Basic Information | |
---|---|
Family ID | F068573 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 47 residues |
Representative Sequence | MDSKPLTQEEIMKAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKDVH |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 87.10 % |
% of genes near scaffold ends (potentially truncated) | 25.00 % |
% of genes from short scaffolds (< 2000 bps) | 70.97 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (72.581 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (67.742 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.065 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.89% β-sheet: 0.00% Coil/Unstructured: 67.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF07486 | Hydrolase_2 | 33.87 |
PF11753 | DUF3310 | 18.55 |
PF13482 | RNase_H_2 | 4.84 |
PF04404 | ERF | 4.03 |
PF09588 | YqaJ | 3.23 |
PF05050 | Methyltransf_21 | 1.61 |
PF06378 | DUF1071 | 1.61 |
PF13481 | AAA_25 | 0.81 |
PF01521 | Fe-S_biosyn | 0.81 |
PF13392 | HNH_3 | 0.81 |
PF07102 | YbcO | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 33.87 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.35 % |
Unclassified | root | N/A | 5.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001851|RCM31_10169558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300002161|JGI24766J26685_10021703 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
3300003277|JGI25908J49247_10001426 | All Organisms → Viruses | 7585 | Open in IMG/M |
3300003277|JGI25908J49247_10006629 | All Organisms → Viruses → Predicted Viral | 3684 | Open in IMG/M |
3300003393|JGI25909J50240_1017172 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
3300003393|JGI25909J50240_1053825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 833 | Open in IMG/M |
3300003393|JGI25909J50240_1089725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300003394|JGI25907J50239_1028757 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300003394|JGI25907J50239_1040937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300003411|JGI25911J50253_10067112 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300003411|JGI25911J50253_10157647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300004126|Ga0066179_10248659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300004240|Ga0007787_10009482 | All Organisms → cellular organisms → Bacteria | 3845 | Open in IMG/M |
3300005528|Ga0068872_10768158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300005580|Ga0049083_10066072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300005581|Ga0049081_10005062 | All Organisms → cellular organisms → Bacteria | 4978 | Open in IMG/M |
3300005581|Ga0049081_10015654 | All Organisms → Viruses → Predicted Viral | 2867 | Open in IMG/M |
3300005581|Ga0049081_10133546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300005582|Ga0049080_10023676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2144 | Open in IMG/M |
3300005582|Ga0049080_10041508 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
3300005582|Ga0049080_10112339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 923 | Open in IMG/M |
3300005805|Ga0079957_1022990 | Not Available | 4292 | Open in IMG/M |
3300005805|Ga0079957_1104012 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
3300006805|Ga0075464_10424663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300007550|Ga0102880_1211259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300007639|Ga0102865_1060272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300007972|Ga0105745_1148584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300007974|Ga0105747_1193948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300008107|Ga0114340_1001514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25368 | Open in IMG/M |
3300008107|Ga0114340_1007130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13372 | Open in IMG/M |
3300008107|Ga0114340_1017205 | All Organisms → Viruses → Predicted Viral | 3447 | Open in IMG/M |
3300008107|Ga0114340_1037839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2172 | Open in IMG/M |
3300008107|Ga0114340_1163094 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300008110|Ga0114343_1076106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2129 | Open in IMG/M |
3300008110|Ga0114343_1129757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
3300008114|Ga0114347_1009981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4831 | Open in IMG/M |
