Basic Information | |
---|---|
Family ID | F068523 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 41 residues |
Representative Sequence | VTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLND |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 87.10 % |
% of genes near scaffold ends (potentially truncated) | 99.19 % |
% of genes from short scaffolds (< 2000 bps) | 95.16 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.097 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.323 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.065 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.935 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF04023 | FeoA | 39.52 |
PF02742 | Fe_dep_repr_C | 37.90 |
PF10590 | PNP_phzG_C | 10.48 |
PF00285 | Citrate_synt | 1.61 |
PF01325 | Fe_dep_repress | 0.81 |
PF13185 | GAF_2 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 39.52 |
COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 37.90 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 1.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.10 % |
All Organisms | root | All Organisms | 37.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001991|JGI24743J22301_10057130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 800 | Open in IMG/M |
3300004103|Ga0058903_1513520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 728 | Open in IMG/M |
3300005542|Ga0070732_10909761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 537 | Open in IMG/M |
3300006032|Ga0066696_10623171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 699 | Open in IMG/M |
3300006871|Ga0075434_100665336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1059 | Open in IMG/M |
3300010048|Ga0126373_10167473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2104 | Open in IMG/M |
3300010048|Ga0126373_11828753 | Not Available | 671 | Open in IMG/M |
3300010120|Ga0127451_1008746 | Not Available | 600 | Open in IMG/M |
3300010121|Ga0127438_1005946 | Not Available | 631 | Open in IMG/M |
3300010134|Ga0127484_1102050 | Not Available | 754 | Open in IMG/M |
3300010159|Ga0099796_10118982 | Not Available | 1013 | Open in IMG/M |
3300010326|Ga0134065_10383468 | Not Available | 560 | Open in IMG/M |
3300010376|Ga0126381_100974409 | Not Available | 1223 | Open in IMG/M |
3300011069|Ga0138592_1062199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 911 | Open in IMG/M |
3300011080|Ga0138568_1115716 | Not Available | 583 | Open in IMG/M |
3300011087|Ga0138570_1181466 | Not Available | 620 | Open in IMG/M |
3300011120|Ga0150983_10744087 | Not Available | 536 | Open in IMG/M |
3300011120|Ga0150983_12947020 | Not Available | 522 | Open in IMG/M |
3300012096|Ga0137389_10039536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3493 | Open in IMG/M |
3300012201|Ga0137365_11198329 | Not Available | 543 | Open in IMG/M |
3300012355|Ga0137369_10864964 | Not Available | 611 | Open in IMG/M |
3300012357|Ga0137384_11114053 | Not Available | 632 | Open in IMG/M |
3300012503|Ga0157313_1021006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
3300012510|Ga0157316_1010646 | Not Available | 848 | Open in IMG/M |
3300012917|Ga0137395_10319899 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300012924|Ga0137413_10203275 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300012972|Ga0134077_10386796 | Not Available | 602 | Open in IMG/M |
