Metagenome / Metatranscriptome Family F068517

Basic Information
Family ID	F068517
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	40 residues
Representative Sequence	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK
Number of Associated Samples	98
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	83.87 %
% of genes near scaffold ends (potentially truncated)	22.58 %
% of genes from short scaffolds (< 2000 bps)	72.58 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Bacteria (74.194 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.097 % of family members)
Environment Ontology (ENVO)	Unclassified (29.032 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (61.290 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF02737	3HCDH_N	34.68
PF00696	AA_kinase	19.35
PF13840	ACT_7	8.87
PF01842	ACT	6.45
PF01494	FAD_binding_3	4.84
PF00753	Lactamase_B	4.84
PF01717	Meth_synt_2	2.42
PF13185	GAF_2	1.61
PF02518	HATPase_c	1.61
PF13924	Lipocalin_5	0.81
PF13763	DUF4167	0.81
PF14534	DUF4440	0.81
PF00171	Aldedh	0.81
PF14833	NAD_binding_11	0.81
PF04279	IspA	0.81
PF13847	Methyltransf_31	0.81
PF13561	adh_short_C2	0.81
PF14079	DUF4260	0.81

COG ID	Name	Functional Category	% Frequency in 124 Family Scaffolds
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	34.68
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	34.68
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	34.68
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	34.68
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	34.68
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	34.68
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	34.68
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	9.68
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	4.84
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	4.84
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	4.84
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	2.42
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.81
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.81
COG2917	Intracellular septation protein A	Cell cycle control, cell division, chromosome partitioning [D]	0.81
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.81 %
Unclassified	root	N/A	24.19 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.81 %
Unclassified	root	N/A	24.19 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	74.19 %
Unclassified	root	N/A	24.19 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.61 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	58.06 %
Unclassified	root	N/A	24.19 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.61 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.81 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.81 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.81 %
Unclassified	root	N/A	24.19 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.61 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.81 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.81 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.81 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	45.16 %
Unclassified	root	N/A	24.19 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1.61 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.81 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.81 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	19.35 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.61 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.81 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.81 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	18.55 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	1.61 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.81 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.81 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	1.61 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.81 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.81 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.81 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.81 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.81 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.81 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.81 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.81 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Strongyloididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae	0.81 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Parastrongyloides	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides	0.81 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.19 %