3300008120|Ga0114355_1076421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1399 | Open in IMG/M |
3300008120|Ga0114355_1128551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300008265|Ga0114361_1092855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300008266|Ga0114363_1193242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300008448|Ga0114876_1117621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1025 | Open in IMG/M |
3300008448|Ga0114876_1228586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300008450|Ga0114880_1264567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 526 | Open in IMG/M |
3300009068|Ga0114973_10001276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18901 | Open in IMG/M |
3300009068|Ga0114973_10249996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300009068|Ga0114973_10333452 | Not Available | 803 | Open in IMG/M |
3300009068|Ga0114973_10412385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300009155|Ga0114968_10463558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300009158|Ga0114977_10024913 | All Organisms → Viruses → Predicted Viral | 3748 | Open in IMG/M |
3300009159|Ga0114978_10136110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
3300009159|Ga0114978_10627904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009163|Ga0114970_10150343 | All Organisms → Viruses → Predicted Viral | 1400 | Open in IMG/M |
3300009164|Ga0114975_10192305 | All Organisms → Viruses → Predicted Viral | 1155 | Open in IMG/M |
3300009164|Ga0114975_10379414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300009183|Ga0114974_10001072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21870 | Open in IMG/M |
3300009183|Ga0114974_10028398 | All Organisms → Viruses → Predicted Viral | 3889 | Open in IMG/M |
3300009419|Ga0114982_1093249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300012017|Ga0153801_1069276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300012282|Ga0157136_1009505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10091749 | All Organisms → Viruses → Predicted Viral | 2169 | Open in IMG/M |
3300013295|Ga0170791_15874891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300017722|Ga0181347_1164589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300017777|Ga0181357_1073370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1315 | Open in IMG/M |
3300017777|Ga0181357_1209751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300017780|Ga0181346_1171408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 799 | Open in IMG/M |
3300017785|Ga0181355_1234815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300017785|Ga0181355_1235580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300019784|Ga0181359_1000522 | All Organisms → Viruses | 8718 | Open in IMG/M |
3300019784|Ga0181359_1002276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5516 | Open in IMG/M |
3300019784|Ga0181359_1009610 | Not Available | 3397 | Open in IMG/M |
3300019784|Ga0181359_1064532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
3300019784|Ga0181359_1133521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300019784|Ga0181359_1207017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300020172|Ga0211729_10575832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4513 | Open in IMG/M |
3300020205|Ga0211731_10286808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300021438|Ga0213920_1041230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300021963|Ga0222712_10084875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2253 | Open in IMG/M |
3300021963|Ga0222712_10519052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300022190|Ga0181354_1149239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300022407|Ga0181351_1140941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 879 | Open in IMG/M |
3300023179|Ga0214923_10606837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
3300023184|Ga0214919_10052155 | All Organisms → Viruses → Predicted Viral | 3898 | Open in IMG/M |
3300024298|Ga0255178_1003600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3493 | Open in IMG/M |
3300024496|Ga0255151_1055475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 646 | Open in IMG/M |
3300024509|Ga0255175_1076662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 600 | Open in IMG/M |
