| Basic Information | |
|---|---|
| Family ID | F068654 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TLRVDARNIFNHPTPGDPNLNINSGTFGEINSKTGSRKLQGQIHFQF |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.23 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 91.13 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.936 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.645 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.806 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 10.67% Coil/Unstructured: 89.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07519 | Tannase | 8.87 |
| PF00072 | Response_reg | 3.23 |
| PF00873 | ACR_tran | 3.23 |
| PF00884 | Sulfatase | 3.23 |
| PF11578 | DUF3237 | 2.42 |
| PF13531 | SBP_bac_11 | 1.61 |
| PF03992 | ABM | 1.61 |
| PF13360 | PQQ_2 | 1.61 |
| PF13620 | CarboxypepD_reg | 1.61 |
| PF07635 | PSCyt1 | 1.61 |
| PF00563 | EAL | 0.81 |
| PF01844 | HNH | 0.81 |
| PF01011 | PQQ | 0.81 |
| PF03848 | TehB | 0.81 |
| PF01367 | 5_3_exonuc | 0.81 |
| PF00082 | Peptidase_S8 | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF06689 | zf-C4_ClpX | 0.81 |
| PF13380 | CoA_binding_2 | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF05787 | DUF839 | 0.81 |
| PF03602 | Cons_hypoth95 | 0.81 |
| PF03972 | MmgE_PrpD | 0.81 |
| PF13442 | Cytochrome_CBB3 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| PF01425 | Amidase | 0.81 |
| PF00950 | ABC-3 | 0.81 |
| PF13590 | DUF4136 | 0.81 |
| PF13801 | Metal_resist | 0.81 |
| PF12847 | Methyltransf_18 | 0.81 |
| PF07617 | DUF1579 | 0.81 |
| PF00196 | GerE | 0.81 |
| PF04199 | Cyclase | 0.81 |
| PF13432 | TPR_16 | 0.81 |
| PF14294 | DUF4372 | 0.81 |
| PF03551 | PadR | 0.81 |
| PF13376 | OmdA | 0.81 |
| PF00355 | Rieske | 0.81 |
| PF02276 | CytoC_RC | 0.81 |
| PF03572 | Peptidase_S41 | 0.81 |
| PF12796 | Ank_2 | 0.81 |
| PF13570 | PQQ_3 | 0.81 |
| PF11141 | DUF2914 | 0.81 |
| PF02371 | Transposase_20 | 0.81 |
| PF00266 | Aminotran_5 | 0.81 |
| PF08668 | HDOD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.81 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.81 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.81 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.81 |
| COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 0.81 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.81 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.81 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.81 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.16 % |
| Unclassified | root | N/A | 4.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01BXE4W | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 566 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1816594 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300004157|Ga0062590_100659906 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300004157|Ga0062590_100866494 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300004463|Ga0063356_102504056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300005172|Ga0066683_10307900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 984 | Open in IMG/M |
| 3300005172|Ga0066683_10854562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 525 | Open in IMG/M |
