| Basic Information | |
|---|---|
| Family ID | F068635 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.194 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 14.52 |
| PF00196 | GerE | 11.29 |
| PF02522 | Antibiotic_NAT | 10.48 |
| PF13715 | CarbopepD_reg_2 | 8.87 |
| PF01261 | AP_endonuc_2 | 7.26 |
| PF13620 | CarboxypepD_reg | 6.45 |
| PF11026 | DUF2721 | 4.84 |
| PF14322 | SusD-like_3 | 1.61 |
| PF04397 | LytTR | 0.81 |
| PF14310 | Fn3-like | 0.81 |
| PF17210 | SdrD_B | 0.81 |
| PF07589 | PEP-CTERM | 0.81 |
| PF03609 | EII-Sor | 0.81 |
| PF01120 | Alpha_L_fucos | 0.81 |
| PF01408 | GFO_IDH_MocA | 0.81 |
| PF13517 | FG-GAP_3 | 0.81 |
| PF04794 | YdjC | 0.81 |
| PF07715 | Plug | 0.81 |
| PF08309 | LVIVD | 0.81 |
| PF00728 | Glyco_hydro_20 | 0.81 |
| PF02837 | Glyco_hydro_2_N | 0.81 |
| PF06736 | TMEM175 | 0.81 |
| PF14437 | MafB19-deam | 0.81 |
| PF14054 | DUF4249 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 10.48 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3715 | Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific IIC component | Carbohydrate transport and metabolism [G] | 0.81 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.39 % |
| Unclassified | root | N/A | 1.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100265729 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300002558|JGI25385J37094_10172971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 578 | Open in IMG/M |
| 3300005176|Ga0066679_10610360 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005177|Ga0066690_10848337 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005181|Ga0066678_10576891 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005293|Ga0065715_10599858 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005446|Ga0066686_10716831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
| 3300005526|Ga0073909_10429871 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005546|Ga0070696_100077987 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
| 3300005553|Ga0066695_10199118 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005558|Ga0066698_10133805 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300005559|Ga0066700_10854994 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005576|Ga0066708_10669416 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005586|Ga0066691_10336933 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005598|Ga0066706_10682382 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005598|Ga0066706_10982174 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005844|Ga0068862_101444755 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300006031|Ga0066651_10062674 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300006034|Ga0066656_10789285 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006796|Ga0066665_10988198 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006800|Ga0066660_11400880 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006806|Ga0079220_11866466 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006871|Ga0075434_100032989 | All Organisms → cellular organisms → Bacteria | 5108 | Open in IMG/M |
| 3300007255|Ga0099791_10620303 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300007258|Ga0099793_10200512 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009012|Ga0066710_103167497 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009088|Ga0099830_10268624 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300009088|Ga0099830_10654861 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300009088|Ga0099830_11132562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 649 | Open in IMG/M |
| 3300009137|Ga0066709_101621411 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 924 | Open in IMG/M |
| 3300009137|Ga0066709_102908804 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009162|Ga0075423_11644778 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300009162|Ga0075423_12359581 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010047|Ga0126382_12324465 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010304|Ga0134088_10456576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300010323|Ga0134086_10501229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