Rhodoplanes roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	18.55 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1.61 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.81 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.81 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004092\|Ga0062389_102228178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	721	Open in IMG/M
3300004092\|Ga0062389_103371993	Not Available	599	Open in IMG/M
3300004092\|Ga0062389_103378317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	598	Open in IMG/M
3300004635\|Ga0062388_100041465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2924	Open in IMG/M
3300005332\|Ga0066388_100024324	All Organisms → cellular organisms → Bacteria → Proteobacteria	5452	Open in IMG/M
3300005332\|Ga0066388_102256484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	984	Open in IMG/M
3300005339\|Ga0070660_101956966	Not Available	500	Open in IMG/M
3300005363\|Ga0008090_15489000	Not Available	756	Open in IMG/M
3300005435\|Ga0070714_100172494	All Organisms → cellular organisms → Bacteria → Proteobacteria	1964	Open in IMG/M
3300005436\|Ga0070713_100945801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	830	Open in IMG/M
3300005531\|Ga0070738_10010650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8253	Open in IMG/M
3300005534\|Ga0070735_10681078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	608	Open in IMG/M
3300005537\|Ga0070730_10441614	Not Available	839	Open in IMG/M
3300005541\|Ga0070733_10029963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3393	Open in IMG/M
3300005541\|Ga0070733_10526094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	792	Open in IMG/M
3300005591\|Ga0070761_10872717	Not Available	568	Open in IMG/M
3300005602\|Ga0070762_10286007	All Organisms → cellular organisms → Bacteria	1035	Open in IMG/M
3300005610\|Ga0070763_10278741	Not Available	913	Open in IMG/M
3300005764\|Ga0066903_100443320	All Organisms → cellular organisms → Bacteria → Proteobacteria	2165	Open in IMG/M
3300005764\|Ga0066903_106432601	Not Available	613	Open in IMG/M
3300005921\|Ga0070766_10138469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	1479	Open in IMG/M
3300006893\|Ga0073928_10053201	All Organisms → cellular organisms → Bacteria → Proteobacteria	3634	Open in IMG/M
3300006893\|Ga0073928_10139319	All Organisms → cellular organisms → Bacteria	1972	Open in IMG/M
3300009521\|Ga0116222_1202747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	854	Open in IMG/M
3300009632\|Ga0116102_1171488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	590	Open in IMG/M
3300009633\|Ga0116129_1122013	Not Available	747	Open in IMG/M
3300009672\|Ga0116215_1088669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	1387	Open in IMG/M
3300009764\|Ga0116134_1032950	Not Available	2047	Open in IMG/M
3300009824\|Ga0116219_10034590	Not Available	3034	Open in IMG/M
3300010373\|Ga0134128_11043206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	903	Open in IMG/M
3300010379\|Ga0136449_100045480	All Organisms → cellular organisms → Bacteria	10030	Open in IMG/M
3300010379\|Ga0136449_100722608	All Organisms → cellular organisms → Bacteria → Proteobacteria	1665	Open in IMG/M
3300010396\|Ga0134126_11473062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	751	Open in IMG/M
3300010398\|Ga0126383_10412656	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	1390	Open in IMG/M
3300010398\|Ga0126383_11917563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	680	Open in IMG/M