| 3300005175|Ga0066673_10073836 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300005181|Ga0066678_10697537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300005181|Ga0066678_10962392 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005186|Ga0066676_10201256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1280 | Open in IMG/M |
| 3300005187|Ga0066675_10735654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300005330|Ga0070690_100773292 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005331|Ga0070670_100014579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6750 | Open in IMG/M |
| 3300005331|Ga0070670_101509410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005332|Ga0066388_106439774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300005334|Ga0068869_100803614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300005340|Ga0070689_101993918 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005345|Ga0070692_11147013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 551 | Open in IMG/M |
| 3300005364|Ga0070673_101062611 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005367|Ga0070667_101902431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005438|Ga0070701_11003684 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005446|Ga0066686_10201264 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300005553|Ga0066695_10283153 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005577|Ga0068857_100610899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1031 | Open in IMG/M |
| 3300005598|Ga0066706_11097470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300005598|Ga0066706_11468003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_103930408 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005834|Ga0068851_10563820 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 689 | Open in IMG/M |
| 3300005841|Ga0068863_102591729 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005844|Ga0068862_102031598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 586 | Open in IMG/M |
| 3300006031|Ga0066651_10747114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300006031|Ga0066651_10773594 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006034|Ga0066656_10633779 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006796|Ga0066665_10021902 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
| 3300006796|Ga0066665_10455849 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300006796|Ga0066665_10755769 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006800|Ga0066660_11461068 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006844|Ga0075428_102464410 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006845|Ga0075421_101005644 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300006865|Ga0073934_10799788 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006871|Ga0075434_100627258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300006904|Ga0075424_100629827 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300007258|Ga0099793_10445586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300009012|Ga0066710_100631134 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300009012|Ga0066710_101032900 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300009012|Ga0066710_102366021 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009012|Ga0066710_103317975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300009094|Ga0111539_11557695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300009094|Ga0111539_12383522 | Not Available | 614 | Open in IMG/M |