3300027121|Ga0255074_1052613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300027151|Ga0255063_1055024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300027608|Ga0208974_1000811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12510 | Open in IMG/M |
3300027608|Ga0208974_1011403 | All Organisms → Viruses → Predicted Viral | 2882 | Open in IMG/M |
3300027659|Ga0208975_1057706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1180 | Open in IMG/M |
3300027659|Ga0208975_1066453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
3300027732|Ga0209442_1087775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
3300027733|Ga0209297_1013091 | All Organisms → Viruses → Predicted Viral | 4024 | Open in IMG/M |
3300027734|Ga0209087_1182451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300027736|Ga0209190_1128018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300027746|Ga0209597_1000588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24085 | Open in IMG/M |
3300027754|Ga0209596_1002322 | Not Available | 15733 | Open in IMG/M |
3300027756|Ga0209444_10147664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 904 | Open in IMG/M |
3300027759|Ga0209296_1001395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18646 | Open in IMG/M |
3300027759|Ga0209296_1020166 | All Organisms → Viruses → Predicted Viral | 3811 | Open in IMG/M |
3300027759|Ga0209296_1318411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300027763|Ga0209088_10375799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300027782|Ga0209500_10244637 | Not Available | 786 | Open in IMG/M |
3300027782|Ga0209500_10289612 | Not Available | 698 | Open in IMG/M |
3300027785|Ga0209246_10051585 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
3300027785|Ga0209246_10192680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 798 | Open in IMG/M |
3300027798|Ga0209353_10471243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300027805|Ga0209229_10001532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9513 | Open in IMG/M |
3300027969|Ga0209191_1081962 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
3300028275|Ga0255174_1061137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
3300028394|Ga0304730_1158966 | Not Available | 898 | Open in IMG/M |
3300031758|Ga0315907_10948022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
3300031787|Ga0315900_10096387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2896 | Open in IMG/M |
3300031787|Ga0315900_10501583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300031857|Ga0315909_10224605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300031885|Ga0315285_10255988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
3300031885|Ga0315285_10501846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300031951|Ga0315904_10334370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
3300031963|Ga0315901_10351212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
3300032053|Ga0315284_10184642 | All Organisms → Viruses → Predicted Viral | 2711 | Open in IMG/M |
3300032092|Ga0315905_11020344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300032401|Ga0315275_12355679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300034066|Ga0335019_0081668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2181 | Open in IMG/M |
3300034104|Ga0335031_0109710 | All Organisms → Viruses → Predicted Viral | 1940 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.97% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.87% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.65% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.03% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.42% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.61% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.61% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.61% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.61% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.61% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.81% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.81% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012282 | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM31_101695582 | 3300001851 | Marine Plankton | MVDYKQLTQEQIIDAYSRVFPTRYEPMTIERMIQFARLIEQLHGVKYEA* |
JGI24766J26685_100217035 | 3300002161 | Freshwater And Sediment | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKHEA* |
