NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068635

Metagenome / Metatranscriptome Family F068635

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068635
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 41 residues
Representative Sequence QQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK
Number of Associated Samples 110
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.387 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(24.194 % of family members)
Environment Ontology (ENVO) Unclassified
(45.968 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.613 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.94%    β-sheet: 0.00%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13302Acetyltransf_3 14.52
PF00196GerE 11.29
PF02522Antibiotic_NAT 10.48
PF13715CarbopepD_reg_2 8.87
PF01261AP_endonuc_2 7.26
PF13620CarboxypepD_reg 6.45
PF11026DUF2721 4.84
PF14322SusD-like_3 1.61
PF04397LytTR 0.81
PF14310Fn3-like 0.81
PF17210SdrD_B 0.81
PF07589PEP-CTERM 0.81
PF03609EII-Sor 0.81
PF01120Alpha_L_fucos 0.81
PF01408GFO_IDH_MocA 0.81
PF13517FG-GAP_3 0.81
PF04794YdjC 0.81
PF07715Plug 0.81
PF08309LVIVD 0.81
PF00728Glyco_hydro_20 0.81
PF02837Glyco_hydro_2_N 0.81
PF06736TMEM175 0.81
PF14437MafB19-deam 0.81
PF14054DUF4249 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2746Aminoglycoside N3'-acetyltransferaseDefense mechanisms [V] 10.48
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.81
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 0.81
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.81
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.81
COG3669Alpha-L-fucosidaseCarbohydrate transport and metabolism [G] 0.81
COG3715Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific IIC componentCarbohydrate transport and metabolism [G] 0.81
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.39 %
UnclassifiedrootN/A1.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100265729All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300002558|JGI25385J37094_10172971All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes578Open in IMG/M
3300005176|Ga0066679_10610360All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005177|Ga0066690_10848337All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005181|Ga0066678_10576891All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005293|Ga0065715_10599858All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300005446|Ga0066686_10716831All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium673Open in IMG/M
3300005526|Ga0073909_10429871All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005546|Ga0070696_100077987All Organisms → cellular organisms → Bacteria2342Open in IMG/M
3300005553|Ga0066695_10199118All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300005558|Ga0066698_10133805All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300005559|Ga0066700_10854994All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005576|Ga0066708_10669416All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300005586|Ga0066691_10336933All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005598|Ga0066706_10682382All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005598|Ga0066706_10982174All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005844|Ga0068862_101444755All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300006031|Ga0066651_10062674All Organisms → cellular organisms → Bacteria1775Open in IMG/M
3300006034|Ga0066656_10789285All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006796|Ga0066665_10988198All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300006800|Ga0066660_11400880All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300006806|Ga0079220_11866466All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006871|Ga0075434_100032989All Organisms → cellular organisms → Bacteria5108Open in IMG/M