3300014325|Ga0163163_12318688 | Not Available | 595 | Open in IMG/M |
3300014654|Ga0181525_10206322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1073 | Open in IMG/M |
3300016387|Ga0182040_11692536 | Not Available | 540 | Open in IMG/M |
3300016404|Ga0182037_11299667 | Not Available | 641 | Open in IMG/M |
3300017821|Ga0187812_1240460 | Not Available | 577 | Open in IMG/M |
3300017926|Ga0187807_1202913 | Not Available | 642 | Open in IMG/M |
3300017937|Ga0187809_10121014 | Not Available | 890 | Open in IMG/M |
3300017942|Ga0187808_10419709 | Not Available | 613 | Open in IMG/M |
3300017959|Ga0187779_11345618 | Not Available | 507 | Open in IMG/M |
3300017961|Ga0187778_10913521 | Not Available | 604 | Open in IMG/M |
3300017961|Ga0187778_11154808 | Not Available | 541 | Open in IMG/M |
3300017972|Ga0187781_10838371 | Not Available | 668 | Open in IMG/M |
3300017975|Ga0187782_11412370 | Not Available | 547 | Open in IMG/M |
3300018035|Ga0187875_10358922 | Not Available | 782 | Open in IMG/M |
3300018038|Ga0187855_10102921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1724 | Open in IMG/M |
3300018058|Ga0187766_10408455 | Not Available | 899 | Open in IMG/M |
3300018085|Ga0187772_11403490 | Not Available | 518 | Open in IMG/M |
3300018089|Ga0187774_10221031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 1052 | Open in IMG/M |
3300021374|Ga0213881_10178107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 936 | Open in IMG/M |
3300021445|Ga0182009_10199765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 973 | Open in IMG/M |
3300021479|Ga0210410_11280332 | Not Available | 625 | Open in IMG/M |
3300022504|Ga0242642_1064207 | Not Available | 593 | Open in IMG/M |
3300022530|Ga0242658_1111648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 667 | Open in IMG/M |
3300022530|Ga0242658_1144053 | Not Available | 609 | Open in IMG/M |
3300022716|Ga0242673_1022858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 905 | Open in IMG/M |
3300022717|Ga0242661_1008046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora | 1444 | Open in IMG/M |
3300022718|Ga0242675_1022827 | Not Available | 894 | Open in IMG/M |
3300022724|Ga0242665_10065035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora aureofaciens | 1007 | Open in IMG/M |
3300024283|Ga0247670_1022471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
3300025914|Ga0207671_10537614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 932 | Open in IMG/M |
3300025938|Ga0207704_10019293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3578 | Open in IMG/M |
3300025960|Ga0207651_10679577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina → Amycolatopsis vancoresmycina DSM 44592 | 905 | Open in IMG/M |
3300026497|Ga0257164_1040310 | Not Available | 728 | Open in IMG/M |
3300027030|Ga0208240_1033446 | Not Available | 574 | Open in IMG/M |
3300027064|Ga0208724_1008400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
3300027096|Ga0208099_1038201 | Not Available | 689 | Open in IMG/M |
3300027590|Ga0209116_1029550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1154 | Open in IMG/M |
3300028780|Ga0302225_10369505 | Not Available | 676 | Open in IMG/M |
3300028781|Ga0302223_10191981 | Not Available | 674 | Open in IMG/M |
3300029882|Ga0311368_10323605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1160 | Open in IMG/M |