| 3300010329|Ga0134111_10141096 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300010335|Ga0134063_10715239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300010336|Ga0134071_10002860 | All Organisms → cellular organisms → Bacteria | 6364 | Open in IMG/M |
| 3300010336|Ga0134071_10242989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 895 | Open in IMG/M |
| 3300010364|Ga0134066_10015210 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300011106|Ga0151489_1724498 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300011119|Ga0105246_11950065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 565 | Open in IMG/M |
| 3300011270|Ga0137391_10763064 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_70_33 | 799 | Open in IMG/M |
| 3300012199|Ga0137383_10517855 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300012201|Ga0137365_11201467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300012203|Ga0137399_11168321 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012204|Ga0137374_10145167 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300012205|Ga0137362_10332620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1315 | Open in IMG/M |
| 3300012208|Ga0137376_11752937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300012362|Ga0137361_10492239 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012386|Ga0134046_1068795 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300012917|Ga0137395_10392737 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300012918|Ga0137396_10064842 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300012918|Ga0137396_10919622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
| 3300012922|Ga0137394_10133220 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300012925|Ga0137419_10016360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4208 | Open in IMG/M |
| 3300012925|Ga0137419_10032822 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
| 3300012927|Ga0137416_12198647 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012929|Ga0137404_10597395 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300012961|Ga0164302_11136534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
| 3300012976|Ga0134076_10089906 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300013100|Ga0157373_11268315 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300013102|Ga0157371_10131705 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300013307|Ga0157372_12716181 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300013308|Ga0157375_12148689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300014154|Ga0134075_10241117 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 781 | Open in IMG/M |
| 3300014157|Ga0134078_10085217 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300015054|Ga0137420_1044037 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300015241|Ga0137418_10470245 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300015356|Ga0134073_10175246 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300015357|Ga0134072_10261082 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300015359|Ga0134085_10277858 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 733 | Open in IMG/M |
| 3300015373|Ga0132257_100505418 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300017654|Ga0134069_1024922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1812 | Open in IMG/M |
| 3300017656|Ga0134112_10214423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
| 3300017656|Ga0134112_10483787 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 522 | Open in IMG/M |
| 3300017657|Ga0134074_1293868 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300018063|Ga0184637_10490708 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300018482|Ga0066669_11952023 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300019885|Ga0193747_1055998 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300022694|Ga0222623_10117712 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300025910|Ga0207684_10546995 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 991 | Open in IMG/M |