3300007255|Ga0099791_10620303All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300007258|Ga0099793_10200512All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300009012|Ga0066710_103167497All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300009088|Ga0099830_10268624All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300009088|Ga0099830_10654861All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300009088|Ga0099830_11132562All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium649Open in IMG/M
3300009137|Ga0066709_101621411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae924Open in IMG/M
3300009137|Ga0066709_102908804All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009162|Ga0075423_11644778All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300009162|Ga0075423_12359581All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300010047|Ga0126382_12324465All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010304|Ga0134088_10456576All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium627Open in IMG/M
3300010323|Ga0134086_10501229All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes503Open in IMG/M
3300010329|Ga0134111_10141096All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300010335|Ga0134063_10715239All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300010336|Ga0134071_10002860All Organisms → cellular organisms → Bacteria6364Open in IMG/M
3300010336|Ga0134071_10242989All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes895Open in IMG/M
3300010364|Ga0134066_10015210All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300011106|Ga0151489_1724498All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300011119|Ga0105246_11950065All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis565Open in IMG/M
3300011270|Ga0137391_10763064All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_70_33799Open in IMG/M
3300012199|Ga0137383_10517855All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300012201|Ga0137365_11201467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300012203|Ga0137399_11168321All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012204|Ga0137374_10145167All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300012205|Ga0137362_10332620All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1315Open in IMG/M
3300012208|Ga0137376_11752937All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium512Open in IMG/M
3300012362|Ga0137361_10492239All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300012386|Ga0134046_1068795All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300012917|Ga0137395_10392737All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300012918|Ga0137396_10064842All Organisms → cellular organisms → Bacteria2540Open in IMG/M
3300012918|Ga0137396_10919622All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium640Open in IMG/M
3300012922|Ga0137394_10133220All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300012925|Ga0137419_10016360All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4208Open in IMG/M
3300012925|Ga0137419_10032822All Organisms → cellular organisms → Bacteria3199Open in IMG/M
3300012927|Ga0137416_12198647All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300012929|Ga0137404_10597395All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300012961|Ga0164302_11136534All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium619Open in IMG/M
3300012976|Ga0134076_10089906All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300013100|Ga0157373_11268315All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300013102|Ga0157371_10131705All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300013307|Ga0157372_12716181All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300013308|Ga0157375_12148689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300014154|Ga0134075_10241117All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes781Open in IMG/M
3300014157|Ga0134078_10085217All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300015054|Ga0137420_1044037All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300015241|Ga0137418_10470245All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300015356|Ga0134073_10175246All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300015357|Ga0134072_10261082All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300015359|Ga0134085_10277858All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium733Open in IMG/M