| 3300009094|Ga0111539_13290681 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009137|Ga0066709_100344648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2044 | Open in IMG/M |
| 3300009137|Ga0066709_102783755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300009147|Ga0114129_11560024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 810 | Open in IMG/M |
| 3300009148|Ga0105243_12431135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 562 | Open in IMG/M |
| 3300009156|Ga0111538_12883405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 602 | Open in IMG/M |
| 3300009162|Ga0075423_10711764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300009162|Ga0075423_12941317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300010047|Ga0126382_10047227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2495 | Open in IMG/M |
| 3300010047|Ga0126382_12094117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300010333|Ga0134080_10111786 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300010333|Ga0134080_10335625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300010336|Ga0134071_10374949 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300010337|Ga0134062_10148416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300010358|Ga0126370_11276465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300010358|Ga0126370_11506009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 640 | Open in IMG/M |
| 3300010366|Ga0126379_10956029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
| 3300010376|Ga0126381_104552122 | Not Available | 535 | Open in IMG/M |
| 3300010398|Ga0126383_11359595 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300010398|Ga0126383_13218151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300010401|Ga0134121_11863925 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300011120|Ga0150983_12230342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300011120|Ga0150983_12819304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 613 | Open in IMG/M |
| 3300011445|Ga0137427_10026228 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300012199|Ga0137383_10405337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300012199|Ga0137383_10904977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300012211|Ga0137377_11577740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 581 | Open in IMG/M |
| 3300012349|Ga0137387_11287578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012356|Ga0137371_11333954 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012362|Ga0137361_10084289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2724 | Open in IMG/M |
| 3300012908|Ga0157286_10470013 | Not Available | 504 | Open in IMG/M |
| 3300012909|Ga0157290_10196417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300012911|Ga0157301_10466156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012923|Ga0137359_11473539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300012971|Ga0126369_10344161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1511 | Open in IMG/M |
