIFPREDTWRRTVLPEMYAEELPVAAK |
| Ga0242655_100044793 | 3300022532 | Soil | DTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK |
| Ga0242661_10221912 | 3300022717 | Soil | VQTGGSPPGADASYYSARAIEKIFPRHDTWRQTVLPEMYVERIPLAAK |
| Ga0242657_11228102 | 3300022722 | Soil | ATRLLLLDAVKTVQAGGSPPGTDTSYYSARAIEKIFPRHETWRQTVLPEMYAEEVPVAAK |
| Ga0207692_105416103 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PGVDTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK |
| Ga0209801_10195276 | 3300026326 | Soil | SYYHARAIEKIFPRSSTWRETVLLEMYADEESVAATTFR |
| Ga0209158_10226124 | 3300026333 | Soil | PGVDASYYHARAIEKIFPRSSTWRETVLPEMYADDGSLAAVH |
| Ga0209056_102670751 | 3300026538 | Soil | NPPGADASYYSARAIEKIFPREDTWRRTVLPEMYAEELPVAAK |
| Ga0179593_10363693 | 3300026555 | Vadose Zone Soil | VQEGGDPLGVDTSYYSARAIEKIFPREITWRETVLPEMYAEDMPVAAK |
| Ga0209622_10412031 | 3300027502 | Forest Soil | VDTSYYSARAIERIFPREMTWRETVLPEMYAEEQPVAAK |
| Ga0209446_10003911 | 3300027698 | Bog Forest Soil | DSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0170824_1225630142 | 3300031231 | Forest Soil | DAVKTVQAGGNPPGADASYYSARAIEKIFPREDTWRRTVLPEMYAERIPVAAK |
| Ga0170824_1279671041 | 3300031231 | Forest Soil | DSYYAARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0170820_169153221 | 3300031446 | Forest Soil | YYAARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0170819_158569731 | 3300031469 | Forest Soil | LDAVKTVQTGGNPPGVDDSYYAARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318516_107152761 | 3300031543 | Soil | NSYYSARAIEKIFPRHDTWRQTVLPEMYAEELAVAPK |
| Ga0318515_102168911 | 3300031572 | Soil | NPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0310915_105177742 | 3300031573 | Soil | DTSYYSARAIEKIFPRRDTWRRTVLPEMYAEELPVAAK |
| Ga0310915_109275541 | 3300031573 | Soil | GNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0318555_106656831 | 3300031640 | Soil | YYSARAIEKIFPREITWRQTVLPEMYAEKVPVGAK |
| Ga0318561_100965034 | 3300031679 | Soil | LLLDAVKTVQTGGNPPGVDTSYYSARAIEKIFPRQETWRQTVLPEMYAEELPAAAK |
| Ga0318561_101914301 | 3300031679 | Soil | GNPPGVDTSYYSARAIEKIFPREITWRETVLPEMYAEEMPIAAK |
| Ga0318561_108228991 | 3300031679 | Soil | TSYYQARAIEKIFPRQETWRRTVLPEMYAEDLPVAAK |
| Ga0318560_102059013 | 3300031682 | Soil | VEAGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0310686_1016128292 | 3300031708 | Soil | NPPGVDTSYYSARAIEKIFPRQETWRDTVLPEMYAEDLPVSAK |
| Ga0306917_112150812 | 3300031719 | Soil | GNPPGADDSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318501_100162891 | 3300031736 | Soil | VQAGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0318501_105989672 | 3300031736 | Soil | YYSARAIEKIFPRHDTWRQAVLPEMYAEELPVAAK |
| Ga0318502_110163061 | 3300031747 | Soil | VQAGGNPPGVDTSYYSARAIEKIFPRQDTWRQTVLPEMYAEELPVAAK |
| Ga0318535_105686771 | 3300031764 | Soil | SYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318521_105246512 | 3300031770 | Soil | VKTVQAGGSPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318521_108543881 | 3300031770 | Soil | VDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0318546_110222282 | 3300031771 | Soil | SYYSARAIERIFPREMTWRETVLPEMYAEQLPVAAK |
| Ga0318566_101276991 | 3300031779 | Soil | GVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318547_105192711 | 3300031781 | Soil | LDAVKTVEAGGSPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318523_100043506 | 3300031798 | Soil | VDTSYYSARAIERIFPREMTWRDTVLPEMYAEELPVAAK |
| Ga0318565_105355781 | 3300031799 | Soil | VDTSYYSARAIEKIFPRRDTWRRTVLPEMYAEELPVAAK |
| Ga0318497_107092472 | 3300031805 | Soil | PPGVDTSYYSARAIERIFPREMTWRETVLPEMYAEDMPVAAK |
| Ga0318499_103944742 | 3300031832 | Soil | SYYSARAIEKIFPREITWRETVLPEMYAEEMPIAAK |
