| Basic Information | |
|---|---|
| Family ID | F068572 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.87 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (94.355 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (14.516 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.774 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.78% β-sheet: 0.00% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13550 | Phage-tail_3 | 5.65 |
| PF00583 | Acetyltransf_1 | 4.84 |
| PF09718 | Tape_meas_lam_C | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.19 % |
| Unclassified | root | N/A | 0.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c035829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 667 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1043076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1705 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10080019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1743 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10106923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1354 | Open in IMG/M |
| 3300001523|JGI1221J15618_1121984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1160 | Open in IMG/M |
| 3300001580|Draft_10475132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 504 | Open in IMG/M |
| 3300001836|RCM27_1060583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 513 | Open in IMG/M |
| 3300001848|RCM47_1168629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
| 3300002091|JGI24028J26656_1016354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 788 | Open in IMG/M |
| 3300002098|JGI24219J26650_1007097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2114 | Open in IMG/M |
| 3300002220|MLSBCLC_10179238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2169 | Open in IMG/M |
| 3300002476|metazooDRAFT_10781565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300003375|JGI26470J50227_1031812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1042 | Open in IMG/M |
| 3300003375|JGI26470J50227_1040400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 868 | Open in IMG/M |
| 3300003785|Ga0007851_101183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1679 | Open in IMG/M |
| 3300003789|Ga0007835_1004064 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300003796|Ga0007865_1026079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 535 | Open in IMG/M |
| 3300003797|Ga0007846_1007771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1111 | Open in IMG/M |
| 3300003812|Ga0007861_1003820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1554 | Open in IMG/M |
| 3300004694|Ga0065170_1001571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3167 | Open in IMG/M |
| 3300005527|Ga0068876_10187040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300005805|Ga0079957_1019460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4787 | Open in IMG/M |
| 3300006100|Ga0007806_1047194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 832 | Open in IMG/M |
| 3300006101|Ga0007810_1001005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8257 | Open in IMG/M |
| 3300006805|Ga0075464_10521162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 728 | Open in IMG/M |
| 3300006863|Ga0075459_1018135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1166 | Open in IMG/M |
| 3300006875|Ga0075473_10127993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1014 | Open in IMG/M |
| 3300006920|Ga0070748_1274406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300006920|Ga0070748_1364820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 508 | Open in IMG/M |
| 3300007276|Ga0070747_1237523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 635 | Open in IMG/M |
| 3300007516|Ga0105050_10527965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 694 | Open in IMG/M |
| 3300007559|Ga0102828_1013714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1693 | Open in IMG/M |