| 3300012976|Ga0134076_10156868 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012977|Ga0134087_10536338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300013296|Ga0157374_11805381 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300013297|Ga0157378_13198004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300013308|Ga0157375_12690989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300014326|Ga0157380_10538457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300015200|Ga0173480_10023732 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300015245|Ga0137409_10962799 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300015371|Ga0132258_11684387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1600 | Open in IMG/M |
| 3300015371|Ga0132258_13140974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
| 3300015372|Ga0132256_103729580 | Not Available | 512 | Open in IMG/M |
| 3300015373|Ga0132257_101872186 | Not Available | 772 | Open in IMG/M |
| 3300015374|Ga0132255_102460059 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300017659|Ga0134083_10322626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 659 | Open in IMG/M |
| 3300018431|Ga0066655_10049915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2151 | Open in IMG/M |
| 3300018431|Ga0066655_10675539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300018433|Ga0066667_11818934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300018433|Ga0066667_12083295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018433|Ga0066667_12259479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300020582|Ga0210395_11007706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300025324|Ga0209640_11379659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300025893|Ga0207682_10096534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-69-10 | 1288 | Open in IMG/M |
| 3300025903|Ga0207680_10186046 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300025918|Ga0207662_10072838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300025930|Ga0207701_11159439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300025933|Ga0207706_11506085 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025934|Ga0207686_11216320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300025936|Ga0207670_10943458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300025941|Ga0207711_10930381 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300025972|Ga0207668_10178587 | Not Available | 1672 | Open in IMG/M |
| 3300026089|Ga0207648_11624128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1 | 607 | Open in IMG/M |
| 3300026332|Ga0209803_1055529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1733 | Open in IMG/M |
| 3300026342|Ga0209057_1191338 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026540|Ga0209376_1367582 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027835|Ga0209515_10463081 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027965|Ga0209062_1318955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300031446|Ga0170820_11197972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2173 | Open in IMG/M |
| 3300031716|Ga0310813_10055985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2925 | Open in IMG/M |