3300012989\|Ga0164305_11442511	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300014168\|Ga0181534_10948794	Not Available	517	Open in IMG/M
3300014169\|Ga0181531_10747806	Not Available	609	Open in IMG/M
3300014199\|Ga0181535_10034782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3676	Open in IMG/M
3300014200\|Ga0181526_10981515	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300014501\|Ga0182024_10025101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10546	Open in IMG/M
3300014501\|Ga0182024_10092317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4450	Open in IMG/M
3300014501\|Ga0182024_10797503	Not Available	1151	Open in IMG/M
3300014654\|Ga0181525_10005424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9504	Open in IMG/M
3300015372\|Ga0132256_102462764	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300016445\|Ga0182038_11585704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	589	Open in IMG/M
3300017943\|Ga0187819_10182776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	1241	Open in IMG/M
3300017944\|Ga0187786_10594076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	519	Open in IMG/M
3300017946\|Ga0187879_10047585	All Organisms → cellular organisms → Bacteria → Proteobacteria	2533	Open in IMG/M
3300017955\|Ga0187817_10244856	Not Available	1142	Open in IMG/M
3300017970\|Ga0187783_10117037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1964	Open in IMG/M
3300017970\|Ga0187783_10205149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1447	Open in IMG/M
3300017970\|Ga0187783_10468133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	914	Open in IMG/M
3300017970\|Ga0187783_10495229	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300017972\|Ga0187781_10001126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20083	Open in IMG/M
3300017972\|Ga0187781_10732021	Not Available	716	Open in IMG/M
3300017975\|Ga0187782_10870307	Not Available	698	Open in IMG/M
3300017975\|Ga0187782_11186285	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300017988\|Ga0181520_10030320	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5700	Open in IMG/M
3300017988\|Ga0181520_10358798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	1070	Open in IMG/M
3300018001\|Ga0187815_10120101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1110	Open in IMG/M
3300018008\|Ga0187888_1016452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4042	Open in IMG/M
3300018014\|Ga0187860_1004250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10844	Open in IMG/M
3300018020\|Ga0187861_10253133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	767	Open in IMG/M
3300018033\|Ga0187867_10511177	Not Available	660	Open in IMG/M
3300018047\|Ga0187859_10128560	Not Available	1337	Open in IMG/M
3300018062\|Ga0187784_10165946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1803	Open in IMG/M
3300018085\|Ga0187772_10019586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3864	Open in IMG/M
3300018086\|Ga0187769_11474600	Not Available	514	Open in IMG/M
3300018090\|Ga0187770_11014428	Not Available	668	Open in IMG/M
3300020582\|Ga0210395_10001998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	15901	Open in IMG/M
3300021088\|Ga0210404_10479891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	701	Open in IMG/M
3300021171\|Ga0210405_10499711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	953	Open in IMG/M
3300021180\|Ga0210396_10671420	All Organisms → cellular organisms → Bacteria	897	Open in IMG/M
3300021402\|Ga0210385_10924988	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300021402\|Ga0210385_11296655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	558	Open in IMG/M
3300021405\|Ga0210387_11571007	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300021406\|Ga0210386_11618559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	537	Open in IMG/M
3300021420\|Ga0210394_11203741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	650	Open in IMG/M
3300021474\|Ga0210390_10135724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	2068	Open in IMG/M