| 3300007559|Ga0102828_1117907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 653 | Open in IMG/M |
| 3300007559|Ga0102828_1121807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 643 | Open in IMG/M |
| 3300008107|Ga0114340_1235551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300008110|Ga0114343_1213152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
| 3300008266|Ga0114363_1012849 | All Organisms → Viruses → Predicted Viral | 4295 | Open in IMG/M |
| 3300008448|Ga0114876_1240207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 572 | Open in IMG/M |
| 3300009085|Ga0105103_10769872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
| 3300009154|Ga0114963_10003903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10203 | Open in IMG/M |
| 3300009155|Ga0114968_10376354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 779 | Open in IMG/M |
| 3300009163|Ga0114970_10323983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 872 | Open in IMG/M |
| 3300009165|Ga0105102_10608724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
| 3300009165|Ga0105102_10723200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 561 | Open in IMG/M |
| 3300009183|Ga0114974_10115544 | All Organisms → Viruses → Predicted Viral | 1711 | Open in IMG/M |
| 3300009183|Ga0114974_10612339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 599 | Open in IMG/M |
| 3300010160|Ga0114967_10333058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 771 | Open in IMG/M |
| 3300010966|Ga0137675_1003256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1189 | Open in IMG/M |
| 3300011995|Ga0153800_1029992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
| 3300012348|Ga0157140_10000631 | All Organisms → Viruses → Predicted Viral | 4278 | Open in IMG/M |
| 3300012352|Ga0157138_1014892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1264 | Open in IMG/M |
| 3300013286|Ga0136641_1185254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
| 3300014819|Ga0119954_1084204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300014960|Ga0134316_1024454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300017716|Ga0181350_1059470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 999 | Open in IMG/M |
| 3300017778|Ga0181349_1013784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3338 | Open in IMG/M |
| 3300019784|Ga0181359_1200864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300020205|Ga0211731_11313427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 642 | Open in IMG/M |
| 3300020705|Ga0214177_1008792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1308 | Open in IMG/M |
| 3300020711|Ga0214237_1013977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1032 | Open in IMG/M |
| 3300021115|Ga0214174_104726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1191 | Open in IMG/M |
| 3300021121|Ga0214173_104014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1720 | Open in IMG/M |
| 3300021125|Ga0214211_1001972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2684 | Open in IMG/M |
| 3300021136|Ga0214167_1050745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 852 | Open in IMG/M |
| 3300021138|Ga0214164_1053705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 871 | Open in IMG/M |
| 3300021138|Ga0214164_1101777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 538 | Open in IMG/M |
| 3300021354|Ga0194047_10222360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 743 | Open in IMG/M |
| 3300021519|Ga0194048_10133133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 942 | Open in IMG/M |
| 3300021519|Ga0194048_10235717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 670 | Open in IMG/M |
| 3300021519|Ga0194048_10237746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 666 | Open in IMG/M |
| 3300021956|Ga0213922_1095950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300021962|Ga0222713_10264640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1113 | Open in IMG/M |