| 3300032205|Ga0307472_100565631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.03% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.81% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_03844520 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | LRIDASNILNHPTPGNPNLDINSGTFGEIQTKTGNRTLAGQLRLEF |
| ICChiseqgaiiDRAFT_18165943 | 3300000033 | Soil | RNLTLRLDAQNVFNHPTPGSPNLNINSGTFGEINSKTGNRSLAGQIRFEF* |
| Ga0062590_1006599061 | 3300004157 | Soil | FRMTEGTRLTVRIDSNNVFNHPNPGDPNLNINSGTFGEIDSKTGNRSLAGQVKFEF* |
| Ga0062590_1008664942 | 3300004157 | Soil | DARNLFNHPTPGNPNLNANTGTFGQINTKTGSRTLAGQIRLEF* |
| Ga0063356_1025040561 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ILNHPTPGNPNLDINSGTFGEITTKTGSRTLSGQLRLEF* |
| Ga0066683_103079001 | 3300005172 | Soil | DARNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF* |
| Ga0066683_108545622 | 3300005172 | Soil | ESKTLTLRVDARNVFNHPTPGDPNLNMNSDTFGQINSKTGSRKLQGQIHFQF* |
| Ga0066673_100738364 | 3300005175 | Soil | VFNHPTPGDPNLNMNSGTFGQIDYKTGSRKLQGQIHFQF* |
| Ga0066678_106975372 | 3300005181 | Soil | ANILKTVKIAESKRLTLRVDAHNLFNHPTPTDPNLNINSGTFGEINSKTGNRTLQG* |
| Ga0066678_109623921 | 3300005181 | Soil | SNILNHPTPANPNLDINSGTFGEITTKNGSRTLAGQIRFEF* |
| Ga0066676_102012562 | 3300005186 | Soil | TLRVDARNIFNHPTPGDPNLNINSGTFGEINSKTGSRKLQGQIHFQF* |
| Ga0066675_107356541 | 3300005187 | Soil | LKTIKIAESKTLTLRVDARNVFNHPTPGDPNLNMNSGTFGEINYKTGSRKLQGQIHFQF* |
| Ga0070690_1007732921 | 3300005330 | Switchgrass Rhizosphere | DARNIFNHPTPGNPNLNLNSGTFGQIATKTGSRTLAGQIRLEF* |
| Ga0070670_1000145791 | 3300005331 | Switchgrass Rhizosphere | SLTFRIDARNIFNHPTPGSPNLNINSGTFGEITTKTGSRALAGQIRLEF* |
| Ga0070670_1015094102 | 3300005331 | Switchgrass Rhizosphere | LTIRVDSNNVFNHPNPGDPNVNINAGTFGEIDSKTGSRSLAAQARFEF* |
| Ga0066388_1064397741 | 3300005332 | Tropical Forest Soil | NNIFNHPTPGNPNLDINSGNFGEITTKTGSRTLAGQVRLEF* |
| Ga0068869_1008036142 | 3300005334 | Miscanthus Rhizosphere | KTFRTSESTRLTIRVDSNNVFNHPNPGDPNVNINAGTFGEIDSKTGSRSLAAQARFEF* |
| Ga0070689_1019939181 | 3300005340 | Switchgrass Rhizosphere | DARNLFNHPTPANPNLNVNTGTFGQINTKTGSRTLAGQIRLEF* |
| Ga0070692_111470131 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DESRNLAIRIDARNVLNHPTPGNPNLNLNAGTFGQITTKTGSRTLAAQIRLEF* |
| Ga0070673_1010626112 | 3300005364 | Switchgrass Rhizosphere | SRSVAIRVDARNIFNHPTPGNPNLNINSGTFGQITTKTGNRALAGQIRLEF* |
| Ga0070667_1019024311 | 3300005367 | Switchgrass Rhizosphere | NVFNHPNPGDPNLNINSGTFGEIDSKTGNRSLAAQVRLEF* |
| Ga0070701_110036842 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ESRSVAVRFDARNLPNHPTPGNPNLNLNTGTFGQISTKNGSRALAGQIRLEF* |
| Ga0066686_102012642 | 3300005446 | Soil | LTFRIDANNVLNHPTPGAPSLNINSGTFGQITTKTGSRSLQAQLHLDF* |
| Ga0066695_102831533 | 3300005553 | Soil | RVDARNVFNHPTPSDPNLNINSGTFGEINSKTGNRTLQSQIHFQF* |
| Ga0068857_1006108993 | 3300005577 | Corn Rhizosphere | RVDSNNVFNHPNPGDPNVNINAGTFGEIDSKTGSRSLAAQARFEF* |
| Ga0066706_110974703 | 3300005598 | Soil | RSVTLRIDASNILNHPTPGNPNLDINSGTFGEIQTKTGNRTLAAQLHLEF* |
| Ga0066706_114680031 | 3300005598 | Soil | RIGEGRSVAIRLDARNVLNHPTPGNPNLNINTGTFGQITTKTGSRSIAGQLRLEF* |
| Ga0066903_1039304081 | 3300005764 | Tropical Forest Soil | AESKTLTLRVDAHNVFNHPTPSDPNLNINSGTFGEINSKTGNRTLQGQIHFQF* |
| Ga0068851_105638201 | 3300005834 | Corn Rhizosphere | NHPNPVNPSLDLNAGNFGEINNKTGSRSLAAQVRFQF* |
| Ga0068863_1025917292 | 3300005841 | Switchgrass Rhizosphere | FNHPTPGNPNLDINSGTFGEISTKTGSRTLAGQLRFEF* |
| Ga0068862_1020315981 | 3300005844 | Switchgrass Rhizosphere | NLQKKIRIAESRSVAIRLDARNLFNHPTPANPNLNINAGTFGQITTKTGSRSLAGQIRVEF* |