| 3300025910|Ga0207684_10734875 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
| 3300025920|Ga0207649_11233352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300025920|Ga0207649_11610025 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025923|Ga0207681_11476794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300025937|Ga0207669_10054779 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300025940|Ga0207691_10678760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
| 3300025945|Ga0207679_11739533 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300025945|Ga0207679_11928465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 538 | Open in IMG/M |
| 3300025981|Ga0207640_10228021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1431 | Open in IMG/M |
| 3300026023|Ga0207677_10191315 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300026295|Ga0209234_1002637 | All Organisms → cellular organisms → Bacteria | 6812 | Open in IMG/M |
| 3300026300|Ga0209027_1214823 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300026301|Ga0209238_1013249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3197 | Open in IMG/M |
| 3300026306|Ga0209468_1079675 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026310|Ga0209239_1191461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300026313|Ga0209761_1068157 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300026317|Ga0209154_1259572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 593 | Open in IMG/M |
| 3300026323|Ga0209472_1014880 | All Organisms → cellular organisms → Bacteria | 3828 | Open in IMG/M |
| 3300026324|Ga0209470_1357334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
| 3300026328|Ga0209802_1295939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300026343|Ga0209159_1116136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1138 | Open in IMG/M |
| 3300026343|Ga0209159_1148340 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026523|Ga0209808_1167760 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300026528|Ga0209378_1115550 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300026529|Ga0209806_1337992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300026536|Ga0209058_1236228 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300026540|Ga0209376_1238216 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300026547|Ga0209156_10000218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 46940 | Open in IMG/M |
| 3300027748|Ga0209689_1082947 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300027765|Ga0209073_10029708 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300027831|Ga0209797_10464292 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027875|Ga0209283_10264877 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300031731|Ga0307405_12152790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
| 3300031740|Ga0307468_100584449 | Not Available | 908 | Open in IMG/M |
| 3300031938|Ga0308175_102132019 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031995|Ga0307409_101568290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 686 | Open in IMG/M |
| 3300032002|Ga0307416_100444702 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1347 | Open in IMG/M |
| 3300032002|Ga0307416_103145287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 552 | Open in IMG/M |
| 3300032205|Ga0307472_100065824 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300033417|Ga0214471_10129157 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1002657292 | 3300000364 | Soil | ARGYYTSKIGIHQEMEYKGNVLQNDYAGIDAGSV* |
| JGI25385J37094_101729712 | 3300002558 | Grasslands Soil | QELKRSTVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK*ASSGEPLT* |
| Ga0066679_106103601 | 3300005176 | Soil | EHFFQQLKGWTVRAYYTSKVGIHADEQYKGNVYQRGEFAGYDAT* |
| Ga0066690_108483371 | 3300005177 | Soil | EHFFQQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYSGYDAK* |
| Ga0066678_105768912 | 3300005181 | Soil | EHFFQELKRSTVRAYYSSKIGIHADQEYKGNVYQRGEFAGFDAQ* |
| Ga0065715_105998581 | 3300005293 | Miscanthus Rhizosphere | KTPAEKFFGYVKRSTARAYYTSAVGIHQDQHYKGNVVQPGEYAGMDPT* |
| Ga0066686_107168312 | 3300005446 | Soil | KTDAEKFFGEIKGSTIRTYYTSKIGIHDDQQYKGNVIQPGEYAGFDAT* |