| 3300022179|Ga0181353_1117064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 640 | Open in IMG/M |
| 3300022555|Ga0212088_10542031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 735 | Open in IMG/M |
| 3300022844|Ga0222687_1011670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1872 | Open in IMG/M |
| 3300023184|Ga0214919_10715389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300024306|Ga0255148_1027681 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300024354|Ga0255171_1047047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 816 | Open in IMG/M |
| 3300024509|Ga0255175_1042425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 866 | Open in IMG/M |
| 3300025369|Ga0208382_1013660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1202 | Open in IMG/M |
| 3300025383|Ga0208250_1031215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 839 | Open in IMG/M |
| 3300025387|Ga0207959_1002063 | All Organisms → Viruses → Predicted Viral | 4394 | Open in IMG/M |
| 3300025389|Ga0208257_1031355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 785 | Open in IMG/M |
| 3300025398|Ga0208251_1004343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3145 | Open in IMG/M |
| 3300025400|Ga0208387_1026772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1003 | Open in IMG/M |
| 3300025413|Ga0208614_1020410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1089 | Open in IMG/M |
| 3300025445|Ga0208424_1008251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1166 | Open in IMG/M |
| 3300025450|Ga0208744_1005233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3118 | Open in IMG/M |
| 3300025466|Ga0208497_1011720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2238 | Open in IMG/M |
| 3300025645|Ga0208643_1035014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1631 | Open in IMG/M |
| 3300025732|Ga0208784_1100708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 865 | Open in IMG/M |
| 3300025761|Ga0256310_1041919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 709 | Open in IMG/M |
| 3300025887|Ga0208544_10187519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300025896|Ga0208916_10376121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300027129|Ga0255067_1049279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
| 3300027151|Ga0255063_1095864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
| 3300027193|Ga0208800_1033747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 688 | Open in IMG/M |
| 3300027300|Ga0255140_1030113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300027302|Ga0255096_1009633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2427 | Open in IMG/M |
| 3300027467|Ga0255154_1055294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 889 | Open in IMG/M |
| 3300027529|Ga0255077_1048792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 786 | Open in IMG/M |
| 3300027597|Ga0255088_1057888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 755 | Open in IMG/M |
| 3300027649|Ga0208960_1091000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300027741|Ga0209085_1002661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10070 | Open in IMG/M |
| 3300027764|Ga0209134_10345799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027793|Ga0209972_10114425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1336 | Open in IMG/M |
| 3300027896|Ga0209777_10053883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3622 | Open in IMG/M |
| 3300027896|Ga0209777_11091357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| 3300027969|Ga0209191_1301924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
| 3300027976|Ga0209702_10054076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2244 | Open in IMG/M |
| 3300028108|Ga0256305_1054834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 991 | Open in IMG/M |