JGI25908J49247_1000142621 | 3300003277 | Freshwater Lake | MVESSPLTQEEIIKAYNKAFPTRYEPMTLERMIQFVRIIEQAHGIKDAV* |
JGI25908J49247_100066294 | 3300003277 | Freshwater Lake | VANEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYE* |
JGI25909J50240_10171726 | 3300003393 | Freshwater Lake | MVESSPLTQEEIMKAYSKVFPTRYEPMTIQRMIQFARIIEQLHGVKDVH* |
JGI25909J50240_10538253 | 3300003393 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGIK |
JGI25909J50240_10897252 | 3300003393 | Freshwater Lake | MENSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD* |
JGI25907J50239_10287573 | 3300003394 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD* |
JGI25907J50239_10409373 | 3300003394 | Freshwater Lake | MVESSPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG* |
JGI25911J50253_100671125 | 3300003411 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHG |
JGI25911J50253_101576472 | 3300003411 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG* |
Ga0066179_102486592 | 3300004126 | Freshwater Lake | MVESSPLTQEEIIKAYNKAFPTRYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0007787_100094827 | 3300004240 | Freshwater Lake | VDYEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYET* |
Ga0068872_107681581 | 3300005528 | Freshwater Lake | MVDYNPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFA |
Ga0049083_100660721 | 3300005580 | Freshwater Lentic | VANEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQL |
Ga0049081_100050623 | 3300005581 | Freshwater Lentic | VANEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYET* |
Ga0049081_100156545 | 3300005581 | Freshwater Lentic | MVDYNPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGIKYEA* |
Ga0049081_101335464 | 3300005581 | Freshwater Lentic | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD* |
Ga0049080_100236762 | 3300005582 | Freshwater Lentic | MVDYSPLTQEQIIGAYSQVFPTRYEPMTIERMIQFARIIEQLHGVKYET* |
Ga0049080_100415084 | 3300005582 | Freshwater Lentic | MDSKPLTQEEIMKAYNKAFPTRYEPMTLERMIQFARIIEQLHGVKDG* |
Ga0049080_101123391 | 3300005582 | Freshwater Lentic | LTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD* |
Ga0079957_102299011 | 3300005805 | Lake | MVDSKPLTLEEIMKAYSKVFPTRYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0079957_11040124 | 3300005805 | Lake | MDFNPLTQEQIIDAYSKVFPTRYEPMTIERMIQFARIIEQLHGVRYET* |
Ga0075464_104246632 | 3300006805 | Aqueous | VDYKPLTQEQIIGAYSKAFPTRYEPMTIDRMIQFARIIEQLHGVKHEA* |
Ga0102880_12112593 | 3300007550 | Estuarine | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0102865_10602722 | 3300007639 | Estuarine | MVDSSPLTLEEIMKAYSKVFPTRYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0105745_11485843 | 3300007972 | Estuary Water | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0105747_11939481 | 3300007974 | Estuary Water | RLMVDYSPLTQEQIIGAYSQVFPTRYEPMTIERMIQFARIIEQLHGVKYET* |
Ga0114340_100151419 | 3300008107 | Freshwater, Plankton | MDFKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVRYET* |
Ga0114340_10071307 | 3300008107 | Freshwater, Plankton | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYEA* |
Ga0114340_10172052 | 3300008107 | Freshwater, Plankton | MVDYNPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARLIEQLHGIKHEA* |
Ga0114340_10378393 | 3300008107 | Freshwater, Plankton | VDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYEA* |
Ga0114340_11630942 | 3300008107 | Freshwater, Plankton | MVDSKPLTLEEIMKAYSKVFPTRYESMTIEKMIQFARIVEQLHGVKDVH* |
Ga0114343_10761065 | 3300008110 | Freshwater, Plankton | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVLYY* |
Ga0114343_11297571 | 3300008110 | Freshwater, Plankton | TQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG* |
Ga0114347_100998110 | 3300008114 | Freshwater, Plankton | MVDYNPLTQEQIIDAYSKVFPTRYEPMTIERMIQFARIIEQLHGIKYEA* |
Ga0114355_10764212 | 3300008120 | Freshwater, Plankton | MDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYEA* |
Ga0114355_11285512 | 3300008120 | Freshwater, Plankton | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVRYET* |
Ga0114361_10928551 | 3300008265 | Freshwater, Plankton | TQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVRYET* |
Ga0114363_11932422 | 3300008266 | Freshwater, Plankton | KPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVRYET* |
Ga0114876_11176211 | 3300008448 | Freshwater Lake | TQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD* |