| Ga0070698_1005006611 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SEPKTPAEQFFREIKGATIQAYYTSKVGIHDDQQYQGNVVQPGEFAGFDPA* |
| Ga0073909_104298711 | 3300005526 | Surface Soil | KFFRQIKGGTVRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT* |
| Ga0070696_1000779871 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FKEIKGATIGAYYTSRIGIHDDQQYKGNVIQTGEYAGYDAT* |
| Ga0066695_101991183 | 3300005553 | Soil | PAEHFFQELKRSTVRAYYTSKIGIHADQQYKGNVYQRGEYAGFDAK* |
| Ga0066698_101338054 | 3300005558 | Soil | RWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0066700_108549942 | 3300005559 | Soil | PAEHFFQQLKGWTVRAYYSSKVGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0066708_106694163 | 3300005576 | Soil | QFFKDLKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT* |
| Ga0066691_103369332 | 3300005586 | Soil | QQLKGWTVRAYYTSKVGIQADQRYKGNVYQRGEYAGYDAK* |
| Ga0066706_106823821 | 3300005598 | Soil | AEKFFRQIKGATIRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT* |
| Ga0066706_109821741 | 3300005598 | Soil | EIKGATVQAYYTSKVGIHDDQGYKGNVYQTGEYAGFDAP* |
| Ga0068862_1014447551 | 3300005844 | Switchgrass Rhizosphere | RAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPRDTVQ* |
| Ga0066651_100626741 | 3300006031 | Soil | LKWWTVFGYYTTKIGIHDDQQYKGNVLQTGEYAGYDAT* |
| Ga0066656_107892851 | 3300006034 | Soil | TIRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0066665_109881983 | 3300006796 | Soil | FFQELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0066660_114008801 | 3300006800 | Soil | QQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0079220_118664662 | 3300006806 | Agricultural Soil | TVHAYYTSKIGIHDDQRYKGNVYQTGDYAGYDAT* |
| Ga0075434_1000329891 | 3300006871 | Populus Rhizosphere | WWTVFGYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT* |
| Ga0099791_106203031 | 3300007255 | Vadose Zone Soil | SDAEKFFGVIKSGTVRAYYTSKIGIHDDQHYKGNVIQPGEYAGYDAT* |
| Ga0099793_102005121 | 3300007258 | Vadose Zone Soil | QDLKGWTVRAYYTSKVGIHADQEYKGNVYQRGDYAGFDAT* |
| Ga0066710_1031674971 | 3300009012 | Grasslands Soil | KRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK |
| Ga0099830_102686241 | 3300009088 | Vadose Zone Soil | TELKRWTVQGYYTSKIGIRLDQEYKGNVYQQGEYAGYDAK* |
| Ga0099830_106548611 | 3300009088 | Vadose Zone Soil | LKQWTARGYYTSKIGIHLDQEYKGNVYQRGDYAGYDAT* |
| Ga0099830_111325621 | 3300009088 | Vadose Zone Soil | FFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0066709_1016214113 | 3300009137 | Grasslands Soil | AEKFFRQIKSATIRAYYTSKTGIHDDQRYKGNVIQPGEYAGYDAT* |
| Ga0066709_1029088042 | 3300009137 | Grasslands Soil | KRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0075423_116447782 | 3300009162 | Populus Rhizosphere | PAQQFFGEIKGATIHAYYTSKIGIHDDQQYKGNVLQTGEFAGFDPE* |
| Ga0075423_123595812 | 3300009162 | Populus Rhizosphere | FKDLKWWTVFGYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT* |
| Ga0126382_123244652 | 3300010047 | Tropical Forest Soil | AAEKDPKTDAEKFFRQIKGSTINAYYSSKIGIHDDQRYKGNVIQPGDFAGFDAT* |
| Ga0134088_104565762 | 3300010304 | Grasslands Soil | TVRAYYTSKIGIHDDQQYKGNVYQQGEFAGFDAK* |
| Ga0134086_105012291 | 3300010323 | Grasslands Soil | SATIRAYYTSKTGIHDDQRYKGNVIQPGEYAGYDAT* |
| Ga0134111_101410961 | 3300010329 | Grasslands Soil | KGGTIRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0134063_107152392 | 3300010335 | Grasslands Soil | WTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0134071_100028601 | 3300010336 | Grasslands Soil | KGWTVRAYYTSKVGIHADQEYKGNVYQRGDYAGFDAT* |
| Ga0134071_102429891 | 3300010336 | Grasslands Soil | KFFGQIKGATIRAYYASKIGIHDDQRYKGNVIQPGEYAGYDAT* |
| Ga0134066_100152101 | 3300010364 | Grasslands Soil | MSGGKEGFFHELKAWTVRSYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK* |
| Ga0151489_17244982 | 3300011106 | Soil | TTRAYYTSKIGIHDDQHYKGNVYQSDAYAGFDAT* |
| Ga0105246_119500652 | 3300011119 | Miscanthus Rhizosphere | FGQLKGATVQAYYTSKIGIHVDQEYKGNVYQQGEYAGFDAT* |
| Ga0137391_107630642 | 3300011270 | Vadose Zone Soil | LFWQLMGRTLRGYYTSTVGIHFDQEYKGNVYQRGEFAGYDAK* |
| Ga0137383_105178553 | 3300012199 | Vadose Zone Soil | KGATVQAYYTSKVGIHDDQGYKGNVYQTGEYAGFDAP* |