3300030057|Ga0302176_10359307 | Not Available | 586 | Open in IMG/M |
3300030399|Ga0311353_10307217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
3300030509|Ga0302183_10071239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
3300030548|Ga0210252_10885751 | Not Available | 511 | Open in IMG/M |
3300030618|Ga0311354_11579479 | Not Available | 577 | Open in IMG/M |
3300030625|Ga0210259_11927014 | Not Available | 633 | Open in IMG/M |
3300030629|Ga0210268_1061120 | Not Available | 919 | Open in IMG/M |
3300030738|Ga0265462_10553598 | Not Available | 855 | Open in IMG/M |
3300030973|Ga0075395_11457278 | Not Available | 750 | Open in IMG/M |
3300031549|Ga0318571_10420194 | Not Available | 525 | Open in IMG/M |
3300031561|Ga0318528_10220440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1016 | Open in IMG/M |
3300031572|Ga0318515_10549406 | Not Available | 615 | Open in IMG/M |
3300031640|Ga0318555_10613622 | Not Available | 589 | Open in IMG/M |
3300031680|Ga0318574_10297078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 938 | Open in IMG/M |
3300031680|Ga0318574_10451707 | Not Available | 752 | Open in IMG/M |
3300031708|Ga0310686_114436786 | Not Available | 515 | Open in IMG/M |
3300031708|Ga0310686_116659170 | Not Available | 530 | Open in IMG/M |
3300031708|Ga0310686_117768559 | Not Available | 2023 | Open in IMG/M |
3300031715|Ga0307476_10902401 | Not Available | 652 | Open in IMG/M |
3300031764|Ga0318535_10193125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 910 | Open in IMG/M |
3300031765|Ga0318554_10459364 | Not Available | 721 | Open in IMG/M |
3300031768|Ga0318509_10282546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 928 | Open in IMG/M |
3300031794|Ga0318503_10047127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1305 | Open in IMG/M |
3300031795|Ga0318557_10081679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1409 | Open in IMG/M |
3300031795|Ga0318557_10284157 | Not Available | 759 | Open in IMG/M |
3300031819|Ga0318568_10651516 | Not Available | 655 | Open in IMG/M |
3300031819|Ga0318568_10804372 | Not Available | 583 | Open in IMG/M |
3300031823|Ga0307478_11652065 | Not Available | 528 | Open in IMG/M |
3300031845|Ga0318511_10385944 | Not Available | 641 | Open in IMG/M |
3300031845|Ga0318511_10393049 | Not Available | 635 | Open in IMG/M |
3300031860|Ga0318495_10455219 | Not Available | 561 | Open in IMG/M |
3300031860|Ga0318495_10535357 | Not Available | 510 | Open in IMG/M |
3300031879|Ga0306919_10875607 | Not Available | 689 | Open in IMG/M |
3300031896|Ga0318551_10010675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3973 | Open in IMG/M |
3300031896|Ga0318551_10277231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 940 | Open in IMG/M |
3300031896|Ga0318551_10638368 | Not Available | 615 | Open in IMG/M |
3300031941|Ga0310912_11046896 | Not Available | 625 | Open in IMG/M |
3300031945|Ga0310913_10102571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1937 | Open in IMG/M |
3300031954|Ga0306926_12951049 | Not Available | 509 | Open in IMG/M |
3300031981|Ga0318531_10122829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1153 | Open in IMG/M |
3300032009|Ga0318563_10297719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 872 | Open in IMG/M |
3300032035|Ga0310911_10157557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1280 | Open in IMG/M |