3300021474\|Ga0210390_11446004	Not Available	546	Open in IMG/M
3300022557\|Ga0212123_10161483	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1714	Open in IMG/M
3300025320\|Ga0209171_10265342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	932	Open in IMG/M
3300025898\|Ga0207692_10521312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	756	Open in IMG/M
3300025929\|Ga0207664_10816902	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300027641\|Ga0208827_1110818	Not Available	803	Open in IMG/M
3300027854\|Ga0209517_10049261	Not Available	3204	Open in IMG/M
3300027855\|Ga0209693_10186033	Not Available	1023	Open in IMG/M
3300027867\|Ga0209167_10042528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2214	Open in IMG/M
3300027889\|Ga0209380_10341004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	880	Open in IMG/M
3300027894\|Ga0209068_10430935	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300027905\|Ga0209415_10291344	Not Available	1418	Open in IMG/M
3300027965\|Ga0209062_1025505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3401	Open in IMG/M
3300028906\|Ga0308309_11441006	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	589	Open in IMG/M
3300030043\|Ga0302306_10042410	All Organisms → cellular organisms → Bacteria	1813	Open in IMG/M
3300030659\|Ga0316363_10072561	All Organisms → cellular organisms → Bacteria → Proteobacteria	1580	Open in IMG/M
3300030730\|Ga0307482_1107720	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300031234\|Ga0302325_10017811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14993	Open in IMG/M
3300031234\|Ga0302325_11098422	All Organisms → cellular organisms → Bacteria	1072	Open in IMG/M
3300031573\|Ga0310915_10956810	Not Available	599	Open in IMG/M
3300031708\|Ga0310686_102990738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28530	Open in IMG/M
3300031708\|Ga0310686_114015144	Not Available	566	Open in IMG/M
3300031708\|Ga0310686_116986730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1298	Open in IMG/M
3300031719\|Ga0306917_10219134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1448	Open in IMG/M
3300031777\|Ga0318543_10334652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	678	Open in IMG/M
3300031823\|Ga0307478_10310046	Not Available	1294	Open in IMG/M
3300031890\|Ga0306925_10972402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	868	Open in IMG/M
3300031941\|Ga0310912_11361425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes roseus	537	Open in IMG/M
3300031947\|Ga0310909_10033015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3861	Open in IMG/M
3300031954\|Ga0306926_10562402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1396	Open in IMG/M
3300032076\|Ga0306924_10078690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3692	Open in IMG/M
3300032160\|Ga0311301_10061560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8182	Open in IMG/M
3300032515\|Ga0348332_12600908	All Organisms → cellular organisms → Bacteria	520	Open in IMG/M
3300032515\|Ga0348332_13911384	Not Available	662	Open in IMG/M
3300032515\|Ga0348332_14309342	Not Available	757	Open in IMG/M
3300032770\|Ga0335085_10002733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	32221	Open in IMG/M
3300032805\|Ga0335078_10056083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5808	Open in IMG/M
3300032805\|Ga0335078_10069088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5169	Open in IMG/M
3300032805\|Ga0335078_10490016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1583	Open in IMG/M
3300032892\|Ga0335081_12004198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	617	Open in IMG/M
3300032895\|Ga0335074_10056038	All Organisms → cellular organisms → Bacteria → Proteobacteria	5402	Open in IMG/M
3300032955\|Ga0335076_10207835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1859	Open in IMG/M
3300033134\|Ga0335073_10020003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9334	Open in IMG/M
3300033134\|Ga0335073_11412371	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.39%