Ga0114876_12285863 | 3300008448 | Freshwater Lake | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEEKVNGK* |
Ga0114880_12645673 | 3300008450 | Freshwater Lake | MVDYNPLTQEQIINAYSKVFPTRYEPMTIERMIQFARIIEQLH |
Ga0114973_1000127624 | 3300009068 | Freshwater Lake | VDYKPLTQEQIIGAYSKVFPTRYEPMTIERMVRFARIIEQLHGVKYET* |
Ga0114973_102499963 | 3300009068 | Freshwater Lake | MDSKPLTQEEIMKAYGKVFPTRYEPMTIERMIQFARIIEQLHGVKDVH* |
Ga0114973_103334523 | 3300009068 | Freshwater Lake | VANNPLTQEQIIGAYKKAFPTKYEPMTIERMIQFARLIEELHGVGHVY* |
Ga0114973_104123853 | 3300009068 | Freshwater Lake | MDSKPLTQEEIIKAYNKAFPTRYEPMTLERMIQFARIIEQLHGVKDVH* |
Ga0114968_104635583 | 3300009155 | Freshwater Lake | VDYKPLTQEQIIGAYSKAFPTRYEPMTIDRMIMFARLIEELHGVSHVH* |
Ga0114977_1002491310 | 3300009158 | Freshwater Lake | VDYKPLTQEQIIGAYKKAFPTKYEPMTIDRMIQFARIIEQLHGVKHEA* |
Ga0114978_101361104 | 3300009159 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTRYEPMTIQRMIQFARIIEQMHGVKDVH* |
Ga0114978_106279043 | 3300009159 | Freshwater Lake | MLDSKPLTLEEIMKAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKDVH* |
Ga0114970_101503436 | 3300009163 | Freshwater Lake | MDSKPLTQEEIMKAYGKVFPTRYEPITLERMIQFARIIEQLHGVKDVH* |
Ga0114975_101923052 | 3300009164 | Freshwater Lake | MVDSKPLTQEEIMKAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKDVY* |
Ga0114975_103794141 | 3300009164 | Freshwater Lake | VDYKPLTQEQIIGAYSQAFPTRYEPMTIDRMIQFARIIEQLHGVKHEA* |
Ga0114974_1000107220 | 3300009183 | Freshwater Lake | VDYKPLTQEQIIGAYSQAFPTRYEPMTINRMIQFARIIEQLHGVKHEA* |
Ga0114974_100283987 | 3300009183 | Freshwater Lake | MLDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFVRIIEQLHGVKDVH* |
Ga0114982_10932494 | 3300009419 | Deep Subsurface | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYET* |
Ga0153801_10692762 | 3300012017 | Freshwater | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQAHGIKDAV* |
Ga0157136_10095052 | 3300012282 | Freshwater | MENSKPLTLEEIMKAYSKAFPTRYEPMTLERMIQFVRIIEQLHGVKHD* |
(restricted) Ga0172367_100917491 | 3300013126 | Freshwater | MVDYNPLTQEQIIGAYSKVFPTRYEPITIERMIQFARIIEQLHGIKHEA* |
Ga0170791_158748913 | 3300013295 | Freshwater | VDYKPLTQEQIIGAYSKVFPTRYEPMTIERMVRFARIIEQLHGVK |
Ga0181347_11645892 | 3300017722 | Freshwater Lake | MDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFARIIEQLHGVKDVY |
Ga0181357_10733703 | 3300017777 | Freshwater Lake | MVESSPLTQEEIMKAYSKSFPTKYEPMTLERMIQFVRIIEQLHGVKHD |
Ga0181357_12097512 | 3300017777 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDVH |
Ga0181346_11714083 | 3300017780 | Freshwater Lake | MENSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLH |
Ga0181355_12348153 | 3300017785 | Freshwater Lake | VDYEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQ |
Ga0181355_12355801 | 3300017785 | Freshwater Lake | MVESSPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVK |
Ga0181359_100052222 | 3300019784 | Freshwater Lake | MVESSPLTQEEIIKAYNKAFPTRYEPMTLERMIQFVRIIEQAHGIKDAV |
Ga0181359_10022766 | 3300019784 | Freshwater Lake | VANEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYE |
Ga0181359_10096103 | 3300019784 | Freshwater Lake | MDSKPLTQEEIIKAYSKAFPTKYESMTLERMIQFVRIIEQLHGVKNVY |
Ga0181359_10645324 | 3300019784 | Freshwater Lake | MVESSPLTQEEIMKAYSKVFPTRYEPMTIQRMIQFARIIEQLHGVKDVH |
Ga0181359_11335213 | 3300019784 | Freshwater Lake | MDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFARIIEQLHGVKDDCATMRH |
Ga0181359_12070172 | 3300019784 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD |
Ga0211729_105758323 | 3300020172 | Freshwater | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYET |
Ga0211731_102868083 | 3300020205 | Freshwater | MDSKPLTQEEIMKAYNKAFPTRYEPMTLERMIQFVRIIEQAHGIKDAV |
Ga0213920_10412303 | 3300021438 | Freshwater | IVDYKPLTQEQIIGAYNVVFPTRYEPMTIERMIQFARIIEQLHGVKYET |
Ga0222712_100848755 | 3300021963 | Estuarine Water | MVDYNPLTQEQIINAYSKVFPTRYEPMTIERMIQFARIIEQLHGIKYEA |
Ga0222712_105190522 | 3300021963 | Estuarine Water | MDYNPLTQEQIIGAYNKVFPTRYEPMTIERMIQFARIIEQLHGVKYEA |
Ga0181354_11492392 | 3300022190 | Freshwater Lake | MVESSPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD |
Ga0181351_11409412 | 3300022407 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG |
Ga0214923_106068371 | 3300023179 | Freshwater | MDYNPLTQEQIIGAYNKVFPTRYEPMTIERMIQFARIIEQLHGVK |
Ga0214919_100521552 | 3300023184 | Freshwater | VDYKPLTQEQIIGAYSKAFPTKYEPMTIERMIQFARIIEQLHGVKHEA |