3300032035|Ga0310911_10862386 | Not Available | 523 | Open in IMG/M |
3300032041|Ga0318549_10047473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
3300032043|Ga0318556_10197799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1045 | Open in IMG/M |
3300032063|Ga0318504_10484875 | Not Available | 592 | Open in IMG/M |
3300032064|Ga0318510_10290171 | Not Available | 680 | Open in IMG/M |
3300032076|Ga0306924_10221660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 2172 | Open in IMG/M |
3300032076|Ga0306924_11354853 | Not Available | 761 | Open in IMG/M |
3300032090|Ga0318518_10158319 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300032090|Ga0318518_10431461 | Not Available | 675 | Open in IMG/M |
3300032090|Ga0318518_10708805 | Not Available | 512 | Open in IMG/M |
3300032756|Ga0315742_10358402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
3300032895|Ga0335074_10745652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
3300032898|Ga0335072_10611414 | Not Available | 1092 | Open in IMG/M |
3300032955|Ga0335076_11004267 | Not Available | 717 | Open in IMG/M |
3300033289|Ga0310914_10837922 | Not Available | 818 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.45% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.65% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.03% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.61% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010120 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010121 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24743J22301_100571302 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCHILY |
Ga0058903_15135201 | 3300004103 | Forest Soil | MTSWSEAAFDAYLPADMVLGQADIGVVVADRLANLLFLNEYAVR |
Ga0070732_109097611 | 3300005542 | Surface Soil | MTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLND |
Ga0066696_106231711 | 3300006032 | Soil | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNLLYLNEFAA |
Ga0075434_1006653361 | 3300006871 | Populus Rhizosphere | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNILY |
Ga0126373_101674731 | 3300010048 | Tropical Forest Soil | VTTWDEAAFDAYLPADMVLGQADIGVLVADRLGHVLFLNEYAARLFRIPDGV |
Ga0126373_118287532 | 3300010048 | Tropical Forest Soil | MTRWNEDAFDPSLPAEMVLRQAEIGVVVTDRRSNIRFVNEYVT |
Ga0127451_10087461 | 3300010120 | Grasslands Soil | VTGWSEPAFDAYLPADMVLDHADIAVVVTDRLCNL |
Ga0127438_10059462 | 3300010121 | Grasslands Soil | VTGWGDAAFGAYLPADMVLGHADIAVVVTDRLSNL |
Ga0127484_11020502 | 3300010134 | Grasslands Soil | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNILYVNDF |
Ga0099796_101189821 | 3300010159 | Vadose Zone Soil | VTGWGEAAFDPYLPADMVLDHADIAVVVTDRLCNLLYV |
Ga0134065_103834682 | 3300010326 | Grasslands Soil | VTGWSEPAFDAYLPADMVLDHADIAVVVTDRLCNLLYV |
Ga0126381_1009744091 | 3300010376 | Tropical Forest Soil | VTGWGEAAFDAYLPADMVLAHADIAVVVTDRLSNLLYVN |
Ga0138592_10621992 | 3300011069 | Peatlands Soil | VTGWGEAAFDAYLPADTVLGQADIAVVVTDRLGNLLFV |
Ga0138568_11157162 | 3300011080 | Peatlands Soil | MTSWGEGAFDAYLPADMVLGQAEIGVVVADRLSNLL |
Ga0138570_11814661 | 3300011087 | Peatlands Soil | MTSWGEGAFDAYLPADMVLGQAEIGVVVADRLSNLLFVNE |
Ga0150983_107440871 | 3300011120 | Forest Soil | MTSWGAAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAVRLFRLPGDV |
Ga0150983_129470201 | 3300011120 | Forest Soil | MTSRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAVRLFRLPGDV |
Ga0137389_100395365 | 3300012096 | Vadose Zone Soil | VTDWGEAAFDAYLPADMVLSQADIAVVVTDRLSNLLYVN |
Ga0137365_111983291 | 3300012201 | Vadose Zone Soil | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNILYVND |
Ga0137369_108649641 | 3300012355 | Vadose Zone Soil | VTGWGEAAFDAYLPADMVLDHAAIAVVVTDRLCNILYVNDFAA |
Ga0137384_111140532 | 3300012357 | Vadose Zone Soil | LGSAGVTGWGEAAFDAYLPADMVLGHADIGVVVTDRLSNLLYV |
Ga0157313_10210062 | 3300012503 | Arabidopsis Rhizosphere | GSASVTGWGEAAFDEYLPADMVLDHADIAVVVTDRLCNVLYVKE* |
Ga0157316_10106462 | 3300012510 | Arabidopsis Rhizosphere | VTGWGEAAFDAYLPADMVLDHAEIAVVVTDGLCNILY |
Ga0137395_103198991 | 3300012917 | Vadose Zone Soil | VTVWGEAAFDAYLPADVVLGQADIAVVVTDRLSNLLYINDYA |
Ga0137413_102032751 | 3300012924 | Vadose Zone Soil | VTGWGDAAFDAYLPADMVLGHADIAVVVTDRLSNLIYLNDFA |
Ga0134077_103867962 | 3300012972 | Grasslands Soil | VTGWGEAAFDPYLPADMVLDHADIAVVVTDRLCNLLYVN |
Ga0163163_123186881 | 3300014325 | Switchgrass Rhizosphere | VTGWGDAAFDAYLPAEMVLGYADIAVIVTDQLSNLL |
Ga0181525_102063223 | 3300014654 | Bog | MNSWSKAAFDAYLPADMVLGQADIGVVVADRLSNL |
Ga0182040_116925361 | 3300016387 | Soil | MTSWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLFLNEY |
Ga0182037_112996671 | 3300016404 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLL |
Ga0187812_12404601 | 3300017821 | Freshwater Sediment | MTSWGEGAFDAYLPADMVLCQAEIGVVVADRLSNLLFVNEYAARLFR |
Ga0187807_12029132 | 3300017926 | Freshwater Sediment | MTSWGEGAFDAYLPADMVLGQAEIGVVVADRLSNLLFVNEYAARLFRITGDVS |
Ga0187809_101210142 | 3300017937 | Freshwater Sediment | MTSEGEAAFDAYLPADMVLGQADIGVLVADRLGHVL |
Ga0187808_104197092 | 3300017942 | Freshwater Sediment | MTSGGEAAFDAYLPADMVLGQADIGVLVADRLGHVLFL |
Ga0187779_113456182 | 3300017959 | Tropical Peatland | MTGWGQRDEAAFDAYLPAEEILGHADMAVLVADRLSNLKYANEY |
Ga0187778_109135212 | 3300017961 | Tropical Peatland | MTGRGETAFGAYLAADMVLGQADIAVVVTDRLGRLRYVNDFAARLL |
Ga0187778_111548082 | 3300017961 | Tropical Peatland | MTGWGQRDGAAFDAYLPAEEILGQADIAVVVADRLSNLTYVNDYA |
Ga0187781_108383712 | 3300017972 | Tropical Peatland | MTSWGEGAFDAHLPADMVLGQAEIGVVVADRLGNLLFVNEYA |
Ga0187782_114123701 | 3300017975 | Tropical Peatland | VTDWGEAAFDAYLPADMVLGQADIAVIVTDRLSNLLYINDFAAKLF |
Ga0187875_103589221 | 3300018035 | Peatland | VTGWGDAGFDAYLPAEMVLGYADIAVVVTDRLSNILYLNG |
Ga0187855_101029213 | 3300018038 | Peatland | VTGWGEAAFDAYLPADMVLAQADIAVVVTDRLSNLLYINEYAVGLFR |
Ga0187766_104084551 | 3300018058 | Tropical Peatland | MTTWDEAAFDAHLPADMVLGQADIGVVVADRFGNLLFLNEYAAR |
Ga0187772_114034901 | 3300018085 | Tropical Peatland | MTSWGEGAFDAYLPADMVLGQAEIGVVVADRLGNLLFVNEYAARLFRVT |
Ga0187774_102210311 | 3300018089 | Tropical Peatland | VTGWGEAAFDAYLPADMVLGQADVAVVVTDRLSNIRYVNDFA |
Ga0213881_101781072 | 3300021374 | Exposed Rock | VTSWGDAAFDAYLPAEMVLGHADIAVIVTDRLSNLLYLNEF |
Ga0182009_101997652 | 3300021445 | Soil | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNIL |
Ga0210410_112803321 | 3300021479 | Soil | MTRRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAVRLFRLP |
Ga0242642_10642071 | 3300022504 | Soil | VTGWGEAAFDAYLPADMVLGHAEIAVVVTDRLCNLLYVN |
Ga0242658_11116482 | 3300022530 | Soil | MTSWGEGAFDAYLPAEMVLSQADIGIVVADRFSNLLFLNS |
Ga0242658_11440531 | 3300022530 | Soil | VTGWGEAAFDAYLPADMVLGHADIAVVVTDRLCNLLYVNEFA |
Ga0242673_10228582 | 3300022716 | Soil | VTGLGEAAFDAYLPADMVLDHADIAIVVTDRLCNLLYVNEFA |