| Ga0066651_107471142 | 3300006031 | Soil | KTIKIAESKTLTLRVDARNVFNHPTPVDPNLNMNSGTFGEINSKIGSRKLQGQIHFQF* |
| Ga0066651_107735941 | 3300006031 | Soil | DSNNVFNHPNPGNPNMNLNSGTFGPITTKTGNRSLAAQLRFVF* |
| Ga0066656_106337791 | 3300006034 | Soil | HPTPGNPNLSINAGTFGQITTKTGQRSLQALVRFDF* |
| Ga0066665_100219026 | 3300006796 | Soil | VDARNLFNHPIPGDPNLNINSGTFGEINSKTGNRRLQGQIHFQF* |
| Ga0066665_104558492 | 3300006796 | Soil | VRVDASNLFNHPTPGNPNLNINSGTFGEINAKTGFSTLAGQVRLEF* |
| Ga0066665_107557691 | 3300006796 | Soil | SKNLTLRVDARNLFNHPTPADPNLNMNSDTFGQINSKTGNRTLQGQIHFQF* |
| Ga0066660_114610681 | 3300006800 | Soil | ILKTVKIAESKNLTLRVDARNLFNHPIPADPNLNMNSLGTFGEINSKTGNRTLQGQIHFQF* |
| Ga0075428_1024644102 | 3300006844 | Populus Rhizosphere | GETRSVAIRLDARNIFNHPTPANPNLNINSGTFGQITNKTGSRTLAGQVRLEF* |
| Ga0075421_1010056443 | 3300006845 | Populus Rhizosphere | NHPTPGNPNLDINSGTFGEIQTKTGNRTLAGQLRLEF* |
| Ga0073934_107997882 | 3300006865 | Hot Spring Sediment | DAQNVFNHPIPGNPNVNMNSGTFGEINSKTGSRSLQAQLRFEF* |
| Ga0075434_1006272582 | 3300006871 | Populus Rhizosphere | PTPANPNLNINAGTFGQITTKIGSRSLAGQIRLEF* |
| Ga0075424_1006298271 | 3300006904 | Populus Rhizosphere | LTIRINASNILNHPTPGNPNLDINSGTFGEITTKTGSRTLSGQLRLEF* |
| Ga0099793_104455861 | 3300007258 | Vadose Zone Soil | KTIKIAESKTLTLRVDARNLFNHPTPVDPNLNINLGTFGEMNTKTGNRTLQGQIHFQF* |
| Ga0066710_1006311341 | 3300009012 | Grasslands Soil | NLFNHPTPSNPTLNINAGTFGQIMTKTGNRILQAQLRLDF |
| Ga0066710_1010329002 | 3300009012 | Grasslands Soil | VDARNVFNHPIPGDPNLNMNSGTFGEINSKTGNRRLQGQIHFQF |
| Ga0066710_1023660212 | 3300009012 | Grasslands Soil | IAESKTLTLRVDARNIFNHPTPGDPNLNINSGTFGEINSKTGSRKLQGQIHFQF |
| Ga0066710_1033179751 | 3300009012 | Grasslands Soil | MDAQNIFNHPTPDNPNFNISTGTFGQIMTKTGNRNLQTQIRLD |
| Ga0111539_115576951 | 3300009094 | Populus Rhizosphere | VDAQNVMNHPNPGAPNLNVNSGTFGEINSKTGNRTLQGQVRFQF* |
| Ga0111539_123835221 | 3300009094 | Populus Rhizosphere | KTLTFRVDAKNVFNHPTPADPNLNINSGTFGEINSKIGNRRLQGQIHFQF* |
| Ga0111539_132906811 | 3300009094 | Populus Rhizosphere | QIAESKKLTFRIDANNVLNHPTPGNPSLNINSGTLGQITTKTGSRSLQAQLHLDF* |
| Ga0066709_1003446483 | 3300009137 | Grasslands Soil | VDASNLFNHPTPGNPNLNINSGTFGEINTKTGFRTLAGQVRLEF* |
| Ga0066709_1027837552 | 3300009137 | Grasslands Soil | VQNSTKIGECRNLTLRIDAQNVFNHPTPGNPNLNINSGTFGEINSKTGNR |
| Ga0114129_115600242 | 3300009147 | Populus Rhizosphere | SFRLDAINVFNHPTPANPTLNINSGTFGQITSKNGNRSIAAQIRLDF* |
| Ga0105243_124311351 | 3300009148 | Miscanthus Rhizosphere | RLDARNILNHPTPANPNLNINTGTFGQITTKTGSRSLAGQIRLEF* |
| Ga0111538_128834052 | 3300009156 | Populus Rhizosphere | VAEAKNLTFRLDAQNVLNHPTPVLPNGSLNINSGTFGEVNNKIGNRSLQAQLRFDF* |
| Ga0075423_107117642 | 3300009162 | Populus Rhizosphere | KIAESKTLTLRVDAKNVFNHPTPADPNLNMNLGTFGEINSKIGNRRLQGQIHFQF* |
| Ga0075423_129413172 | 3300009162 | Populus Rhizosphere | AEGRSVTVRIDASNILNHPTPSNPNLDINSGTFGEISNKTGSRTLAGQVRLEF* |
| Ga0126382_100472271 | 3300010047 | Tropical Forest Soil | NLLKTIKIAESKTLTLRLDARNVFNHPTPADPNLNINSGTFGEINSKIGNRRLQGQIHFQF* |
| Ga0126382_120941171 | 3300010047 | Tropical Forest Soil | RIDAQNLFNHPNLGNPTLDINSGTFGQITTKTGFRTLAGQVRLEF* |
| Ga0134080_101117861 | 3300010333 | Grasslands Soil | RNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF* |
| Ga0134080_103356252 | 3300010333 | Grasslands Soil | DARNVFNHPIPGDPNLNMNSGTFGEINSKTGNRRLQGQIHFQF* |