3300015373|Ga0132257_100505418All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300017654|Ga0134069_1024922All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1812Open in IMG/M
3300017656|Ga0134112_10214423All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium755Open in IMG/M
3300017656|Ga0134112_10483787All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes522Open in IMG/M
3300017657|Ga0134074_1293868All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300018063|Ga0184637_10490708All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300018482|Ga0066669_11952023All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300019885|Ga0193747_1055998All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300022694|Ga0222623_10117712All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300025910|Ga0207684_10546995All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes991Open in IMG/M
3300025910|Ga0207684_10734875All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium837Open in IMG/M
3300025920|Ga0207649_11233352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300025920|Ga0207649_11610025All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300025923|Ga0207681_11476794All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium570Open in IMG/M
3300025937|Ga0207669_10054779All Organisms → cellular organisms → Bacteria2411Open in IMG/M
3300025940|Ga0207691_10678760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium869Open in IMG/M
3300025945|Ga0207679_11739533All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300025945|Ga0207679_11928465All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium538Open in IMG/M
3300025981|Ga0207640_10228021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1431Open in IMG/M
3300026023|Ga0207677_10191315All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300026295|Ga0209234_1002637All Organisms → cellular organisms → Bacteria6812Open in IMG/M
3300026300|Ga0209027_1214823All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300026301|Ga0209238_1013249All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3197Open in IMG/M
3300026306|Ga0209468_1079675All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300026310|Ga0209239_1191461All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium752Open in IMG/M
3300026313|Ga0209761_1068157All Organisms → cellular organisms → Bacteria1901Open in IMG/M
3300026317|Ga0209154_1259572All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes593Open in IMG/M
3300026323|Ga0209472_1014880All Organisms → cellular organisms → Bacteria3828Open in IMG/M
3300026324|Ga0209470_1357334All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes523Open in IMG/M
3300026328|Ga0209802_1295939All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300026343|Ga0209159_1116136All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1138Open in IMG/M
3300026343|Ga0209159_1148340All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300026523|Ga0209808_1167760All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300026528|Ga0209378_1115550All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300026529|Ga0209806_1337992All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300026536|Ga0209058_1236228All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300026540|Ga0209376_1238216All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300026547|Ga0209156_10000218All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes46940Open in IMG/M
3300027748|Ga0209689_1082947All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300027765|Ga0209073_10029708All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300027831|Ga0209797_10464292All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027875|Ga0209283_10264877All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300031731|Ga0307405_12152790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes501Open in IMG/M
3300031740|Ga0307468_100584449Not Available908Open in IMG/M