Ga0242661_10080462 | 3300022717 | Soil | MTSRGEAAFDAYLPADMVLGQADIGVVVADRLGDLLFLND |
Ga0242675_10228271 | 3300022718 | Soil | MTSRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAVRLFRLPGD |
Ga0242665_100650351 | 3300022724 | Soil | VTGWTESAFDAYLPADMVLDHADIAVVVTDRLCNLLYVNNFA |
Ga0247670_10224711 | 3300024283 | Soil | VTGWGEAAFDAYLPADMVLDHADIAVVVTDGLCNIL |
Ga0207671_105376141 | 3300025914 | Corn Rhizosphere | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCHIL |
Ga0207704_100192931 | 3300025938 | Miscanthus Rhizosphere | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNILYVNDFA |
Ga0207651_106795772 | 3300025960 | Switchgrass Rhizosphere | VTGWGEAAFDAYLPADMVLDHADIAVVVTDRLCNILYV |
Ga0257164_10403101 | 3300026497 | Soil | VTGWGEAAFDPYLPADMVLDHADIAVVVTDRLCNLV |
Ga0208240_10334461 | 3300027030 | Forest Soil | VPGWGEAAFDAYLPADMVLGHADIAVVVTDRLSNLL |
Ga0208724_10084001 | 3300027064 | Forest Soil | VPSWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLLYINEYAVG |
Ga0208099_10382011 | 3300027096 | Forest Soil | MTRWGEAAFDAYLPADMVLGQADIAVVVADRLSNLLFLN |
Ga0209116_10295503 | 3300027590 | Forest Soil | VPGPGEAAFDAYLPADLVLGQADIGVIVADRLGNLLYV |
Ga0302225_103695051 | 3300028780 | Palsa | VTGWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLLYINEYAV |
Ga0302223_101919811 | 3300028781 | Palsa | MNSWSKAAFDAYLPADMVLGQADIGVVVADRLSNLLYLNEYAA |
Ga0311368_103236051 | 3300029882 | Palsa | VPAWGEAAFDAYLPADMVLSQADIAVVVTDRLSNLLYVNE |
Ga0302176_103593072 | 3300030057 | Palsa | VPGWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLLYINEYA |
Ga0311353_103072171 | 3300030399 | Palsa | VPGWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLL |
Ga0302183_100712391 | 3300030509 | Palsa | VTSWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLLYINE |
Ga0210252_108857512 | 3300030548 | Soil | MTSCGEAAFDAYLPAEMVLGQADIGVVVADRLSNLLFLKEYAVRLF |
Ga0311354_115794792 | 3300030618 | Palsa | MNSWSKAAFDAYLPADMVLGQADIGVVVADRLSNLLYLNEYAAWLFRV |
Ga0210259_119270141 | 3300030625 | Soil | VTDWSEAPFDAYLPADMVLGQADIAVVVTDRLSNLLYINEYAA |
Ga0210268_10611202 | 3300030629 | Soil | MTSCGEAAFDAYLPAEMVLGQADIGVVVADRLSNLLFLNEYAVRLFRIPGD |
Ga0265462_105535981 | 3300030738 | Soil | VTGWDNGAFDAYLPADMVLAQADIAVVVTDRLSNLLYVNE |
Ga0075395_114572781 | 3300030973 | Soil | VTGWGEAAFDAYLPADVVLGHADIAVVVTDRLCNLLYVNDFAA |
Ga0318571_104201941 | 3300031549 | Soil | VTGLGEAASDAYLPAGANLGYADIAVVVADRLGTI |
Ga0318528_102204401 | 3300031561 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAARLFRIPDDVS |
Ga0318515_105494062 | 3300031572 | Soil | VTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLND |
Ga0318555_106136222 | 3300031640 | Soil | VTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNDYGARLF |
Ga0318574_102970781 | 3300031680 | Soil | VTSWGEAAFDAYLPADTVLGQADIGVVVADRLGNLLFLNDYGPRR |
Ga0318574_104517072 | 3300031680 | Soil | VTGLDEAASDACLPADMVLEQADIAVVVTDRLSNLRYVN |
Ga0310686_1144367862 | 3300031708 | Soil | MLPGPGSVRVTGWGEAAFDAYLPADMVLGQADIAVVVTDRLSNLLYVNN |
Ga0310686_1166591701 | 3300031708 | Soil | MTSWGDGAFDAYLPADMVLGQADIGVVVADRLGNLL |
Ga0310686_1177685594 | 3300031708 | Soil | MTGWDAGAFDAYLPADMVLGQADIGVLVADRLSNLLYL |
Ga0307476_109024012 | 3300031715 | Hardwood Forest Soil | MTSWGEGAFDAYLPAEMVLGQADIGVVVADRLCNLLYLNEYAAR |
Ga0318535_101931251 | 3300031764 | Soil | VTTWGEAAFDAYLPADTVLGQADIGVVVADRLGHLLFL |