| Ga0134071_103749492 | 3300010336 | Grasslands Soil | AESKTLTLRVDARNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQY* |
| Ga0134062_101484161 | 3300010337 | Grasslands Soil | KTIKIAESKTLTLRVDARNLFNHPIPGDPNLNINSGTFGEINYKTGNRRLQGQIHFQF* |
| Ga0126370_112764651 | 3300010358 | Tropical Forest Soil | ILNHPTPGNPNLNMNSGTFGQITTKTGNRSLAGQLRLELIS* |
| Ga0126370_115060092 | 3300010358 | Tropical Forest Soil | RIGESRSISIRIDTRNVLNHPTPGTPNLNINSGTFGQITTKTGSRTLAGQLRLEF* |
| Ga0126379_109560291 | 3300010366 | Tropical Forest Soil | NVFNHPTPGDPNLSINSGTFGEINSKTGNRTLQGQIHFQF* |
| Ga0126381_1045521221 | 3300010376 | Tropical Forest Soil | NSATIGGNLNLNMNVGTFGQITNKTGNRTLAGQIRIQF* |
| Ga0126383_113595951 | 3300010398 | Tropical Forest Soil | RIAESYRLTFRMDANNVLNHPTPGTPSLNINSGTFGQITTKTGSRTLQAQLHLDF* |
| Ga0126383_132181511 | 3300010398 | Tropical Forest Soil | SNILNHPTPGNPNLDINSGTFGEIQTKTGNRTLAGQLRLEF* |
| Ga0134121_118639252 | 3300010401 | Terrestrial Soil | ARNILNHPTPANPNLNINTGTFGQITTKTGSRSLAGQIRLEF* |
| Ga0150983_122303421 | 3300011120 | Forest Soil | KNLTLRVDARNLFNHPTPADPNLNINSGTFGEINSKIGNRTLQGQIHFQF* |
| Ga0150983_128193041 | 3300011120 | Forest Soil | SLKISETKNLTLRIDAQDLMNHSTPGAPNLTINSGTFGEINTKTGNRTLQGQIRLAF* |
| Ga0137427_100262281 | 3300011445 | Soil | TPGNPNLNINAGTFGQITTKNGNRTLAGQIRLEF* |
| Ga0137383_104053372 | 3300012199 | Vadose Zone Soil | LKTIKIAESKTLTLRVDARNLFNHPIPGDPNLNINSGTFGQINSKTGNRRLQGQIHFQF* |
| Ga0137383_109049771 | 3300012199 | Vadose Zone Soil | KTLTLRVDARNIFNHPTPGDPNLNINSGTFGQIDSKTGSRKLQGQIHFQF* |
| Ga0137377_115777401 | 3300012211 | Vadose Zone Soil | TLTLRVDARNVFNHPIPGDPNLNINSGTFGEINYKTGNRRLQGQIHFQF* |
| Ga0137387_112875781 | 3300012349 | Vadose Zone Soil | TPGNPNLNINSGTFGEINSKTGNRSLAGQLRFEF* |
| Ga0137371_113339541 | 3300012356 | Vadose Zone Soil | IAESKTLTLRVDARNVFNHPTPSDPNLNINSGTFGEINSKTGNRTLQGQIHFQF* |
| Ga0137361_100842894 | 3300012362 | Vadose Zone Soil | LFNHPIPGDPNLNMNSGTFGEINSKTGNRRLQGQIHFQF* |
| Ga0157286_104700131 | 3300012908 | Soil | NPGDPNLNINSGTFGEIDSKTGNRSLAGQVKFEF* |
| Ga0157290_101964172 | 3300012909 | Soil | SVSFRMDARNLFNHPTPAGPNLNINSGTFGQITNKTGSRALAAQIRLEF* |
| Ga0157301_104661561 | 3300012911 | Soil | MFNHPNPGNPSMNLNGGTFGQITTKTGNRSLAAQLRFEF* |
| Ga0137359_114735391 | 3300012923 | Vadose Zone Soil | SKTLTLRVDARNVFNHPTPGDPNLSMNSGTFGQINSKIGSRKLQGQIHFQF* |
| Ga0126369_103441613 | 3300012971 | Tropical Forest Soil | FNHPTPANPNLNINSGTFGQITSKTGSRTLAGQIRLEF* |
| Ga0134076_101568681 | 3300012976 | Grasslands Soil | LRVDARNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF* |
| Ga0134087_105363381 | 3300012977 | Grasslands Soil | ARNVFNHPTPGDPNMNMNSGTFGQIDYKTGSTKLQGQIHFQF* |
| Ga0157374_118053811 | 3300013296 | Miscanthus Rhizosphere | TPGNPNLNLNSGTFGQIATKTGSRTLAGQIRLEF* |
| Ga0157378_131980041 | 3300013297 | Miscanthus Rhizosphere | LNHPAPANPNLNINTGTFGQITSKTGSRVLAAQIHFDF* |
| Ga0157375_126909893 | 3300013308 | Miscanthus Rhizosphere | FNHPNPGDPNLNINSGTFGEIDSKTGNRSLAAQVRLEF* |
| Ga0157380_105384573 | 3300014326 | Switchgrass Rhizosphere | AIRLDARNIFNHPTPANPNLNINTGTFGQITTKTGSRTLAGQIRLEF* |
| Ga0173480_100237322 | 3300015200 | Soil | RMTEGTRLTVRIDSNNVFNHPNPGDPNLNINSGTFGEIDSKTGSRSLAGQVKFEF* |
| Ga0137409_109627991 | 3300015245 | Vadose Zone Soil | RVDARNVFNHPTPADPNLNMNSGTFGEINSKTGNRRLQGQIHFQF* |