Ga0255178_10036002 | 3300024298 | Freshwater | MDYNPLTQEQIIGAYNKVFPTRYEPMTIERMIQFARIIEQLHGVKYES |
Ga0255151_10554751 | 3300024496 | Freshwater | MVDYNPLTQEQIINAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYES |
Ga0255175_10766621 | 3300024509 | Freshwater | MDYNPLTQEQIIGAYNKVFPTRYEPMTIERMIQFARIIE |
Ga0255074_10526132 | 3300027121 | Freshwater | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKHD |
Ga0255063_10550243 | 3300027151 | Freshwater | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGV |
Ga0208974_100081129 | 3300027608 | Freshwater Lentic | MDSKPLTQEEIMKAYNKAFPTRYEPMTLERMIQFARIIEQLHGVKDG |
Ga0208974_10114037 | 3300027608 | Freshwater Lentic | VANEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKYET |
Ga0208975_10577064 | 3300027659 | Freshwater Lentic | MVDYNPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARI |
Ga0208975_10664533 | 3300027659 | Freshwater Lentic | MDSKPLTQEEIMKAYSKAFPTRYEPMTLERMIQFVRIIEQAHGIKDAV |
Ga0209442_10877753 | 3300027732 | Freshwater Lake | MENSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDVH |
Ga0209297_10130914 | 3300027733 | Freshwater Lake | VDYKPLTQEQIIGAYKKAFPTKYEPMTIDRMIQFARIIEQLHGVKHEA |
Ga0209087_11824514 | 3300027734 | Freshwater Lake | MDSKPLTQEEIMKAYGKVFPTRYEPMTIERMIQFARIIEQLHGVKDVH |
Ga0209190_11280185 | 3300027736 | Freshwater Lake | MDSKPLTQEEIMKAYGKVFPTRYEPITLERMIQFARIIEQLHGVKDVH |
Ga0209597_100058824 | 3300027746 | Freshwater Lake | VDYKPLTQEQIIGAYSKVFPTRYEPMTIERMVRFARIIEQLHGVKYET |
Ga0209596_10023223 | 3300027754 | Freshwater Lake | VANNPLTQEQIIGAYKKAFPTKYEPMTIERMIQFARLIEELHGVGHVY |
Ga0209444_101476644 | 3300027756 | Freshwater Lake | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG |
Ga0209296_100139511 | 3300027759 | Freshwater Lake | VDYKPLTQEQIIGAYSQAFPTRYEPMTINRMIQFARIIEQLHGVKHEA |
Ga0209296_10201667 | 3300027759 | Freshwater Lake | MLDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFVRIIEQLHGVKDVH |
Ga0209296_13184113 | 3300027759 | Freshwater Lake | MLDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFV |
Ga0209088_103757992 | 3300027763 | Freshwater Lake | MDSKPLTQEEIMKAYSKVFPTRYEPMTIERMIQFARIIEQLHGVKDVH |
Ga0209500_102446373 | 3300027782 | Freshwater Lake | MLDSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFARIIEQLHGVKDVH |
Ga0209500_102896121 | 3300027782 | Freshwater Lake | MDSKPLTQEEIMKAYSKAFPTRYEPMTIQRMIQFARIIEQMHGVKDVH |
Ga0209246_100515853 | 3300027785 | Freshwater Lake | MDSKPLTQEEIMRAYSKAFPTKYEPMTLERMIQFVRIIEQLHGVKDG |
Ga0209246_101926803 | 3300027785 | Freshwater Lake | MVESSPLTQEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQLHG |
Ga0209353_104712432 | 3300027798 | Freshwater Lake | VDYEPLTQEQIIGAYSKVFPTRYEPMTVERMIQFARIIEQLHGVKYET |
Ga0209229_1000153226 | 3300027805 | Freshwater And Sediment | MVDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKHEA |
Ga0209191_10819622 | 3300027969 | Freshwater Lake | VDYKPLTQEQIIGAYSQAFPTRYEPMTIDRMIQFARIIEQLHGVKHEA |
Ga0255174_10611371 | 3300028275 | Freshwater | MDYNPLTQEQIIGAYNKVFPTRYEPMTIERMIQFARIIEQLH |
Ga0304730_11589663 | 3300028394 | Freshwater Lake | VDYKPLTQEQIIGAYSKAFPTRYEPMTIDRMIMFARLIEELHGVSHVH |
Ga0315907_109480223 | 3300031758 | Freshwater | MDYKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVKYEA |
Ga0315900_100963871 | 3300031787 | Freshwater | MDFKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHG |
Ga0315900_105015831 | 3300031787 | Freshwater | QIMDFKPLTQEQIIDAYSKVFPTRYEPMTIDRMIQFARIIEQLHGVRYET |
Ga0315909_102246054 | 3300031857 | Freshwater | MDFKPLTQEQIIDAYSRVFPTRYEPMTIDRMIQFARIIEQLHGVRYET |
Ga0315285_102559883 | 3300031885 | Sediment | MDSKPLTPEEIMKAYSKAFPTRYEPMTLERMIQFVKIIEQLHGVKHD |
Ga0315285_105018462 | 3300031885 | Sediment | MDSKPLTPEEIMKAYSKAFPTRYEPMTLERMIQFARIIEQLHGVKDVH |
Ga0315904_103343702 | 3300031951 | Freshwater | MVDSKPLTLEEIMKAYSKVFPTRYESMTIEKMIQFARIVEQLHGVKDVH |
Ga0315901_103512121 | 3300031963 | Freshwater | DSKPLTLEEIMKAYSKVFPTRYESMTIEKMIQFARIVEQLHGVKDVH |
Ga0315284_101846429 | 3300032053 | Sediment | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQL |
Ga0315905_110203442 | 3300032092 | Freshwater | IVDYEPLTQEQIIGAYSKVFPTRYEPMTIERMIQFARIIEQLHGVRYET |
Ga0315275_123556791 | 3300032401 | Sediment | MDSKPLTLEEIMKAYSKAFPTKYEPMTLERMIQFVRIIEQ |
Ga0335019_0081668_2038_2181 | 3300034066 | Freshwater | DSKPLTQEEIMKAYSKVFPTRYEPMTLERMIQFVRIIEQLHGVKDVH |
Ga0335031_0109710_2_115 | 3300034104 | Freshwater | MDYKPLAQEQIIDAYSKVFPTRYEPMTLERMIQFVRII |
⦗Top⦘ |