Ga0318554_104593642 | 3300031765 | Soil | VTSRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEY |
Ga0318509_102825461 | 3300031768 | Soil | MTSWGEAAFDAYLPADMVLGQADIGIVVADRLGHL |
Ga0318503_100471271 | 3300031794 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLF |
Ga0318557_100816793 | 3300031795 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLFLNEYGTRLFRIPGDE |
Ga0318557_102841572 | 3300031795 | Soil | VTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLL |
Ga0318568_106515161 | 3300031819 | Soil | VTGWGDGAFDAYLPAGMVLGHADIAVVVTDRLAHLRYVNE |
Ga0318568_108043722 | 3300031819 | Soil | VTGLDEAASDACLPADMVLEQADIAVVVTDRLSNLRYVNDFAARLF |
Ga0307478_116520652 | 3300031823 | Hardwood Forest Soil | MTSRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAVRLFRLP |
Ga0318511_103859442 | 3300031845 | Soil | VTGWGDGAFDAYLPAGMVLGHADIAVVVTDRLGHLRYV |
Ga0318511_103930492 | 3300031845 | Soil | VTSWGEAGFDAYLPADMVLGQADIGIVVADRLGNL |
Ga0318495_104552191 | 3300031860 | Soil | MTSGGEAAFDAHLPADMVLGQADIGVLAADRLGHVLF |
Ga0318495_105353572 | 3300031860 | Soil | MTSWGEAAFDAYLPADMVLGQADIGIVVADRLGHLLFLNE |
Ga0306919_108756071 | 3300031879 | Soil | VTSWGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNDYGAR |
Ga0318551_100106755 | 3300031896 | Soil | MTGRGEDAFDGHLPADTVLGQADIGVLAADRCGTLLYVNEYAG |
Ga0318551_102772311 | 3300031896 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGRLL |
Ga0318551_106383681 | 3300031896 | Soil | VTGLGEAASDAYLPAGANLGYADIAVVVADRLGTIRYVNEFAVRLLR |
Ga0310912_110468961 | 3300031941 | Soil | VTSWGEAAFDAYLPADMVLGQADIGVVVADQLGNLLFLNDYGARL |
Ga0310913_101025713 | 3300031945 | Soil | MTGWSEAAFDARQPAGTVLDHADIAVVVADRLGNLRYVNDF |
Ga0306926_129510491 | 3300031954 | Soil | VTSRGEAAFDAYLPADMVLGQADIGVVVADRLGNLLFLNE |
Ga0318531_101228292 | 3300031981 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLFLNEYGTRLFRIPGDA |
Ga0318563_102977191 | 3300032009 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGRLLFLNEYGTR |
Ga0310911_101575571 | 3300032035 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLFLNEYGTRLFR |
Ga0310911_108623862 | 3300032035 | Soil | VTGLGEAASDAYLPAGANLGYADIAVVVADRLGTIR |
Ga0318549_100474733 | 3300032041 | Soil | MTGRGEDAFDGHLPTDTVLGQADIGVLAADRFGNLLY |
Ga0318556_101977992 | 3300032043 | Soil | VTSWGEAAFDAYLPADTVLGQADIGVVVADRLGNLLFLNEYGARL |
Ga0318504_104848752 | 3300032063 | Soil | VTSWGEAGFDAYLPADMVLGQADIGVVVADRLGNLLFL |
Ga0318510_102901711 | 3300032064 | Soil | MTSWGEAAFDAYLPADMVLGQADIGIVVADRLGHLLF |
Ga0306924_102216604 | 3300032076 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGRLLFLNEY |
Ga0306924_113548531 | 3300032076 | Soil | VTGWGDGAFDAYLPAGMVLGHADIAVVVTDRLGHL |
Ga0318518_101583191 | 3300032090 | Soil | VTTWGEAASDAYLPADMVLGQADIAVVVADRLGHLQ |
Ga0318518_104314611 | 3300032090 | Soil | VTSWGEAGFDAYLPADMVLGQADIGVVVADRLGNLLFLNEYAARL |
Ga0318518_107088052 | 3300032090 | Soil | VTGLDEAASDACLPADMVLEQADIAVVVTDRLSNLRYVNDF |
Ga0315742_103584021 | 3300032756 | Forest Soil | MMAWGSWDEGAFDAYLPSNMILGMADIAVIVADRLTNLL |
Ga0335074_107456521 | 3300032895 | Soil | MTSWGEAAFDAYLPPDMVLGQADIGVVVADRLGTLLFLNEYAARLFRIAD |
Ga0335072_106114143 | 3300032898 | Soil | MTSWGEAGFDAYLPPDMVLGQADIGVVVADRLGTLLFLNEYAARLFRIAD |
Ga0335076_110042671 | 3300032955 | Soil | MTSWGEAAFDAYLPPDMVLGQADIGVVVADRLGTLLFLNEYAARLFRIA |
Ga0310914_108379222 | 3300033289 | Soil | VTTWGEAAFDAYLPADMVLGQADIGVVVADRLGHLLFLNEYGTRLFRIPGDES |
⦗Top⦘ |