| Ga0132258_116843871 | 3300015371 | Arabidopsis Rhizosphere | AQNLFNHPILGNPSLDINAGTFGQITTKTGFRTLAGQVRLEF* |
| Ga0132258_131409742 | 3300015371 | Arabidopsis Rhizosphere | DAQNVMNHPTPGAPNMNINSGTFGEISTKTGNRTLQGQIRFQF* |
| Ga0132256_1037295801 | 3300015372 | Arabidopsis Rhizosphere | LFNHPTPGNPNLNINSGTFGEIDTKTGSRILQAQMRFVF* |
| Ga0132257_1018721862 | 3300015373 | Arabidopsis Rhizosphere | ARNLFNHPTPDNPNLEINSGTFGEIRSKSGSRSLAAQIRLEF* |
| Ga0132255_1024600593 | 3300015374 | Arabidopsis Rhizosphere | IRLDARNILNHPTPGNPNLNINTGTFGQISIKTGSRTLAGQIRLEF* |
| Ga0134083_103226263 | 3300017659 | Grasslands Soil | ESKSLTIRLDTNNILNHPTPGNPNLDINAGTFGEITTKTGSRTLAGQIRLEF |
| Ga0066655_100499153 | 3300018431 | Grasslands Soil | FNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF |
| Ga0066655_106755391 | 3300018431 | Grasslands Soil | KNLTLRVDARNVFNHPTPSDPNLNINSGTFGEINSKTGNRTLQSQIHFQF |
| Ga0066667_118189342 | 3300018433 | Grasslands Soil | FNHPTPGDPNLNMNSGTFGQIDYKTGSRKLQGQIHFQF |
| Ga0066667_120832952 | 3300018433 | Grasslands Soil | DGRNIFNHPTPGNPNLNINSGTFGQITTKTGSRSLAGQVRLEF |
| Ga0066667_122594792 | 3300018433 | Grasslands Soil | RNVFNHPTPSDPNLNINSGTFGEINSKTGNRTLQGQIHFQF |
| Ga0210395_110077062 | 3300020582 | Soil | LQKKMRIGESRSLAFRLDTKNIFNHPTPGAPNLNINSGTFGQITTKTGNRSLAGQIRLEF |
| Ga0209640_113796592 | 3300025324 | Soil | DFDANVQKRIQVAESKNLTLRLDARNLFNHPTPDNPTLNINTGTFGEITAKTGSRTLAAQLRFEF |
| Ga0207682_100965342 | 3300025893 | Miscanthus Rhizosphere | NHPTPANPNLNLNSGTFGEINNKTGFRTLAGQVRLEF |
| Ga0207680_101860461 | 3300025903 | Switchgrass Rhizosphere | IFNHPTPGNPNLNLNSGTFGQIATKTGSRTLAGQIRLEF |
| Ga0207662_100728381 | 3300025918 | Switchgrass Rhizosphere | RLDARNIFNHPTPGNPNLNLNSGTFGQIATKTGSRTLAGQIRLEF |
| Ga0207701_111594391 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | FRMSESTRLTVRIDANNVFNHPNPGDPNLNINTGTFGEIDSKTGSRSLAGQLRLEF |
| Ga0207706_115060851 | 3300025933 | Corn Rhizosphere | SFRMDARNLFNHATPVGPNLNVNSGTFGQINNKTGSRALAAQIRLEF |
| Ga0207686_112163201 | 3300025934 | Miscanthus Rhizosphere | NIQKTFKTSETTNLTVRLDSNNVFNHPNPGNPNMNLNSGTFGQITTKTGNRSLAAQLRFV |
| Ga0207670_109434583 | 3300025936 | Switchgrass Rhizosphere | PTPANPNLNINTGTFGQITNKTGSRTLAGQLRLEF |
| Ga0207711_109303812 | 3300025941 | Switchgrass Rhizosphere | GTRLTVRIDSNNVFNHPNPGDPNLNINSGTFGEIDSKTGNRSLAGQVKFEF |
| Ga0207668_101785871 | 3300025972 | Switchgrass Rhizosphere | VFNHPNPGDPNVNINAGTFGEIDSKTGSRSLAAQVRFEF |
| Ga0207648_116241281 | 3300026089 | Miscanthus Rhizosphere | NVLNHPTPGNLPGTLTLTINTGTFGQITNKNGSRTLQAQLHLDF |
| Ga0209803_10555292 | 3300026332 | Soil | TLTLRVDARNIFNHPTPGDPNLNINSGTFGEINSKTGSRKLQGQIHFQF |
| Ga0209057_11913382 | 3300026342 | Soil | RVDARNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF |
| Ga0209376_13675821 | 3300026540 | Soil | VDARNIFNHPTPGDPNLNINSLTFGEINSKTGSRKLQGQIHFQF |
| Ga0209515_104630811 | 3300027835 | Groundwater | ILKTVKIAESKTLTLRVDARNVFNHPTPADPNLNMNSGTFGEINSKIGNRRLQGQIHFQF |
| Ga0209062_13189551 | 3300027965 | Surface Soil | ANLQKKMRIGESRSLAFRLDTRNIFNHPTPGAPNLNINSGTFGQIATKTGNRSLAGQIRLEF |
| Ga0170820_111979722 | 3300031446 | Forest Soil | FNHPNLGNPTLDMNSGTFGQITTKTGFRTLAGQVRFEF |
| Ga0310813_100559851 | 3300031716 | Soil | RSLAIRLDARNIFNHPTPGNPNLNINTGTFGQITTKTGSRTLAGQVRLEF |
| Ga0307472_1005656312 | 3300032205 | Hardwood Forest Soil | LKTIKIRESKTLTLRVDARNVFNHPTPADPNLNINSLATFGEINSKIGSRKLQGQIHFQF |
| ⦗Top⦘ |