Host-Associated	Host-Associated	1.61%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	75.81%
Aquatic	Environmental → Aquatic	22.58%
Plants	Host-Associated → Plants	1.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	70.97%
Freshwater	Environmental → Aquatic → Freshwater	18.55%
Thermal Springs	Environmental → Aquatic → Thermal Springs	3.23%
Peat	Environmental → Terrestrial → Peat	2.42%
Plant Litter	Environmental → Terrestrial → Plant Litter	2.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.61%
Sediment	Environmental → Aquatic → Sediment	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	20.16%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	18.55%
Loam	Environmental → Terrestrial → Soil → Loam	12.10%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	3.23%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	2.42%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	2.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.61%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.74%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	17.74%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	13.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.87%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.23%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.23%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.42%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.42%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.42%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	2.42%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	2.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.61%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.81%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.81%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	12.10%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	10.48%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	8.06%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	7.26%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	5.65%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.65%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	5.65%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	4.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.03%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	3.23%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.23%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.23%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.23%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	2.42%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.42%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	2.42%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.42%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	2.42%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.61%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.61%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.81%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004092	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental	Open in IMG/M
3300009632	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40	Environmental	Open in IMG/M
3300009633	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10	Environmental	Open in IMG/M
3300009672	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG	Environmental	Open in IMG/M
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental	Open in IMG/M
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental	Open in IMG/M
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental	Open in IMG/M
3300014199	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG	Environmental	Open in IMG/M
3300014200	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014654	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300017988	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG	Environmental	Open in IMG/M
3300018001	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5	Environmental	Open in IMG/M