| 3300031758|Ga0315907_10813597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 696 | Open in IMG/M |
| 3300031787|Ga0315900_10017881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8349 | Open in IMG/M |
| 3300031787|Ga0315900_10174859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1944 | Open in IMG/M |
| 3300032053|Ga0315284_11012459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 935 | Open in IMG/M |
| 3300032275|Ga0315270_10169957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1323 | Open in IMG/M |
| 3300032560|Ga0316223_1136158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 831 | Open in IMG/M |
| 3300032676|Ga0316229_1313169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
| 3300033996|Ga0334979_0389350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 773 | Open in IMG/M |
| 3300034061|Ga0334987_0838398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 507 | Open in IMG/M |
| 3300034104|Ga0335031_0106548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1972 | Open in IMG/M |
| 3300034106|Ga0335036_0896072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 504 | Open in IMG/M |
| 3300034116|Ga0335068_0428690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 14.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.84% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.23% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.42% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.42% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.61% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.61% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.61% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.61% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.81% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.81% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.81% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.81% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.81% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.81% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020705 | Freshwater microbial communities from Trout Bog Lake, WI - 27AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300020711 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnion | Environmental | Open in IMG/M |
| 3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022844 | Saline water microbial communities from Ace Lake, Antarctica - #1163 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025761 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027300 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300027302 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0358291 | 3300000176 | Freshwater | YIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR* |
| TBL_comb48_EPIDRAFT_10430761 | 3300000439 | Freshwater | SAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR* |
| TBL_comb47_HYPODRAFT_100800194 | 3300000553 | Freshwater | YNGPYIASMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR* |
| TBL_comb47_HYPODRAFT_101069233 | 3300000553 | Freshwater | VMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR* |
| JGI1221J15618_11219841 | 3300001523 | Hypersaline | YNGPVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR* |
| Draft_104751321 | 3300001580 | Hydrocarbon Resource Environments | NLSAIDTQSGMQFLMKNKESIWSANQSASRGLPASR* |
| RCM27_10605832 | 3300001836 | Marine Plankton | NGPYIASMSAIDTQSATQFLARNKAAVWAANQSAQRSVPVSR* |
| RCM47_11686292 | 3300001848 | Marine Plankton | YIANMSAIDTQSAQQFLAKNRNSVFAANQSALRSLPVSR* |
| JGI24028J26656_10163542 | 3300002091 | Lentic | IANMSAIDTQSAMAFIAKNQNSIWAANQAAQRSLPQSR* |
| JGI24219J26650_10070975 | 3300002098 | Lentic | NMSAIDTQSATQFLAKNKQGVWAANQSAQLSLPQSR* |
| MLSBCLC_101792381 | 3300002220 | Hydrocarbon Resource Environments | PNQQMNNFQQQPQIVYNGPYIQNMSAIDTQSATQFLSRNKEAVYAANLSAGRSVPTSR* |
| metazooDRAFT_107815651 | 3300002476 | Lake | AGAMGGAPQAVYNGPYIANMSAIDTQSAVQFLARNKMAVYSANMSASRSVPTSTR* |