| Ga0318511_101646591 | 3300031845 | Soil | VDDSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318544_103870091 | 3300031880 | Soil | DTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0306925_107391351 | 3300031890 | Soil | PPGVDTSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0306925_120075342 | 3300031890 | Soil | RLLLDALKTVQAGGNPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318536_102538312 | 3300031893 | Soil | VDASYYSARAIEKIFPRHDTWRQTMLPEMYAEELPVAAK |
| Ga0318522_102528622 | 3300031894 | Soil | PGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAVK |
| Ga0318551_105391382 | 3300031896 | Soil | TSYYSARAIEKIFPRRDTWRRTVLPEMYAEELPVAAK |
| Ga0318520_100923924 | 3300031897 | Soil | LLLDAVTTVQAGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAVK |
| Ga0318520_108984081 | 3300031897 | Soil | TGGNPPGADTSYYSARAIEKVFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0306923_125303312 | 3300031910 | Soil | TSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAVK |
| Ga0306921_125637991 | 3300031912 | Soil | LLDAVKTVQTGGSPPGVDTSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0310912_100778783 | 3300031941 | Soil | DTSYYSARAIERIFPREMTWRETVLPEMYAEELPVAAK |
| Ga0310916_100454775 | 3300031942 | Soil | ASYYSARAIEKIFPRHDTWRRTVLPEMYAEELRVVAK |
| Ga0310910_106752982 | 3300031946 | Soil | PGVDTSYYSARAIEKIFPREITWRETVLPEMYAEEMPIAAK |
| Ga0310910_111078861 | 3300031946 | Soil | DNSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0310910_112295351 | 3300031946 | Soil | GSPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0310909_102604903 | 3300031947 | Soil | DTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0310909_116233481 | 3300031947 | Soil | NPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAVK |
| Ga0318530_101098123 | 3300031959 | Soil | YYSARAIERIFPREMTWRETVLPEMYAEDMPVAAK |
| Ga0318531_100571514 | 3300031981 | Soil | VQAGGNPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318531_104268532 | 3300031981 | Soil | RLLLDAVKTVQAGGNPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0306922_109296841 | 3300032001 | Soil | RLLLDAVKTVQAGGNPPGADNSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318507_102044691 | 3300032025 | Soil | TSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0310911_108913272 | 3300032035 | Soil | YYSARAIEKIFPRRDTWRRTVLPEMYAEELPVAAK |
| Ga0318559_104177212 | 3300032039 | Soil | VKTVQAGGSPPGVDTSYYSARAIEKIFPRHDTWRETVLPEMYAEELPAAAK |
| Ga0318559_105310671 | 3300032039 | Soil | AGGNPPGADDSYYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318556_105637962 | 3300032043 | Soil | PPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0318575_106940592 | 3300032055 | Soil | AVKTVQAGGNPPGVDTSYYSARAIEKIFPRHDTWRRTVLPEMYAEELPVAAK |
| Ga0318533_101121824 | 3300032059 | Soil | YYSARAIEKIFPRHDTWRQTVLPEMYAEELPVAAK |
| Ga0318504_101366503 | 3300032063 | Soil | YYSARAIEKIFPRHATWRQTVLPEMYAEELPVAAK |
| Ga0318504_104153811 | 3300032063 | Soil | KTVQTGGNPPGVDTSYYSARAIEKIFPRQETWRQTVLPEMYAEELPAAAK |
| Ga0306924_107262493 | 3300032076 | Soil | TSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0318518_100459941 | 3300032090 | Soil | VDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0318518_104078762 | 3300032090 | Soil | SYYSARAIERIFPREMTWRDTVLPEMYAEELPVAAK |
| Ga0318577_100137021 | 3300032091 | Soil | GVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEKLPVAAK |
| Ga0318540_106059901 | 3300032094 | Soil | AVTTVQAGGNPPGVDTSYYSARAIEKIFPRNDTWRQTVLPEMYAEALPVAAK |
| Ga0307471_1006415003 | 3300032180 | Hardwood Forest Soil | DAVKTVQAGGNPPGADASYYSARAIEKIFPREDTWRQTVLPEMYAEEFPLAAK |
| Ga0307472_1007964542 | 3300032205 | Hardwood Forest Soil | VKTVQAGGNPPGADASYYSARAIEKIFPREDTWRRTVLPEMYAEALPAAAK |
| Ga0335073_112451422 | 3300033134 | Soil | TDTSYYQARAIEKIFPRDETWRQTVLPEMYAEDLPVAAK |
| Ga0318519_100419861 | 3300033290 | Soil | VQEGGNPPGVDTSYYSARAIERIFPREMTWRETVLPEMYAEEQPVAAK |
| ⦗Top⦘ |