3300018008	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40	Environmental	Open in IMG/M
3300018014	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40	Environmental	Open in IMG/M
3300018020	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100	Environmental	Open in IMG/M
3300018033	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10	Environmental	Open in IMG/M
3300018047	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018085	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021474	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025320	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300027641	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)	Environmental	Open in IMG/M
3300027854	Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)	Environmental	Open in IMG/M
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027965	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300030043	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1	Environmental	Open in IMG/M
3300030659	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)	Environmental	Open in IMG/M
3300030730	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F068517

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062389_1022281782	3300004092	Bog Forest Soil	MPILLWIALWSSMTGVATGWQETMLPIRVRGKDRRDQPTD*
Ga0062389_1033719931	3300004092	Bog Forest Soil	MHALMWIAFWSSWMEVARGWQETVSPIRSVVEDRHDRLWQACRAD*
Ga0062389_1033783172	3300004092	Bog Forest Soil	MPILLWIAFWSSMTGVANGWQETMLPIRVKWKDRRDQPSK*
Ga0062388_1000414652	3300004635	Bog Forest Soil	MPILMWIAFWSNVMGIAAGWQETALPIRVRVKDRRDRPTSSTT*
Ga0066388_1000243243	3300005332	Tropical Forest Soil	MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGDT*
Ga0066388_1022564842	3300005332	Tropical Forest Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQSSK*
Ga0070660_1019569662	3300005339	Corn Rhizosphere	MPILLWIAFWSSMTGIANGWQETVLPIRVKGKDRRDHPSE*
Ga0008090_154890001	3300005363	Tropical Rainforest Soil	MPILLWIAFWSSMTGVASSWQEMMLPIRVKGKDRRDQPTE*
Ga0070714_1001724942	3300005435	Agricultural Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGDS*
Ga0070713_1009458011	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGTS*
Ga0070738_100106505	3300005531	Surface Soil	MPILLWIAVWCNLTGIAAGWQETVSPIQASDEARRDRRTA*
Ga0070735_106810782	3300005534	Surface Soil	MPILMWIAFWSGMTGVANGWQETMLPIRVQVEDRRDRASK*
Ga0070730_104416142	3300005537	Surface Soil	MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQPSK*
Ga0070733_100299633	3300005541	Surface Soil	MPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD*
Ga0070733_105260942	3300005541	Surface Soil	MPILMWIAFWSNVMGIAAGWQETALPIRVRAKDRRDRSTSSPT*
Ga0070761_108727171	3300005591	Soil	MPILLWIAFWSSMTGVVRGWQETMLPIRMKVTDRRDQPTE*
Ga0070762_102860072	3300005602	Soil	MPILLWIAFWSSMTGVASGWQETVLPVRVKAKDRRDHRPSE*
Ga0070763_102787411	3300005610	Soil	MPVLMWIAFWSNVMGIAAGWQETALPIRMRAKDRRDRSTSS*
Ga0066903_1004433202	3300005764	Tropical Forest Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDWSSE*
Ga0066903_1064326011	3300005764	Tropical Forest Soil	QFDPPRSKVMPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDQPSE*
Ga0070766_101384692	3300005921	Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK*
Ga0073928_100532012	3300006893	Iron-Sulfur Acid Spring	MPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE*
Ga0073928_101393193	3300006893	Iron-Sulfur Acid Spring	MPILLWIALWSSMTGVATGWRETMLPIRVRGKDRRDQPTD*
Ga0116222_12027471	3300009521	Peatlands Soil	MPILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE*
Ga0116102_11714881	3300009632	Peatland	MRILMWIAFWSSLMGVATSWQGTALPIRVKGNDRRDRP
Ga0116129_11220131	3300009633	Peatland	MAMPALMWVAFWSNLMGVAVGSQETMSPISVRVKDRRDRLIK*
Ga0116215_10886691	3300009672	Peatlands Soil	PILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE*
Ga0116134_10329502	3300009764	Peatland	MPILLWIALWSSMMGVAMGWQESMLPIRVRITDCRDRLTE*
Ga0116219_100345903	3300009824	Peatlands Soil	MELVMPILLWIAFWSNLMGIAAGWQETASPIRVTVKDRRDHSAK*
Ga0134128_110432062	3300010373	Terrestrial Soil	MPILLWIAFWYSMTGVASGWQETMLPIRVKGKDRRDHPGDS*