| JGI26470J50227_10318123 | 3300003375 | Freshwater | YNGPYIANMSAIDTQSAMSFIAKNQNSIWAANQAAQRSLPQSR* |
| JGI26470J50227_10404001 | 3300003375 | Freshwater | PNNSLSSSMGSQPQIVYNGPYIANMSAIDTQTSVQFLAKNKTAVWAANQSAQQSLPQSR* |
| Ga0007851_1011831 | 3300003785 | Freshwater | DVMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR* |
| Ga0007835_10040644 | 3300003789 | Freshwater | GQSVTYNGPYIASMQAIDTQSATTFLARNKTAVWAANQSAQRSLPQSR* |
| Ga0007865_10260791 | 3300003796 | Freshwater | VMNSSSGGVTYNGPYIANMSAIDTQSATQFLARNQTAVWSANQAAQRGLPSSR* |
| Ga0007846_10077711 | 3300003797 | Freshwater | VMGGSNQPSVVYNGPYIQQMSAIDTQSATQFLARNQNAVWAANQSAQRSLPQSR* |
| Ga0007861_10038201 | 3300003812 | Freshwater | QSVTYNGPYIASMQAIDTQSATTFLAKNKTAVWAANQSAQRSLPQSR* |
| Ga0065170_10015711 | 3300004694 | Freshwater | PYIASMQAIDTQSATQFLARNKTAVWAANQSAQRSLPQSR* |
| Ga0068876_101870401 | 3300005527 | Freshwater Lake | MGGQTINYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR* |
| Ga0079957_10194601 | 3300005805 | Lake | GPYIANMQAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR* |
| Ga0007806_10471942 | 3300006100 | Freshwater | MSGSQQPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR* |
| Ga0007810_100100511 | 3300006101 | Freshwater | SSSMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR* |
| Ga0075464_105211621 | 3300006805 | Aqueous | TTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR* |
| Ga0075459_10181353 | 3300006863 | Aqueous | GQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR* |
| Ga0075473_101279931 | 3300006875 | Aqueous | GQPQMVINGPYIENMSAIDTQSGQQFLAKNKNTIWAAYQSANRTVPLSR* |
| Ga0070748_12744062 | 3300006920 | Aqueous | PYIANMSAIDTQSGAQFLAKNKQAVWATYQSANRSIPVTR* |
| Ga0070748_13648201 | 3300006920 | Aqueous | IANMSAIDTQTGVQFLAKNKQTIWASYQSANRSVPVSR* |
| Ga0070747_12375231 | 3300007276 | Aqueous | QQLSSMNGQPSVVYNGPYIANMQAIDTQSGVQFLAKNKMTIWSLNQSANRSIPAGR* |
| Ga0105050_105279652 | 3300007516 | Freshwater | PVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR* |
| Ga0102828_10137141 | 3300007559 | Estuarine | IASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR* |
| Ga0102828_11179071 | 3300007559 | Estuarine | VVYNGPYIANMSAIDTQSAAQFLAKNKEAVWGANQSAQRSLPQSR* |
| Ga0102828_11218072 | 3300007559 | Estuarine | VFNGPYIANMSAIDTQSGIQFLAKNKMTIWSMNQSANRSVPAGR* |
| Ga0114340_12355512 | 3300008107 | Freshwater, Plankton | GQTINYNGPIIQNMSAIDTQSGLQFLAKNKQGVFAAYQSANRSIPVSR* |
| Ga0114343_12131521 | 3300008110 | Freshwater, Plankton | NLSAIDTQSALQFLSQNKQAIYAANQSAARSVPTSR* |
| Ga0114363_10128492 | 3300008266 | Freshwater, Plankton | MNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR* |
| Ga0114876_12402072 | 3300008448 | Freshwater Lake | IIQNMSAIDTQSGVAFLSKNKQAVWAANQSAQRSLPVSR* |
| Ga0105103_107698722 | 3300009085 | Freshwater Sediment | LSSMSGQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR* |
| Ga0114963_1000390312 | 3300009154 | Freshwater Lake | PTINYNGPYIASMSAIDTQSGLQFLAKNKQSVWAAYQSANRSVPMSR* |
| Ga0114968_103763542 | 3300009155 | Freshwater Lake | GQTVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR* |
| Ga0114970_103239831 | 3300009163 | Freshwater Lake | AMGGSQVVYNGPYIAQMNAIDTQSATQFLSKNKQAVWAANQSASRGVPASRA* |
| Ga0105102_106087241 | 3300009165 | Freshwater Sediment | IANMSAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR* |
| Ga0105102_107232002 | 3300009165 | Freshwater Sediment | PVVEHLSAIDTQSGMQFLMKNKESIWSANQSASRGLPASR* |
| Ga0114974_101155441 | 3300009183 | Freshwater Lake | TVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR* |
| Ga0114974_106123391 | 3300009183 | Freshwater Lake | NQPQVVYNGPYIANMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR* |
| Ga0114967_103330581 | 3300010160 | Freshwater Lake | NGPYIQNMSAIDTQSSIQFLAKNKQAVWSANQSAQRSLPQSR* |
| Ga0137675_10032563 | 3300010966 | Pond Fresh Water | GPYIASMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR* |
| Ga0153800_10299921 | 3300011995 | Freshwater | YNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSR* |