| Ga0137365_112014672 | 3300012201 | Vadose Zone Soil | TVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK* |
| Ga0137399_111683213 | 3300012203 | Vadose Zone Soil | FREIKGSTMRAYYSSKIGIHDDQGYKGNVYQMGEFAGFDPA* |
| Ga0137374_101451676 | 3300012204 | Vadose Zone Soil | EIKSSTIRAYYTSKVGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0137362_103326201 | 3300012205 | Vadose Zone Soil | GRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0137376_117529372 | 3300012208 | Vadose Zone Soil | APERFFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0137361_104922393 | 3300012362 | Vadose Zone Soil | WTVRGYYTSKVGIHLDQEYKGNVYQRGEFAGYDAT* |
| Ga0134046_10687953 | 3300012386 | Grasslands Soil | APERFFGELKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0137395_103927371 | 3300012917 | Vadose Zone Soil | KFFREIKSSTIRAYYTSKVGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0137396_100648421 | 3300012918 | Vadose Zone Soil | DAEKFFGEIKGATIQAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0137396_109196222 | 3300012918 | Vadose Zone Soil | RTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0137394_101332205 | 3300012922 | Vadose Zone Soil | KGATIQAYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT* |
| Ga0137419_100163601 | 3300012925 | Vadose Zone Soil | ERFFGQLKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0137419_100328223 | 3300012925 | Vadose Zone Soil | KGSTIRAYYTSKVGIHDDQQYKGNVYQMGEYAGFDPA* |
| Ga0137416_121986471 | 3300012927 | Vadose Zone Soil | QLKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT* |
| Ga0137404_105973951 | 3300012929 | Vadose Zone Soil | RELKGWTVRGYYSSKIGIHLDQEYKGNVYQRGEFAGYDAT* |
| Ga0164302_111365341 | 3300012961 | Soil | TAPERFFGELKAWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0134076_100899061 | 3300012976 | Grasslands Soil | AKEGFFHELKAWTVRGYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK* |
| Ga0157373_112683151 | 3300013100 | Corn Rhizosphere | TVRAYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQ* |
| Ga0157371_101317053 | 3300013102 | Corn Rhizosphere | YRQLKGATVRAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPTDTVQ* |
| Ga0157372_127161812 | 3300013307 | Corn Rhizosphere | YYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQ* |
| Ga0157375_121486891 | 3300013308 | Miscanthus Rhizosphere | QLKGATVRAYYTSKVGIHDDQHYKGNVYQTGEYAGFEPTDAVQ* |
| Ga0134075_102411171 | 3300014154 | Grasslands Soil | ESDPKTDAEKFFGQIKGATIRAYYASKIGIHDDQRYKGNVIQPGEYAGYDAT* |
| Ga0134078_100852171 | 3300014157 | Grasslands Soil | FFQELKHWSARVYYSSKIGIHVDQQYKGNVYQRGEYAGYDAK* |
| Ga0137420_10440371 | 3300015054 | Vadose Zone Soil | IKSGTIRAYYTYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT* |
| Ga0137418_104702451 | 3300015241 | Vadose Zone Soil | RFFRELKGRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK* |
| Ga0134073_101752462 | 3300015356 | Grasslands Soil | EHFFQQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0134072_102610821 | 3300015357 | Grasslands Soil | ELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK* |
| Ga0134085_102778582 | 3300015359 | Grasslands Soil | TSPERFFNELKRSTVRAYYTSKIGIHDDQEYKGNVYQQGEFAGFDPK* |
| Ga0132257_1005054184 | 3300015373 | Arabidopsis Rhizosphere | DAEKFFKQIKGATIGAYYSSKIGIHDDQQYKGNVVQTGEYAGYDAT* |
| Ga0134069_10249222 | 3300017654 | Grasslands Soil | RVAVLTEMSGAKEGFFHELKAWTVRGYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK |
| Ga0134112_102144232 | 3300017656 | Grasslands Soil | AERFFRELKGWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT |
| Ga0134112_104837871 | 3300017656 | Grasslands Soil | DHFFQTVKHWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK |
| Ga0134074_12938681 | 3300017657 | Grasslands Soil | QTIRAYYTSKIGIHDDQQYKGNVYQTGEFAGFDPA |
| Ga0184637_104907081 | 3300018063 | Groundwater Sediment | REIKGATIQAYYTSKIGIHDDQQYKGNVYQTGDYAGSDPT |
| Ga0066669_119520231 | 3300018482 | Grasslands Soil | GEKDPKTPAEHFFQQLKGWTVRAYYTSKVGIQADQRYKGNVYQRGEYAGYDAK |
| Ga0193747_10559981 | 3300019885 | Soil | FAELKRTTVFAYYTSKIGIHTDQNYKGNVYQLAEYAGYDAT |
| Ga0222623_101177123 | 3300022694 | Groundwater Sediment | ATPESFFGEIKGSTIRAYYTSQVGIHDDQQYKGNVYQTGEFAGFDPT |
| Ga0207684_105469953 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KSGTVRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT |
| Ga0207684_107348751 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT |
| Ga0207649_112333521 | 3300025920 | Corn Rhizosphere | KGATVRAYYTSSIGIHNDQHYKGNVYQQGDYAGIEPTDQLQ |
| Ga0207649_116100252 | 3300025920 | Corn Rhizosphere | ATTRAYYTSKIGIHQDQHYKGNVFQTGEYAGLDPT |
| Ga0207681_114767941 | 3300025923 | Switchgrass Rhizosphere | PAEKFFGYVKRSTARAYYSSAVGIHQDQHYKGNVVQPGEYAGMDPT |
| Ga0207669_100547791 | 3300025937 | Miscanthus Rhizosphere | ATVRAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPTDTVQ |
| Ga0207691_106787602 | 3300025940 | Miscanthus Rhizosphere | RAYYTSKVGIHDDQHYKGNVYQTGEYAGFEPTDAVQ |
| Ga0207679_117395331 | 3300025945 | Corn Rhizosphere | LGGFFRQIKSATTRAYYTSKIGIHQDQHYKGNVFQTGEYAGLDPT |
| Ga0207679_119284652 | 3300025945 | Corn Rhizosphere | PAEKFFGYVKRSTARAYYTSAVGIHQDQHYKGNVVQPGEYAGYDAD |
| Ga0207640_102280211 | 3300025981 | Corn Rhizosphere | ERLQDGTLKGATVRAYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDAVQ |
| Ga0207677_101913153 | 3300026023 | Miscanthus Rhizosphere | QLKGATVRAYYTSSIGIHNDQHYKGNVYQQGDYAGIEPTDAVQ |
| Ga0209234_10026371 | 3300026295 | Grasslands Soil | WTVRGYYTSKIGIHVDQEYKGNVYQRGEFAGYDAT |
| Ga0209027_12148231 | 3300026300 | Grasslands Soil | LKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT |
| Ga0209238_10132491 | 3300026301 | Grasslands Soil | QQLKGWTVRAYYSSKVGIQADQRYKGNVYQRGEYAGYDAK |
| Ga0209468_10796753 | 3300026306 | Soil | ERFFRELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT |
| Ga0209239_11914613 | 3300026310 | Grasslands Soil | GELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK |
| Ga0209761_10681571 | 3300026313 | Grasslands Soil | PAEKFFGQIKGATIRTYYSSKIGIHDDQRYKGNVIQPGEYAGYDAT |
| Ga0209154_12595722 | 3300026317 | Soil | ADHFFQTLKHWTARAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK |
| Ga0209472_10148807 | 3300026323 | Soil | TPAERFFTELKRWTVRAYYTSKVGIQVDQEYKGNVYQRGEYAGYDAK |
| Ga0209470_13573341 | 3300026324 | Soil | STIQAYYTSKIGIHDDQHYKGNVIQPGEYAGYDAT |
| Ga0209802_12959392 | 3300026328 | Soil | RELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK |
| Ga0209159_11161361 | 3300026343 | Soil | FQELKRSTVRAYYTSKIGIHADQQYKGNVYQRGEYAGFDAK |
| Ga0209159_11483403 | 3300026343 | Soil | KGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK |
| Ga0209808_11677603 | 3300026523 | Soil | QFFKDLKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT |
| Ga0209378_11155503 | 3300026528 | Soil | KGWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT |
| Ga0209806_13379922 | 3300026529 | Soil | FFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK |
| Ga0209058_12362281 | 3300026536 | Soil | ELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK |
| Ga0209376_12382161 | 3300026540 | Soil | GTVRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT |
| Ga0209156_100002181 | 3300026547 | Soil | GWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT |
| Ga0209689_10829472 | 3300027748 | Soil | TPAEHFFQQLKGWTVRAYYSSKVGIHADQQYKGNVYQRGEYAGYDAK |
| Ga0209073_100297081 | 3300027765 | Agricultural Soil | EHFFQQLKGWTVRAYYTSKVGIHADQEYKGNVYQRGEYAGYDAT |
| Ga0209797_104642922 | 3300027831 | Wetland Sediment | DWTVRGYYTSKIGIHLDQEYKGNVYQPGEYAGFDAKGAA |
| Ga0209283_102648773 | 3300027875 | Vadose Zone Soil | FFREIKSPTIHAYYTSNIGIHDDQQYKGNVIQPGEYAGYDAT |
| Ga0307405_121527902 | 3300031731 | Rhizosphere | GQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT |
| Ga0307468_1005844491 | 3300031740 | Hardwood Forest Soil | NAYYTSKIGIHTDLKYQGNKYQEEYAGYDADYQGEL |
| Ga0308175_1021320191 | 3300031938 | Soil | AYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQQP |
| Ga0307409_1015682901 | 3300031995 | Rhizosphere | ERFFGQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT |
| Ga0307416_1004447021 | 3300032002 | Rhizosphere | ATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFEPT |
| Ga0307416_1031452871 | 3300032002 | Rhizosphere | FFGQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT |
| Ga0307472_1000658245 | 3300032205 | Hardwood Forest Soil | FFNELKRWTVEGYYTSSIGIHKDQEYKGNVVQPGEFAGYDAT |
| Ga0214471_101291571 | 3300033417 | Soil | KELKRRTVHGYYTSKIGIQLDQEYKGNVYQRGDYAGYDAT |
| ⦗Top⦘ |