Ga0136449_10004548010	3300010379	Peatlands Soil	MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRHRPAE*
Ga0136449_1007226082	3300010379	Peatlands Soil	MPILLWIAFWSSMTAVAMGRQETALPIRVRVTDRRDHPAV*
Ga0134126_114730622	3300010396	Terrestrial Soil	MWIALWSSLLGVATGWQETALPIRVGAKDRRDYRKN
Ga0126383_104126562	3300010398	Tropical Forest Soil	GQFDPPSSKVMPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQSSK*
Ga0126383_119175632	3300010398	Tropical Forest Soil	MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRD
Ga0164305_114425111	3300012989	Soil	KVMPILLWIAFWSSMTGVASGWQETMLPIRVKRKDRRDQPSK*
Ga0181534_109487941	3300014168	Bog	MPVLMWVAFWSSLLRVTLGWQETMLPVRIGVKDRRDRPAD*
Ga0181531_107478061	3300014169	Bog	MYILLWIAFWSSMTGVTAGWQETMLPIRVKATDRRDRPT*
Ga0181535_100347826	3300014199	Bog	MPALLWIAFWSNLMGVAMGWQETTLPIRLRDNDRRDRPTNQRSN*
Ga0181526_109815152	3300014200	Bog	MPALLWIAFWSNLTGVARGWQETALPIRVGGDDHRDHPAK*
Ga0182024_1002510112	3300014501	Permafrost	MPILLWIAFWSSMAGVAIGWQETPMPIRVRVTDRRDRPTA*
Ga0182024_100923176	3300014501	Permafrost	MPALLWIAFWSNLMGVAMGWHETVLPIRVRVNDRRDRPTR*
Ga0182024_107975032	3300014501	Permafrost	MPILMWIAFWSNIMGIAAGWQETALPIRVRAKDRRDHSTD*
Ga0181525_100054249	3300014654	Bog	MPALLWIAFWSNLMGVASGWQETALPIRVGVNDRRDRPTK*
Ga0132256_1024627641	3300015372	Arabidopsis Rhizosphere	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRD
Ga0182038_115857042	3300016445	Soil	MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGD
Ga0187819_101827762	3300017943	Freshwater Sediment	MPILLWIAFWSSMTGIANGWQETVLPVRVKAKYRRDQPGE
Ga0187786_105940761	3300017944	Tropical Peatland	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPDNS
Ga0187879_100475852	3300017946	Peatland	MPALLWIAFWSNLMGVAMGWQETVLPIRVRVNDRRDRPTR
Ga0187817_102448563	3300017955	Freshwater Sediment	MPILLWIAFWSSMTGVANGWQETMLPIRVRGKDRRDQPSK
Ga0187783_101170372	3300017970	Tropical Peatland	MPILLWIAFWSSLTGVANGWQETMLPIRVRETDRRDQPTE
Ga0187783_102051492	3300017970	Tropical Peatland	MPVLLWIAFWSNLTGIARGWQETALPIRVRDKDRRDHPTD
Ga0187783_104681332	3300017970	Tropical Peatland	MPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPEK
Ga0187783_104952292	3300017970	Tropical Peatland	MPVLMWIAFWSNLTGIATAWQETVLPIRVRDKDRRDRPTN
Ga0187781_1000112614	3300017972	Tropical Peatland	MPILLWITFWSSMTGVANGWQETMLPIRVKGEDRRDQPHE
Ga0187781_107320212	3300017972	Tropical Peatland	MPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPDK
Ga0187782_108703072	3300017975	Tropical Peatland	MRVLMWIAFWLNLTGIATAWQETVLPIRVRDKDRRDRPTN
Ga0187782_111862851	3300017975	Tropical Peatland	KFDPRKEHVMPVLLWIAFWSNLTGVALGWQETALPIRVRVTDRRDHPDK
Ga0181520_100303203	3300017988	Bog	MPALLWIAFWSNLMGVAMGWQETTLPIRLRDNDRRDRPTNQRSN
Ga0181520_103587982	3300017988	Bog	MYILLWIAFWSSMTGVTAGWQETMLPIRVKATDRRDRPT
Ga0187815_101201012	3300018001	Freshwater Sediment	MPFLLWIAFWSSMTGIANGWQETVLPVRVKAKYRRDQPGE
Ga0187888_10164523	3300018008	Peatland	MPILLWIAFWSSMTGVAMGWQETALPIRVRVTDRRHRPAE
Ga0187860_10042502	3300018014	Peatland	MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRHRPAE
Ga0187861_102531332	3300018020	Peatland	MSILLWIAFWSSMTGVAMGWQETTPPIRVRVTDRRHRPAE
Ga0187867_105111772	3300018033	Peatland	MPLLMWIALWSGLLGVANGWQETVLPVRVGTKDRRDHRPS
Ga0187859_101285601	3300018047	Peatland	ERVVPMLMWIALWSSLLGVASGWQETASPVRVWAKDRRDHRPN
Ga0187784_101659462	3300018062	Tropical Peatland	MPILLWIAFWSSLTGVATGWQDTMLPIRVKETDRRDQPTD
Ga0187772_100195864	3300018085	Tropical Peatland	MPALLWIAFWSNLTGVAVGWQETALPIRVRDKDRRDQPTN
Ga0187769_114746001	3300018086	Tropical Peatland	MPILLWIAFWSNLTGLLACWRETALPIGAGKEDRRDHTNK
Ga0187770_110144282	3300018090	Tropical Peatland	MWIALWSSLLGMASGWQETALPVRVGAKDRRDHQQN
Ga0210395_1000199811	3300020582	Soil	MPILLWIAFWSSMTGVVRGWQETMLPIRMKVTDRRDQPTE
Ga0210404_104798911	3300021088	Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK
Ga0210405_104997111	3300021171	Soil	MPILLWIAFWSSMTGIASGWQETMLPIRVKGKDRRDQSNE
Ga0210396_106714202	3300021180	Soil	MPILLWIAFWSSVTGIAKGWQETVLPVRVKVRDRRDQPPK
Ga0210385_109249882	3300021402	Soil	MPLLMWIALWSGLLGVANGWQETMLPVRVGTKDRRDR
Ga0210385_112966551	3300021402	Soil	MQFDSQKEHAMPILLWVALWSSMTGVAKGWQETMLPIRVKVKDRRDQPTE