| Ga0157140_100006315 | 3300012348 | Freshwater | YIANMSAIDTQSGMQFLMQNKQSIWAANQSAQRSLPVSK* |
| Ga0157138_10148923 | 3300012352 | Freshwater | NKMLGAMSNNQPQVVYNGPYIANMSAIDTQSATQFLAKNKQTIWAVNQSAQRSLPVSK* |
| Ga0136641_11852541 | 3300013286 | Freshwater | IANMSAIDTQTGLQFLAKNKQGVWAANQSAQRGIPQSR* |
| Ga0119954_10842041 | 3300014819 | Freshwater | GQLSGMMGNQPQVVYNGPYIANMSAIDTQSAAQFLAKNKMSVWAANQSANRSIPVSR* |
| Ga0134316_10244542 | 3300014960 | Surface Water | GGGQQIIYNGPYIANMSAIDTQSASQFLAKNKDAVWAANQSANRSIPSSR* |
| Ga0181350_10594701 | 3300017716 | Freshwater Lake | MSASDTQSAAQFLAKNKEAVWGANQSAQRSLPQSR |
| Ga0181349_10137845 | 3300017778 | Freshwater Lake | QVVYNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSR |
| Ga0181359_12008642 | 3300019784 | Freshwater Lake | DGNYIANMSAIDTQSGMAFLAKNKDTIWAAYQSANRSVPISR |
| Ga0211731_113134272 | 3300020205 | Freshwater | GPVIQNMQAIDTQSGLQFLAKNKMNIWAINQSASRSIATSR |
| Ga0214177_10087923 | 3300020705 | Freshwater | QPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR |
| Ga0214237_10139771 | 3300020711 | Freshwater | MSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR |
| Ga0214174_1047261 | 3300021115 | Freshwater | MSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR |
| Ga0214173_1040141 | 3300021121 | Freshwater | DVMGGSNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR |
| Ga0214211_10019725 | 3300021125 | Freshwater | PYIQQMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR |
| Ga0214167_10507452 | 3300021136 | Freshwater | SGGGITYNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR |
| Ga0214164_10537052 | 3300021138 | Freshwater | SALSANSGGGITYNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR |
| Ga0214164_11017772 | 3300021138 | Freshwater | PATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR |
| Ga0194047_102223602 | 3300021354 | Anoxic Zone Freshwater | ANMSAIDTQSAMQFLASNKMAIWSANQSASRSIPASR |
| Ga0194048_101331331 | 3300021519 | Anoxic Zone Freshwater | PYIANMSAIDTQSSLQFLAKNKQGVWAANQSAQRSLPQSR |
| Ga0194048_102357171 | 3300021519 | Anoxic Zone Freshwater | SQPQVVYNGPYIANMNAIDTQSGTQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0194048_102377461 | 3300021519 | Anoxic Zone Freshwater | GPYIANMSAIDTQSATDFLAKNKMTIWAVNQSANRSIPTSR |
| Ga0213922_10959501 | 3300021956 | Freshwater | MGGGPQVVYNGPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSFPQSR |
| Ga0222713_102646401 | 3300021962 | Estuarine Water | NMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR |
| Ga0181353_11170641 | 3300022179 | Freshwater Lake | ANMSAIDTQSATQFLASNKQTIWAAYQSANRMVPISR |
| Ga0212088_105420311 | 3300022555 | Freshwater Lake Hypolimnion | YNGPYIGQMSAIDTQSAVQFLARNKTAVWSANQSAQRGLPTSR |
| Ga0222687_10116701 | 3300022844 | Saline Water | IQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR |
| Ga0214919_107153892 | 3300023184 | Freshwater | TVVPNNQLSSHLGQGAQNVFNGPYIANMSAIDTQSSMQFISKNKEMIWAANQSASRSLQASR |
| Ga0228707_10203473 | 3300023700 | Freshwater | VFNQMLGGGGQTVNYNGPYIANMSAIDTQSSIQFLSKNKQAVWAANQSAQRALPVSR |
| Ga0255148_10276811 | 3300024306 | Freshwater | IQSMIAIDTQTGVQFLVKNKQTIWAANQSAQRALPASR |
| Ga0255171_10470472 | 3300024354 | Freshwater | GPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0255175_10424252 | 3300024509 | Freshwater | KLTSMGGGPQVVYNGPYIANMNAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0208382_10136601 | 3300025369 | Freshwater | VYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR |
| Ga0208250_10312151 | 3300025383 | Freshwater | DAMSGSQQPATVYNGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR |
| Ga0207959_10020631 | 3300025387 | Freshwater | PYIASMQAIDTQSATTFLAKNKTAVWAANQSAQRSLPQSR |
| Ga0208257_10313552 | 3300025389 | Freshwater | VMNSSSGGVTYNGPYIANMSAIDTQSATQFLARNQVAVWSANQAAQRGLPQSR |
| Ga0208251_10043431 | 3300025398 | Freshwater | LSSSMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR |
| Ga0208387_10267723 | 3300025400 | Freshwater | MYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR |
| Ga0208614_10204101 | 3300025413 | Freshwater | AQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR |
| Ga0208424_10082513 | 3300025445 | Aqueous | GQPQVVYNGPYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0208744_10052335 | 3300025450 | Freshwater | NSLSASMGNQAQIVYNGPYIANMSAIDTQSSVQFLAKNKTAVWAANQSAQQSLPATR |
| Ga0208497_10117201 | 3300025466 | Freshwater | TYNGPYIASMSAIDTQSALQFIAKNQNSIWAANQAAQRSLPQSR |
| Ga0208643_10350141 | 3300025645 | Aqueous | TVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR |
| Ga0208784_11007081 | 3300025732 | Aqueous | MGQPQMVINGPYIENMSAIDTQSGQQFLAKNKNTIWAAYQSANRTVPLSR |
| Ga0256310_10419191 | 3300025761 | Freshwater | NMSAIDTQSAAQFLAKNKMSVWSANQSASRSVPTSK |
| Ga0208544_101875191 | 3300025887 | Aqueous | GGTTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR |
| Ga0208916_103761212 | 3300025896 | Aqueous | NLASSMGNGGQTVNYNGPYIANMSAIDTQSGMQFLAKNKQTIWASYQSANRSVPVSR |
| Ga0255067_10492791 | 3300027129 | Freshwater | HALAGAMGGQVINYNGPIIQNMSAIDTQSGIAFLAKNKQAVWAANQSAQRSLPVSR |
| Ga0255063_10958642 | 3300027151 | Freshwater | TINYNAPYIANMSAIDTQSGVQFLAKNKEAVWSANQSASRGLPTSR |
| Ga0208800_10337472 | 3300027193 | Estuarine | GQTVNYNGPYIASMSAIDTQSATQFLSQNKQTIWAVNQSASRSMPTSR |
| Ga0255140_10301132 | 3300027300 | Freshwater | NGPIIQNMSAIDTQSGLQFLAKNKQGVFAAYQSANRSIPVSR |
| Ga0255096_10096335 | 3300027302 | Freshwater | INYNGPIIQNMSAIDTQSGIAFLAKNKQAVWAANQSAQRSLPVSR |
| Ga0255154_10552941 | 3300027467 | Freshwater | LASMMGSGQTINYNGPFIQQMSAIDTQSGIQFLTQNKQAVWAANQSAQRSLPVSR |
| Ga0255077_10487921 | 3300027529 | Freshwater | SSAMSGGPQVVYNGPYIASMSAIDTQSATQFLSRNKQAVFAANQSATRSLPQSRS |
| Ga0255088_10578882 | 3300027597 | Freshwater | PYIANMSAIDTQSGVQFLAKNKEAVWSANQSASRGLPTSR |
| Ga0208960_10910002 | 3300027649 | Freshwater Lentic | TYIANMSAIDTQSATQFLASNKNTIWAAYQSANRSVPISR |
| Ga0209085_100266111 | 3300027741 | Freshwater Lake | PTINYNGPYIASMSAIDTQSGLQFLAKNKQSVWAAYQSANRSVPMSR |
| Ga0209134_103457992 | 3300027764 | Freshwater Lake | ANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0209972_101144251 | 3300027793 | Freshwater Lake | MQAIDTQSATQFLARNKEAVYAANLSATRSLPASR |
| Ga0209777_100538831 | 3300027896 | Freshwater Lake Sediment | SMGSQPQIVYNGPYIANMSAIDTQTSVQFLAKNKTAVWAANQSAQQSLPQSR |
| Ga0209777_110913571 | 3300027896 | Freshwater Lake Sediment | NGPYIANMSAIDTQSATQFLANNKQAVWSANISAQRGLPQSR |
| Ga0209191_13019242 | 3300027969 | Freshwater Lake | VNSLMGNQPQVVYNGPYIANMSAIDTQSGLQFLAKNKQGVWAANQSAQRSLPQSR |
| Ga0209702_100540765 | 3300027976 | Freshwater | VTYNGPVIQNMQAIDTQSGIQFLAKNKMTIWSMNQSANRSIPAGR |
| Ga0256305_10548341 | 3300028108 | Freshwater | GPYIENMSAIDTQSAAQFLAKNKMSVWSANQSASRSVPTSK |
| Ga0315907_108135971 | 3300031758 | Freshwater | GSQPQVVYNAPVVQNLSAIDTQSALQFLSQNKQAIYAANQSAARSVPTSR |
| Ga0315900_1001788111 | 3300031787 | Freshwater | MGGQTINYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPMSR |
| Ga0315900_101748591 | 3300031787 | Freshwater | INYNGPIIQNMNAIDTQSGLQFLAKNKQGVFAAYQSANRSIPTSR |
| Ga0315284_110124593 | 3300032053 | Sediment | NMSAIDTQSGIQFLSKNKETIWSANQSAQRSLPQGR |
| Ga0315270_101699571 | 3300032275 | Sediment | NHQLSLGGGGGGTTVNYNGPYIASMSAVDTQSGVQFLAKNKQAVWATYQSANRSIPMSR |
| Ga0316223_11361582 | 3300032560 | Freshwater | SNQPSVMYNGPYIANMSAIDTQSATQFLARNQTAVWAANQSAQRSLPQSR |
| Ga0316229_13131692 | 3300032676 | Freshwater | NGPYIASMSAIDTQSATQFLAKNQNAVWGAYQNAQRGLPQTR |
| Ga0334979_0389350_601_756 | 3300033996 | Freshwater | MGNQPQIVYNGPYIANMSAIDTQSATQFLATNKQAVWSANQSAQRGLPQSR |
| Ga0334987_0838398_2_124 | 3300034061 | Freshwater | PYIANMQAIDTQSATQFLAKNKQAVWSANQSAQRSLPQSR |
| Ga0335031_0106548_1777_1935 | 3300034104 | Freshwater | MMGGGGGLTVNGNYIANMSAIDTQSATQFLASNKQTIWAAYQSANRMVPISR |
| Ga0335036_0896072_301_459 | 3300034106 | Freshwater | MGGGPQVVYNGPYIANMQAIDTQSSIQFLAKNKDAVWAANQSAQRSLPQSRA |
| Ga0335068_0428690_3_176 | 3300034116 | Freshwater | IAPSLAGMQQPQVVYNGPYIENMSAIDTQSAAQFLSKNKMSVWAANKSADRSVPVSR |
| ⦗Top⦘ |