3300031938|Ga0308175_102132019All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300031995|Ga0307409_101568290All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes686Open in IMG/M
3300032002|Ga0307416_100444702All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1347Open in IMG/M
3300032002|Ga0307416_103145287All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes552Open in IMG/M
3300032205|Ga0307472_100065824All Organisms → cellular organisms → Bacteria2340Open in IMG/M
3300033417|Ga0214471_10129157All Organisms → cellular organisms → Bacteria2081Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil24.19%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil14.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.23%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.61%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10026572923300000364SoilARGYYTSKIGIHQEMEYKGNVLQNDYAGIDAGSV*
JGI25385J37094_1017297123300002558Grasslands SoilQELKRSTVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK*ASSGEPLT*
Ga0066679_1061036013300005176SoilEHFFQQLKGWTVRAYYTSKVGIHADEQYKGNVYQRGEFAGYDAT*
Ga0066690_1084833713300005177SoilEHFFQQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYSGYDAK*
Ga0066678_1057689123300005181SoilEHFFQELKRSTVRAYYSSKIGIHADQEYKGNVYQRGEFAGFDAQ*
Ga0065715_1059985813300005293Miscanthus RhizosphereKTPAEKFFGYVKRSTARAYYTSAVGIHQDQHYKGNVVQPGEYAGMDPT*
Ga0066686_1071683123300005446SoilKTDAEKFFGEIKGSTIRTYYTSKIGIHDDQQYKGNVIQPGEYAGFDAT*
Ga0070698_10050066113300005471Corn, Switchgrass And Miscanthus RhizosphereSEPKTPAEQFFREIKGATIQAYYTSKVGIHDDQQYQGNVVQPGEFAGFDPA*
Ga0073909_1042987113300005526Surface SoilKFFRQIKGGTVRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT*
Ga0070696_10007798713300005546Corn, Switchgrass And Miscanthus RhizosphereFKEIKGATIGAYYTSRIGIHDDQQYKGNVIQTGEYAGYDAT*
Ga0066695_1019911833300005553SoilPAEHFFQELKRSTVRAYYTSKIGIHADQQYKGNVYQRGEYAGFDAK*
Ga0066698_1013380543300005558SoilRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK*
Ga0066700_1085499423300005559SoilPAEHFFQQLKGWTVRAYYSSKVGIHADQQYKGNVYQRGEYAGYDAK*
Ga0066708_1066941633300005576SoilQFFKDLKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT*
Ga0066691_1033693323300005586SoilQQLKGWTVRAYYTSKVGIQADQRYKGNVYQRGEYAGYDAK*
Ga0066706_1068238213300005598SoilAEKFFRQIKGATIRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT*
Ga0066706_1098217413300005598SoilEIKGATVQAYYTSKVGIHDDQGYKGNVYQTGEYAGFDAP*
Ga0068862_10144475513300005844Switchgrass RhizosphereRAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPRDTVQ*
Ga0066651_1006267413300006031SoilLKWWTVFGYYTTKIGIHDDQQYKGNVLQTGEYAGYDAT*
Ga0066656_1078928513300006034SoilTIRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0066665_1098819833300006796SoilFFQELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK*
Ga0066660_1140088013300006800SoilQQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK*
Ga0079220_1186646623300006806Agricultural SoilTVHAYYTSKIGIHDDQRYKGNVYQTGDYAGYDAT*
Ga0075434_10003298913300006871Populus RhizosphereWWTVFGYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT*
Ga0099791_1062030313300007255Vadose Zone SoilSDAEKFFGVIKSGTVRAYYTSKIGIHDDQHYKGNVIQPGEYAGYDAT*
Ga0099793_1020051213300007258Vadose Zone SoilQDLKGWTVRAYYTSKVGIHADQEYKGNVYQRGDYAGFDAT*
Ga0066710_10316749713300009012Grasslands SoilKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK
Ga0099830_1026862413300009088Vadose Zone SoilTELKRWTVQGYYTSKIGIRLDQEYKGNVYQQGEYAGYDAK*
Ga0099830_1065486113300009088Vadose Zone SoilLKQWTARGYYTSKIGIHLDQEYKGNVYQRGDYAGYDAT*
Ga0099830_1113256213300009088Vadose Zone SoilFFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0066709_10162141133300009137Grasslands SoilAEKFFRQIKSATIRAYYTSKTGIHDDQRYKGNVIQPGEYAGYDAT*
Ga0066709_10290880423300009137Grasslands SoilKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK*
Ga0075423_1164477823300009162Populus RhizospherePAQQFFGEIKGATIHAYYTSKIGIHDDQQYKGNVLQTGEFAGFDPE*
Ga0075423_1235958123300009162Populus RhizosphereFKDLKWWTVFGYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT*
Ga0126382_1232446523300010047Tropical Forest SoilAAEKDPKTDAEKFFRQIKGSTINAYYSSKIGIHDDQRYKGNVIQPGDFAGFDAT*
Ga0134088_1045657623300010304Grasslands SoilTVRAYYTSKIGIHDDQQYKGNVYQQGEFAGFDAK*
Ga0134086_1050122913300010323Grasslands SoilSATIRAYYTSKTGIHDDQRYKGNVIQPGEYAGYDAT*
Ga0134111_1014109613300010329Grasslands SoilKGGTIRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0134063_1071523923300010335Grasslands SoilWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0134071_1000286013300010336Grasslands SoilKGWTVRAYYTSKVGIHADQEYKGNVYQRGDYAGFDAT*
Ga0134071_1024298913300010336Grasslands SoilKFFGQIKGATIRAYYASKIGIHDDQRYKGNVIQPGEYAGYDAT*
Ga0134066_1001521013300010364Grasslands SoilMSGGKEGFFHELKAWTVRSYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK*
Ga0151489_172449823300011106SoilTTRAYYTSKIGIHDDQHYKGNVYQSDAYAGFDAT*
Ga0105246_1195006523300011119Miscanthus RhizosphereFGQLKGATVQAYYTSKIGIHVDQEYKGNVYQQGEYAGFDAT*
Ga0137391_1076306423300011270Vadose Zone SoilLFWQLMGRTLRGYYTSTVGIHFDQEYKGNVYQRGEFAGYDAK*
Ga0137383_1051785533300012199Vadose Zone SoilKGATVQAYYTSKVGIHDDQGYKGNVYQTGEYAGFDAP*
Ga0137365_1120146723300012201Vadose Zone SoilTVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK*
Ga0137399_1116832133300012203Vadose Zone SoilFREIKGSTMRAYYSSKIGIHDDQGYKGNVYQMGEFAGFDPA*
Ga0137374_1014516763300012204Vadose Zone SoilEIKSSTIRAYYTSKVGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0137362_1033262013300012205Vadose Zone SoilGRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0137376_1175293723300012208Vadose Zone SoilAPERFFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0137361_1049223933300012362Vadose Zone SoilWTVRGYYTSKVGIHLDQEYKGNVYQRGEFAGYDAT*
Ga0134046_106879533300012386Grasslands SoilAPERFFGELKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0137395_1039273713300012917Vadose Zone SoilKFFREIKSSTIRAYYTSKVGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0137396_1006484213300012918Vadose Zone SoilDAEKFFGEIKGATIQAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0137396_1091962223300012918Vadose Zone SoilRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0137394_1013322053300012922Vadose Zone SoilKGATIQAYYTSKIGIHDDQQYKGNVYQTGDYAGYDAT*
Ga0137419_1001636013300012925Vadose Zone SoilERFFGQLKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0137419_1003282233300012925Vadose Zone SoilKGSTIRAYYTSKVGIHDDQQYKGNVYQMGEYAGFDPA*
Ga0137416_1219864713300012927Vadose Zone SoilQLKGWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT*
Ga0137404_1059739513300012929Vadose Zone SoilRELKGWTVRGYYSSKIGIHLDQEYKGNVYQRGEFAGYDAT*
Ga0164302_1113653413300012961SoilTAPERFFGELKAWTVRGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0134076_1008990613300012976Grasslands SoilAKEGFFHELKAWTVRGYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK*
Ga0157373_1126831513300013100Corn RhizosphereTVRAYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQ*
Ga0157371_1013170533300013102Corn RhizosphereYRQLKGATVRAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPTDTVQ*
Ga0157372_1271618123300013307Corn RhizosphereYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQ*
Ga0157375_1214868913300013308Miscanthus RhizosphereQLKGATVRAYYTSKVGIHDDQHYKGNVYQTGEYAGFEPTDAVQ*
Ga0134075_1024111713300014154Grasslands SoilESDPKTDAEKFFGQIKGATIRAYYASKIGIHDDQRYKGNVIQPGEYAGYDAT*
Ga0134078_1008521713300014157Grasslands SoilFFQELKHWSARVYYSSKIGIHVDQQYKGNVYQRGEYAGYDAK*
Ga0137420_104403713300015054Vadose Zone SoilIKSGTIRAYYTYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT*
Ga0137418_1047024513300015241Vadose Zone SoilRFFRELKGRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK*
Ga0134073_1017524623300015356Grasslands SoilEHFFQQLKGWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGYDAK*
Ga0134072_1026108213300015357Grasslands SoilELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK*
Ga0134085_1027785823300015359Grasslands SoilTSPERFFNELKRSTVRAYYTSKIGIHDDQEYKGNVYQQGEFAGFDPK*
Ga0132257_10050541843300015373Arabidopsis RhizosphereDAEKFFKQIKGATIGAYYSSKIGIHDDQQYKGNVVQTGEYAGYDAT*
Ga0134069_102492223300017654Grasslands SoilRVAVLTEMSGAKEGFFHELKAWTVRGYYTSKIGIHVDQQYKGNVYQRGEYAGYDAK
Ga0134112_1021442323300017656Grasslands SoilAERFFRELKGWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT
Ga0134112_1048378713300017656Grasslands SoilDHFFQTVKHWTVRAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK
Ga0134074_129386813300017657Grasslands SoilQTIRAYYTSKIGIHDDQQYKGNVYQTGEFAGFDPA
Ga0184637_1049070813300018063Groundwater SedimentREIKGATIQAYYTSKIGIHDDQQYKGNVYQTGDYAGSDPT
Ga0066669_1195202313300018482Grasslands SoilGEKDPKTPAEHFFQQLKGWTVRAYYTSKVGIQADQRYKGNVYQRGEYAGYDAK
Ga0193747_105599813300019885SoilFAELKRTTVFAYYTSKIGIHTDQNYKGNVYQLAEYAGYDAT
Ga0222623_1011771233300022694Groundwater SedimentATPESFFGEIKGSTIRAYYTSQVGIHDDQQYKGNVYQTGEFAGFDPT
Ga0207684_1054699533300025910Corn, Switchgrass And Miscanthus RhizosphereKSGTVRAYYTSKIGIHDDQQYKGNVIQPGDYAGYDAT
Ga0207684_1073487513300025910Corn, Switchgrass And Miscanthus RhizosphereGRTAHAYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT
Ga0207649_1123335213300025920Corn RhizosphereKGATVRAYYTSSIGIHNDQHYKGNVYQQGDYAGIEPTDQLQ
Ga0207649_1161002523300025920Corn RhizosphereATTRAYYTSKIGIHQDQHYKGNVFQTGEYAGLDPT
Ga0207681_1147679413300025923Switchgrass RhizospherePAEKFFGYVKRSTARAYYSSAVGIHQDQHYKGNVVQPGEYAGMDPT
Ga0207669_1005477913300025937Miscanthus RhizosphereATVRAYYTSSIGIHTDQKYKGNVYQQGDYAGVEPTDTVQ
Ga0207691_1067876023300025940Miscanthus RhizosphereRAYYTSKVGIHDDQHYKGNVYQTGEYAGFEPTDAVQ
Ga0207679_1173953313300025945Corn RhizosphereLGGFFRQIKSATTRAYYTSKIGIHQDQHYKGNVFQTGEYAGLDPT
Ga0207679_1192846523300025945Corn RhizospherePAEKFFGYVKRSTARAYYTSAVGIHQDQHYKGNVVQPGEYAGYDAD
Ga0207640_1022802113300025981Corn RhizosphereERLQDGTLKGATVRAYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDAVQ
Ga0207677_1019131533300026023Miscanthus RhizosphereQLKGATVRAYYTSSIGIHNDQHYKGNVYQQGDYAGIEPTDAVQ
Ga0209234_100263713300026295Grasslands SoilWTVRGYYTSKIGIHVDQEYKGNVYQRGEFAGYDAT
Ga0209027_121482313300026300Grasslands SoilLKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT
Ga0209238_101324913300026301Grasslands SoilQQLKGWTVRAYYSSKVGIQADQRYKGNVYQRGEYAGYDAK
Ga0209468_107967533300026306SoilERFFRELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT
Ga0209239_119146133300026310Grasslands SoilGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK
Ga0209761_106815713300026313Grasslands SoilPAEKFFGQIKGATIRTYYSSKIGIHDDQRYKGNVIQPGEYAGYDAT
Ga0209154_125957223300026317SoilADHFFQTLKHWTARAYYTSKVGIHADQQYKGNVYQRGEYAGFDAK
Ga0209472_101488073300026323SoilTPAERFFTELKRWTVRAYYTSKVGIQVDQEYKGNVYQRGEYAGYDAK
Ga0209470_135733413300026324SoilSTIQAYYTSKIGIHDDQHYKGNVIQPGEYAGYDAT
Ga0209802_129593923300026328SoilRELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK
Ga0209159_111613613300026343SoilFQELKRSTVRAYYTSKIGIHADQQYKGNVYQRGEYAGFDAK
Ga0209159_114834033300026343SoilKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK
Ga0209808_116776033300026523SoilQFFKDLKWQTIYAYYTSKIGIHDDQQYKGNVYQTGEYAGFDAT
Ga0209378_111555033300026528SoilKGWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT
Ga0209806_133799223300026529SoilFFGELKGWTARGYYTSKIGIHLDQEYKGNVYQRGEFAGYDAK
Ga0209058_123622813300026536SoilELKRWTVRSYYTSKIGIHADQQYKGNVYQRGEYAGYDAK
Ga0209376_123821613300026540SoilGTVRAYYTSKIGIHDDQQYKGNVIQPGEYAGYDAT
Ga0209156_1000021813300026547SoilGWTARSYYTSKIGIHLDQEYKGNVYQRGEFAGYDAT
Ga0209689_108294723300027748SoilTPAEHFFQQLKGWTVRAYYSSKVGIHADQQYKGNVYQRGEYAGYDAK
Ga0209073_1002970813300027765Agricultural SoilEHFFQQLKGWTVRAYYTSKVGIHADQEYKGNVYQRGEYAGYDAT
Ga0209797_1046429223300027831Wetland SedimentDWTVRGYYTSKIGIHLDQEYKGNVYQPGEYAGFDAKGAA
Ga0209283_1026487733300027875Vadose Zone SoilFFREIKSPTIHAYYTSNIGIHDDQQYKGNVIQPGEYAGYDAT
Ga0307405_1215279023300031731RhizosphereGQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT
Ga0307468_10058444913300031740Hardwood Forest SoilNAYYTSKIGIHTDLKYQGNKYQEEYAGYDADYQGEL
Ga0308175_10213201913300031938SoilAYYTSSIGIHDDQHYKGNVYQQGDYAGIEPTDQLQQP
Ga0307409_10156829013300031995RhizosphereERFFGQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT
Ga0307416_10044470213300032002RhizosphereATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFEPT
Ga0307416_10314528713300032002RhizosphereFFGQIKGATAQAYYLSRIGIHQDQQYKGNVYQTGEYAGFDPT
Ga0307472_10006582453300032205Hardwood Forest SoilFFNELKRWTVEGYYTSSIGIHKDQEYKGNVVQPGEFAGYDAT
Ga0214471_1012915713300033417SoilKELKRRTVHGYYTSKIGIQLDQEYKGNVYQRGDYAGYDAT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.