Ga0210387_115710071	3300021405	Soil	MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQP
Ga0210386_116185591	3300021406	Soil	WIAFWSSVTGIAKGWQETVLPVRVKVRDRRDQPPK
Ga0210394_112037412	3300021420	Soil	MPILLWVALWSSMTGVAKGWQETMLPISVKVKVKDRRD
Ga0210390_101357241	3300021474	Soil	PILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDQPSK
Ga0210390_114460042	3300021474	Soil	LWIAFWSSMTGVVKGWQETVLPIRVKVTDRRDQPTE
Ga0212123_101614831	3300022557	Iron-Sulfur Acid Spring	MPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE
Ga0209171_102653422	3300025320	Iron-Sulfur Acid Spring	MENVMPILLWIAFWSSMMGVATGWQETMLPIRVKVTGRRDQPTE
Ga0207692_105213122	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGD
Ga0207664_108169022	3300025929	Agricultural Soil	PILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGDS
Ga0208827_11108182	3300027641	Peatlands Soil	MPILLWIAFWSSMTGIANGWQETVLPVRVKAKDRRDQPGE
Ga0209517_100492612	3300027854	Peatlands Soil	MPALLWIAFWSNLMGVAMGWQETALPIRVRVKDRRDRSR
Ga0209693_101860332	3300027855	Soil	MPVLMWIAFWSNVMGIAAGWQETALPIRMRAKDRRDRSTSS
Ga0209167_100425282	3300027867	Surface Soil	MPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD
Ga0209380_103410043	3300027889	Soil	MPILLWIAFWSSMTGVANGWQETMLPIRVKGKDRRDQPSK
Ga0209068_104309352	3300027894	Watersheds	MPILLWIAFWSSMTGVANGWQETMLPIHVKGKDRRDQPSK
Ga0209415_102913441	3300027905	Peatlands Soil	MELVMPILLWIAFWSNLMGIAAGWQETASPIRVTVKDRRDHSAK
Ga0209062_10255053	3300027965	Surface Soil	MPILLWIAVWCNLTGIAAGWQETVSPIQASDEARRDRRTA
Ga0308309_114410061	3300028906	Soil	MPILMWIAFWSNVMGIAAGWQETALPIRMRAKDRRD
Ga0302306_100424101	3300030043	Palsa	MPMLMWIALWSNLLGVASGWQETASPVRLWAKDRRDHRSN
Ga0316363_100725611	3300030659	Peatlands Soil	MSILLWIAFWSSMTGVAMGWQETAPPIRVRVTDRRH
Ga0307482_11077202	3300030730	Hardwood Forest Soil	SKVMPILLWIAFWSSMTGVAKGWQETMLPIRVKGKDRRDQPSK
Ga0302325_1001781111	3300031234	Palsa	MPALLWIAFWSNLMGVAMGWHETVLPIRVRVNDRRDRPTR
Ga0302325_110984222	3300031234	Palsa	MPMLMWIALWSSLLGVASGWQETASPVRLLARDRRDHRPN
Ga0310915_109568101	3300031573	Soil	MPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDQPTE
Ga0310686_10299073819	3300031708	Soil	MPILLWIAFWSSMTGVAKGWQETVLPIRVKVTDRRDQPTE
Ga0310686_1140151441	3300031708	Soil	MPILMWIAFWSNMMGVAAGWQETALPIRVTAKDRRDRSTSSTSIGHS
Ga0310686_1169867302	3300031708	Soil	MPVLLWIAFWSSMSGIAMGWQETALPVRIKDKGRHDRPVT
Ga0306917_102191342	3300031719	Soil	MPILLWIAFWSSMTGVASSWQETMLPIRVKGKDRRDPPSE
Ga0318543_103346522	3300031777	Soil	MPILLWIAFWSSMTGVASGWQETLLPIRVKGTDHRDHPGDT
Ga0307478_103100462	3300031823	Hardwood Forest Soil	MPILLWIAFWSSMTGVAKGWQETTLPIRVKVTDRRDQPTE
Ga0306925_109724022	3300031890	Soil	MVMPILLWIAFWSSMTGVASGWQETVLPVRLKAKDRRDRTSE
Ga0310912_113614252	3300031941	Soil	MPILLWIAFWSSMTGVASGWQETVLPVRLKAKDRRDRTSE
Ga0310909_100330153	3300031947	Soil	MPILLWIAFWSSMTGVASSWQETMLPIRVKRKDRRDQPTE
Ga0306926_105624022	3300031954	Soil	MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHPGDT
Ga0306924_100786901	3300032076	Soil	MPILLWIAFWSSMTGVASGWQETVLPIRVKGTDHRDHP
Ga0311301_100615602	3300032160	Peatlands Soil	MSILLWIAFWSNLMGIAAGWQETASPIRVRAKDRRDRSAK
Ga0348332_126009081	3300032515	Plant Litter	ERVMPILLWIAFWSSMTGVAKGWQETVLPIRVKVTDRRDQPTE
Ga0348332_139113841	3300032515	Plant Litter	AKEARMPLLMWIAFWSNLTGIAMGWQETALPIRVRNKDRRDRPTD
Ga0348332_143093421	3300032515	Plant Litter	MLMWIALWSSLLGVASGWQETASPVRVWAKDRRDHRPN
Ga0335085_1000273321	3300032770	Soil	MPILIWITFWSNLMGIAAGWQETASPIRVRAKNGRDHSAD
Ga0335078_100560836	3300032805	Soil	MPILLWIAFWSNLTGIAAGWQETVLPVRVRGKDRRDHPAK
Ga0335078_100690883	3300032805	Soil	MPALMWIAFWSSLMGVATGWQETALPIRVRAMDRRDRPTK
Ga0335078_104900163	3300032805	Soil	MPILLWIAFWSSMTGVASGWQETMLPIRVKGKDRRDHPGNS
Ga0335081_120041982	3300032892	Soil	MSVLLWIAFWSNLTGIAMGWQETALPIRVRDKDRRDRSTD
Ga0335074_100560384	3300032895	Soil	MPALLWIAFWSNLTGVAMGWQETALPIRVRAKDRRDPPAE
Ga0335076_102078352	3300032955	Soil	MPILLWIAMWSSMTGVAKGWQDTILPIRVKVTDRRDQLTEK
Ga0335073_100200033	3300033134	Soil	MPMLMWIALWSSLLGVVSGWQETALPVRVGAKDRRDHRLT
Ga0335073_114123712	3300033134	Soil	MPILLWIAMWSSMTGVAKGWQDTVLPIRVKVTDRRDQLTEK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign