| Basic Information | |
|---|---|
| Family ID | F068471 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | KLFPIDFSGVYAGMAADAIGEAYCTTDACEVKLIKDNS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.226 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.774 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 16.94 |
| PF02511 | Thy1 | 10.48 |
| PF02675 | AdoMet_dc | 5.65 |
| PF00462 | Glutaredoxin | 4.03 |
| PF09723 | Zn-ribbon_8 | 1.61 |
| PF01391 | Collagen | 1.61 |
| PF01923 | Cob_adeno_trans | 1.61 |
| PF00589 | Phage_integrase | 1.61 |
| PF05050 | Methyltransf_21 | 1.61 |
| PF04860 | Phage_portal | 1.61 |
| PF14659 | Phage_int_SAM_3 | 1.61 |
| PF04820 | Trp_halogenase | 1.61 |
| PF13392 | HNH_3 | 1.61 |
| PF01464 | SLT | 0.81 |
| PF00535 | Glycos_transf_2 | 0.81 |
| PF00145 | DNA_methylase | 0.81 |
| PF02867 | Ribonuc_red_lgC | 0.81 |
| PF00085 | Thioredoxin | 0.81 |
| PF00565 | SNase | 0.81 |
| PF13495 | Phage_int_SAM_4 | 0.81 |
| PF11397 | GlcNAc | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 10.48 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 5.65 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.81 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.23 % |
| All Organisms | root | All Organisms | 46.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000439|TBL_comb48_EPIDRAFT_1047158 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1073001 | Not Available | 1078 | Open in IMG/M |
| 3300000882|FwDRAFT_10043812 | Not Available | 545 | Open in IMG/M |
| 3300001848|RCM47_1146801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 592 | Open in IMG/M |
| 3300002098|JGI24219J26650_1020494 | Not Available | 897 | Open in IMG/M |
| 3300002220|MLSBCLC_10402905 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300002274|B570J29581_108233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300002307|JGI24890J29729_1054261 | Not Available | 716 | Open in IMG/M |
| 3300002408|B570J29032_109959248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20693 | Open in IMG/M |
| 3300003827|Ga0007880_1010565 | Not Available | 880 | Open in IMG/M |
| 3300004054|Ga0063232_10253518 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005581|Ga0049081_10165006 | Not Available | 806 | Open in IMG/M |
| 3300005662|Ga0078894_10548103 | Not Available | 1034 | Open in IMG/M |
| 3300005805|Ga0079957_1059852 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300006071|Ga0007876_1012535 | All Organisms → Viruses → Predicted Viral | 2428 | Open in IMG/M |
| 3300006128|Ga0007828_1056852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 812 | Open in IMG/M |
| 3300007541|Ga0099848_1252995 | Not Available | 615 | Open in IMG/M |
| 3300008113|Ga0114346_1160312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300008113|Ga0114346_1263463 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300008113|Ga0114346_1326332 | Not Available | 513 | Open in IMG/M |
| 3300008450|Ga0114880_1206134 | Not Available | 654 | Open in IMG/M |
| 3300008996|Ga0102831_1147769 | Not Available | 780 | Open in IMG/M |
| 3300008996|Ga0102831_1259574 | Not Available | 573 | Open in IMG/M |
| 3300009059|Ga0102830_1112902 | Not Available | 803 | Open in IMG/M |
| 3300009068|Ga0114973_10289586 | Not Available | 875 | Open in IMG/M |
| 3300009080|Ga0102815_10577410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter anophelis | 631 | Open in IMG/M |
| 3300009161|Ga0114966_10566824 | Not Available | 638 | Open in IMG/M |
| 3300009164|Ga0114975_10526479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300009180|Ga0114979_10558130 | Not Available | 657 | Open in IMG/M |
| 3300009183|Ga0114974_10270510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300009183|Ga0114974_10494112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300009184|Ga0114976_10180390 | Not Available | 1171 | Open in IMG/M |
| 3300009184|Ga0114976_10208741 | Not Available | 1073 | Open in IMG/M |
| 3300009184|Ga0114976_10698398 | Not Available | 509 | Open in IMG/M |
| 3300010160|Ga0114967_10463397 | Not Available | 623 | Open in IMG/M |
| 3300010354|Ga0129333_10290880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
| 3300010370|Ga0129336_10193600 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
| 3300010370|Ga0129336_10432515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter anophelis | 715 | Open in IMG/M |
| 3300010370|Ga0129336_10612491 | Not Available | 580 | Open in IMG/M |
| 3300010885|Ga0133913_10261092 | All Organisms → Viruses → Predicted Viral | 4597 | Open in IMG/M |
| 3300011011|Ga0139556_1051457 | Not Available | 612 | Open in IMG/M |
| 3300013005|Ga0164292_10902395 | Not Available | 554 | Open in IMG/M |
| 3300013285|Ga0136642_1099362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300013295|Ga0170791_12344824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300017761|Ga0181356_1232044 | Not Available | 532 | Open in IMG/M |
| 3300017766|Ga0181343_1192607 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Latescibacteria → unclassified Candidatus Latescibacteria → Candidatus Latescibacteria bacterium ADurb.Bin168 | 560 | Open in IMG/M |
| 3300019784|Ga0181359_1063992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300020083|Ga0194111_10111900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2164 | Open in IMG/M |
| 3300020151|Ga0211736_10352767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300020159|Ga0211734_10717890 | Not Available | 673 | Open in IMG/M |
| 3300020172|Ga0211729_11306768 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300020183|Ga0194115_10265861 | Not Available | 802 | Open in IMG/M |
| 3300020200|Ga0194121_10224568 | Not Available | 998 | Open in IMG/M |
| 3300020200|Ga0194121_10419165 | Not Available | 661 | Open in IMG/M |
| 3300020221|Ga0194127_10095367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2222 | Open in IMG/M |
| 3300020221|Ga0194127_10296434 | Not Available | 1095 | Open in IMG/M |
| 3300020222|Ga0194125_10716350 | Not Available | 581 | Open in IMG/M |
| 3300020222|Ga0194125_10741806 | Not Available | 567 | Open in IMG/M |
| 3300020553|Ga0208855_1054394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium | 518 | Open in IMG/M |
| 3300020566|Ga0208222_1091406 | Not Available | 500 | Open in IMG/M |
| 3300020570|Ga0208465_1031756 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300020603|Ga0194126_10153113 | Not Available | 1737 | Open in IMG/M |
| 3300020603|Ga0194126_10723576 | Not Available | 578 | Open in IMG/M |
| 3300020710|Ga0214198_1048030 | Not Available | 503 | Open in IMG/M |
| 3300020717|Ga0214248_1004650 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
| 3300020718|Ga0214178_1011684 | Not Available | 1258 | Open in IMG/M |
| 3300020723|Ga0214249_1034619 | Not Available | 757 | Open in IMG/M |
| 3300020731|Ga0214170_1050206 | Not Available | 614 | Open in IMG/M |
| 3300020731|Ga0214170_1056569 | Not Available | 564 | Open in IMG/M |
| 3300021115|Ga0214174_119172 | Not Available | 549 | Open in IMG/M |
| 3300021125|Ga0214211_1016330 | Not Available | 722 | Open in IMG/M |
| 3300021133|Ga0214175_1015905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
| 3300021141|Ga0214163_1071374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300021376|Ga0194130_10449725 | Not Available | 671 | Open in IMG/M |
| 3300021519|Ga0194048_10091812 | Not Available | 1176 | Open in IMG/M |
| 3300021962|Ga0222713_10778505 | Not Available | 536 | Open in IMG/M |
| 3300023172|Ga0255766_10067802 | Not Available | 2255 | Open in IMG/M |
| 3300023179|Ga0214923_10560968 | Not Available | 548 | Open in IMG/M |
| 3300023184|Ga0214919_10256525 | Not Available | 1247 | Open in IMG/M |
| 3300023184|Ga0214919_10586749 | Not Available | 661 | Open in IMG/M |
| 3300023311|Ga0256681_12423798 | All Organisms → Viruses → Predicted Viral | 4922 | Open in IMG/M |
| 3300024346|Ga0244775_10371918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300024346|Ga0244775_11386208 | Not Available | 541 | Open in IMG/M |
| 3300024348|Ga0244776_10045273 | All Organisms → Viruses → Predicted Viral | 3463 | Open in IMG/M |
| 3300025382|Ga0208256_1008781 | All Organisms → Viruses → Predicted Viral | 1646 | Open in IMG/M |
| 3300025398|Ga0208251_1060648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300025407|Ga0208378_1002438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4955 | Open in IMG/M |
| 3300025407|Ga0208378_1046060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300025778|Ga0208388_1060402 | Not Available | 525 | Open in IMG/M |
| 3300025782|Ga0208867_1048349 | Not Available | 594 | Open in IMG/M |
| 3300027597|Ga0255088_1050802 | Not Available | 826 | Open in IMG/M |
| 3300027621|Ga0208951_1013026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2743 | Open in IMG/M |
| 3300027644|Ga0209356_1196298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300027659|Ga0208975_1030078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1739 | Open in IMG/M |
| 3300027720|Ga0209617_10286884 | Not Available | 618 | Open in IMG/M |
| 3300027734|Ga0209087_1031439 | All Organisms → cellular organisms → Bacteria | 2534 | Open in IMG/M |
| 3300027736|Ga0209190_1142070 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
| 3300027746|Ga0209597_1296774 | Not Available | 621 | Open in IMG/M |
| 3300027782|Ga0209500_10291736 | Not Available | 694 | Open in IMG/M |
| 3300027797|Ga0209107_10327076 | Not Available | 714 | Open in IMG/M |
| 3300027808|Ga0209354_10095006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
| 3300027963|Ga0209400_1079598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1585 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1337541 | Not Available | 507 | Open in IMG/M |
| 3300028025|Ga0247723_1076014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300028025|Ga0247723_1091423 | Not Available | 782 | Open in IMG/M |
| 3300028394|Ga0304730_1006446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7374 | Open in IMG/M |
| 3300031786|Ga0315908_10883023 | Not Available | 726 | Open in IMG/M |
| 3300031857|Ga0315909_10924411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 535 | Open in IMG/M |
| 3300031963|Ga0315901_10315419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae | 1289 | Open in IMG/M |
| 3300033996|Ga0334979_0343862 | Not Available | 837 | Open in IMG/M |
| 3300034050|Ga0335023_0422359 | Not Available | 701 | Open in IMG/M |
| 3300034062|Ga0334995_0163585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1591 | Open in IMG/M |
| 3300034063|Ga0335000_0442298 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300034068|Ga0334990_0129853 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300034101|Ga0335027_0393313 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300034102|Ga0335029_0180350 | Not Available | 1420 | Open in IMG/M |
| 3300034102|Ga0335029_0593265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300034102|Ga0335029_0653077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300034106|Ga0335036_0168760 | Not Available | 1543 | Open in IMG/M |
| 3300034107|Ga0335037_0407602 | Not Available | 733 | Open in IMG/M |
| 3300034112|Ga0335066_0445129 | Not Available | 698 | Open in IMG/M |
| 3300034168|Ga0335061_0683072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300034272|Ga0335049_0586391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300034356|Ga0335048_0071806 | Not Available | 2157 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.03% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.23% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.42% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.42% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.61% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.61% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.81% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.81% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003827 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020717 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300021115 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb48_EPIDRAFT_10471581 | 3300000439 | Freshwater | FPIDLSGVYAGMAFDAIGEAYCTTDACEVKLIKDNA* |
| TBL_comb48_EPIDRAFT_10730014 | 3300000439 | Freshwater | IDLSGVYEGMAFDAIGEAYCTTDACEVKLIREEVKSGS* |
| FwDRAFT_100438121 | 3300000882 | Freshwater And Marine | QDGLDKLFPIDFAGVYAGIAADAIGESYCSTDSCEIKLIKDNIAH* |
| RCM47_11468011 | 3300001848 | Marine Plankton | LFPIDLTGVYEGMAFDAVGEAYCTTDACEVKLVRDNAN* |
| JGI24219J26650_10204941 | 3300002098 | Lentic | MTLFPIDFVGVYAGMASDAVGESYCVTDACEVNLIKDNQ* |
| MLSBCLC_104029053 | 3300002220 | Hydrocarbon Resource Environments | GSLMPLDLSPVYAGMAADAIGEQYCTTDACEVKIV* |
| B570J29581_1082332 | 3300002274 | Freshwater | GLDKLFPIDFAGVYAGMAADAIGESYCSTDSCEIKLIKDNIAH* |
| JGI24890J29729_10542612 | 3300002307 | Lentic | MTLFPIDFVGVYAGMASDAVGESYCVTDACEVNLIMENTKEVNN* |
| B570J29032_10995924835 | 3300002408 | Freshwater | MKLFPIDFSGVYAGMAADAIGESYCTTDSCEIKLIKENNKQ* |
| Ga0007880_10105653 | 3300003827 | Freshwater | EYENYRMTLFPIDFAGVYAGMAADAVGEAYCTTDACEVKLIKDNQ* |
| Ga0063232_102535181 | 3300004054 | Freshwater Lake | TEATMKLFPIDFAGVYAGMAADAVGEAYCTTDACEVKLIKDNR* |
| Ga0049081_101650064 | 3300005581 | Freshwater Lentic | EEYVFKLMPIDFAGVYAGLAADAIGEAYCTTDACEIKLIQ* |
| Ga0078894_105481031 | 3300005662 | Freshwater Lake | GVKLFPIDLTGVYAGMASDAIGERYCTTDSCEIKFIKDNSKAN* |
| Ga0079957_10598526 | 3300005805 | Lake | PIDFSGVYAGMAADAIGEAYCTTDSCEIRLIKDNN* |
| Ga0007876_10125351 | 3300006071 | Freshwater | FPIDLAGVYAGMAADAIGEAYCTTDACEVKLIKDNQ* |
| Ga0007828_10568523 | 3300006128 | Freshwater | NEGTMKLFPIDLAGVYAGMDADAIGEAYCTTDACEVKLIKDNQ* |
| Ga0099848_12529952 | 3300007541 | Aqueous | EATMKLFPIDFSGVYAGMAADAIGEAYCTTDACEIKLIKDNQ* |
| Ga0114346_11603124 | 3300008113 | Freshwater, Plankton | SQGKLFPIDFAGIYAGLGLDAIGEKYCTTDACEIKLIVENQK* |
| Ga0114346_12634634 | 3300008113 | Freshwater, Plankton | IDFVGVYQGMAADAVGEAYCTTDACEIKLIKDNTKE* |
| Ga0114346_13263321 | 3300008113 | Freshwater, Plankton | EEGVNKLFPIDFSGVYAGMASDAIGEAYCTTDACEVKLIVNNQ* |
| Ga0114880_12061341 | 3300008450 | Freshwater Lake | FPIDFSGVYAGMAADAIGESYCTTDACEIKFVKDNAK* |
| Ga0102831_11477691 | 3300008996 | Estuarine | TATMSLFPIDFSGIYAGMAADAIGEAYCTTDACEIKFVKDNIKK* |
| Ga0102831_12595742 | 3300008996 | Estuarine | AGVYAGMASDAIGDAYCTTDACEVKLITENQKDK* |
| Ga0102830_11129021 | 3300009059 | Estuarine | EEGVMKLFPIDLAGVYAGMASDAIGDAYCTTDACEVKLITENQKDK* |
| Ga0114973_102895861 | 3300009068 | Freshwater Lake | TEGTMKLFPIDLSGVYAGMAADAIGEAYCTTDACEVRLIKDNQ* |
| Ga0102815_105774103 | 3300009080 | Estuarine | FPIDFSGVYAGMAADAIGEAYCTTDACEVKLITDNQKG* |
| Ga0114966_105668241 | 3300009161 | Freshwater Lake | LFPIDFTGVYAGMASDAIGDAYCTTDACEVRLIVENLK* |
| Ga0114975_105264792 | 3300009164 | Freshwater Lake | DFSGVYAGMAADAIGEAYCTTDACEVKLITDNQPK* |
| Ga0114979_105581301 | 3300009180 | Freshwater Lake | TMKLFPIDFVGVYAGMAADAIGDAYCSTDFCEVKLITENLKDK* |
| Ga0114974_102705103 | 3300009183 | Freshwater Lake | DFSGVYAGMAADAIGEAYCTTDACEIKLITDNQPK* |
| Ga0114974_104941121 | 3300009183 | Freshwater Lake | FPIDFAGVYAGMAADAVGESYCTTDSCEIKLIKDNIAH* |
| Ga0114976_101803906 | 3300009184 | Freshwater Lake | MKLFPIDFSGVYAGMAADAVGEMYCTTDACEVKLIKDNI* |
| Ga0114976_102087411 | 3300009184 | Freshwater Lake | KLFPIDFSGVYAGMAADAIGEAYCTTDACEVKLIANNQ* |
| Ga0114976_106983982 | 3300009184 | Freshwater Lake | KLFPIDFSGVYAGMAADAIGEAYCTTDACEVKLIKDNS* |
| Ga0114967_104633971 | 3300010160 | Freshwater Lake | NKLFPIDFSGVYAGMAADAVGENYCTTDACEVKLITENNKDKA* |
| Ga0129333_102908803 | 3300010354 | Freshwater To Marine Saline Gradient | PIDFSGIYSGMGIDAVGEAYCTTDSCEIKLIKDNLDK* |
| Ga0129336_101936001 | 3300010370 | Freshwater To Marine Saline Gradient | DATMDIFPIDFSGVYAGLASDAIGEAYCTTDACEVKLITNS* |
| Ga0129336_104325153 | 3300010370 | Freshwater To Marine Saline Gradient | AMMKLFPIDFSGVYAGLAADAIGEAYCTTDACEIKLIKENQ* |
| Ga0129336_106124911 | 3300010370 | Freshwater To Marine Saline Gradient | TEKLFPIDLTGVYAGMAADAIGERYCTTDSCEIKFVKDNQ* |
| Ga0133913_1026109210 | 3300010885 | Freshwater Lake | REDGELKLFPIDFSGVYAGMAADAIGEAYCTTDACEIKLITENNKDK* |
| Ga0139556_10514571 | 3300011011 | Freshwater | VLRLFPIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENI* |
| Ga0164292_109023952 | 3300013005 | Freshwater | YESEGTMKLFPIDLSGVYAGMAADAIGEAYCTTDACEVRLIKDNQ* |
| Ga0136642_10993623 | 3300013285 | Freshwater | FPIDFAGIYAGMAMDAIGEAYCTTDACEVKLIKDNQ* |
| Ga0170791_123448243 | 3300013295 | Freshwater | PIDFSGVYAGMAADAIGEAYCTTDACEVKLIKDNS* |
| Ga0181356_12320441 | 3300017761 | Freshwater Lake | DEGVLRLFPIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENI |
| Ga0181343_11926071 | 3300017766 | Freshwater Lake | YDAYAMKLFPIDFAGVYAGLAADAVGEAYCTTDACEIKLIKDNQ |
| Ga0181359_10639926 | 3300019784 | Freshwater Lake | LRLFPIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENI |
| Ga0194111_101119003 | 3300020083 | Freshwater Lake | KSELFPIDFAGVYAGLAHDAIGEAYCTTDSCEIKLS |
| Ga0211736_103527671 | 3300020151 | Freshwater | MKLFPIDLAGVYAGMASDAIGEAYCTTDACEVKLIKDNQ |
| Ga0211734_107178901 | 3300020159 | Freshwater | KLFPIDLTGVYAGMAADAIGEAYCTTDACEIKFIKDNSX |
| Ga0211729_113067681 | 3300020172 | Freshwater | PIDLSGVYAGMAADAIGEAYCTTDACEVKLIKLNN |
| Ga0194115_102658611 | 3300020183 | Freshwater Lake | TLFPIDFAGVYAGMASDAIGERYCTTDSCEIKLIRDSNSQR |
| Ga0194121_102245681 | 3300020200 | Freshwater Lake | YNQEGSTKLFPIDLSGVYAGLAVDAIGESYCTTDSCEIKFLKDNQKS |
| Ga0194121_104191651 | 3300020200 | Freshwater Lake | YLQQADKLFPIDLTGVYAGMAADAIGERYCATDSCEIKFIKDNVK |
| Ga0194127_100953676 | 3300020221 | Freshwater Lake | QIDKLFPIDLTGVYAGMAADAIGERHCTTDTCEIKYIKDNQ |
| Ga0194127_102964344 | 3300020221 | Freshwater Lake | EEATMKLFPIDLSGVYAGMASDAIGEAYCTTDACEVKLIKDNS |
| Ga0194125_107163502 | 3300020222 | Freshwater Lake | ADKLFPIDLTGVYAGMAADAIGERYCATDSCEIKFIKDNVK |
| Ga0194125_107418061 | 3300020222 | Freshwater Lake | IDFAGVYAGMASDAIGERYCTTDSCEIKLIRDSNSQR |
| Ga0208855_10543942 | 3300020553 | Freshwater | EQYESEGVMKLFPIDFSGVYAGMAADAIGEAYCTTDACEVKLIRDNQ |
| Ga0208222_10914061 | 3300020566 | Freshwater | IDLTGVYAGMAADAIGERYCTTDSCEIKFIKDNIKV |
| Ga0208465_10317561 | 3300020570 | Freshwater | LFPIDFAGVYAGLAADAVGEAYCTTDACEVKLIKDNTK |
| Ga0194126_101531135 | 3300020603 | Freshwater Lake | PIDFAGVYAGMAIDAIGERYCSTDSCEVQLIKDNV |
| Ga0194126_107235761 | 3300020603 | Freshwater Lake | PIDFVGVYAGMAIDAIGEKYCATDSCEIKLIKNNITQE |
| Ga0214198_10480301 | 3300020710 | Freshwater | RMNLFPIDLSGVYEGMAFDAIGEAYCTTDACEVKLIREEVKSGS |
| Ga0214248_10046501 | 3300020717 | Freshwater | DEYEEGRMTLFPIDFKGIYEGMGLDAVGEAYCTTDACEVKLIKDNA |
| Ga0214178_10116841 | 3300020718 | Freshwater | MTLMPIDFSGVYAGMASDAIGEAYCTTDACEVKLIKDNQ |
| Ga0214249_10346191 | 3300020723 | Freshwater | QQYTDEGIMKLFPIDLAGVYAGMAIDAIGEAYCTTDACEVKLIKDNQ |
| Ga0214170_10502062 | 3300020731 | Freshwater | RMTLMPIDFSGVYAGMASDAIGEAYCTTDACEVKLIKDNQ |
| Ga0214170_10565691 | 3300020731 | Freshwater | KLFPIDFAGIYAGMAMDAIGESYCTTDACEVKLIKDNQ |
| Ga0214174_1191723 | 3300021115 | Freshwater | YEEGRMTLFPIDFKGIYEGMGLDAVGEAYCTTDACEVKLIKDNA |
| Ga0214211_10163301 | 3300021125 | Freshwater | EEYEQYRMTLFPIDFAGVYAGMASDAVGEAYCTTDACEVKLIKDNQ |
| Ga0214175_10159054 | 3300021133 | Freshwater | RMTLFPIDLSGVYAGMAFDAIGEAYCTTDACEVKLIKDNA |
| Ga0214163_10713741 | 3300021141 | Freshwater | YTMKLFPIDFSGVYEGLAADAIGEAYCTTDACEVRLIKENQ |
| Ga0194130_104497251 | 3300021376 | Freshwater Lake | DLDGIYAGLAADAIGEQYCTTDSCEIKFIKDNAKA |
| Ga0194048_100918124 | 3300021519 | Anoxic Zone Freshwater | PIDFAGVYAGMAIDAIGEAYCTTDACEIKLITENQK |
| Ga0222713_107785051 | 3300021962 | Estuarine Water | FPIDFSGVYAGMAADAIGESYCTTDSCEIKFVKENQK |
| Ga0255766_100678027 | 3300023172 | Salt Marsh | EASKALFPIDFTGVYGGMAADAIGESYCTTDSCEIKFVKENA |
| Ga0214923_105609681 | 3300023179 | Freshwater | LFPIDFSGVYAGMAADAIGEAYCTTDACEIKLIKDNA |
| Ga0214919_102565254 | 3300023184 | Freshwater | EDATMKLFPIDFTGVYAGMASDAIGDAYCTTDACEVKLIVENLK |
| Ga0214919_105867491 | 3300023184 | Freshwater | LFPIDFKGVYAGMASDAIGEAYCTTDACEVKLITDNQ |
| Ga0256681_1242379812 | 3300023311 | Freshwater | RTTVFPIDFTGVYAGMASDAIGEAYCTTDACEVKLIKDNQ |
| Ga0244775_103719184 | 3300024346 | Estuarine | EGTMRLFPIDFSGVYAGMGADAIGEAYCTTDACEVKLISENQK |
| Ga0244775_113862082 | 3300024346 | Estuarine | EDATMKLFPIDFTGVYAGMASDAIGDAYCTTDACEIRLIVENLK |
| Ga0244776_100452731 | 3300024348 | Estuarine | PIDLSGVYAGMAADAIGEAYCTTDACEVKLIKDSQ |
| Ga0208256_10087816 | 3300025382 | Freshwater | LFPIDFAGVYAGMAADAVGEAYCTTDACEVKLIKDNQ |
| Ga0208251_10606482 | 3300025398 | Freshwater | TMKLFPIDFKGVYAGMAADAVGEAYCTTDACEVKLIKDNQ |
| Ga0208378_10024382 | 3300025407 | Freshwater | MTLFPIDLKGVYEGMAFDAVGEAYCTTDACEVKLVRDNVQ |
| Ga0208378_10460602 | 3300025407 | Freshwater | QYRMTLFPIDFAGVYAGMASDAVGESYCVTDACEIKLITENTKEV |
| Ga0208388_10604021 | 3300025778 | Freshwater | MTLFPIDFAGVYAGMAYDAVGEAYCTTDACEVKLIKDNQ |
| Ga0208867_10483492 | 3300025782 | Freshwater | RMTLFPIDFAGVYAGMAADAVGEAYCTTDACEVKLIKDNQ |
| Ga0255088_10508021 | 3300027597 | Freshwater | DEGLKELFPIDFSGVYAGLAADAIGEAYCTTDACEIKFVKENQ |
| Ga0208951_10130267 | 3300027621 | Freshwater Lentic | FPIDLSGVYAGMAFDAIGERYCTTDSCEIKFIKDNTK |
| Ga0209356_11962983 | 3300027644 | Freshwater Lake | PIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENSNG |
| Ga0208975_10300786 | 3300027659 | Freshwater Lentic | LFPIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENANG |
| Ga0209617_102868843 | 3300027720 | Freshwater And Sediment | RMKLFPIDFAGVYAGMAADAVGEAYCTTDACEVKLIKDNK |
| Ga0209087_10314397 | 3300027734 | Freshwater Lake | EYEEYTMKLFPIDFSGVYAGLAADAIGEAYCTTDACEIKLISNNQ |
| Ga0209190_11420701 | 3300027736 | Freshwater Lake | GELKLFPIDFSGVYAGMAADAIGEAYCTTDACEIKLITENNKDK |
| Ga0209597_12967741 | 3300027746 | Freshwater Lake | EGTMKLFPIDLTGVYAGMASDAIGEAYCTTDACEVRLIKDNH |
| Ga0209500_102917362 | 3300027782 | Freshwater Lake | NLSTGSLFQIDFSGVYGGLAADAIGEAYCTTDACEIKFIKENVK |
| Ga0209107_103270762 | 3300027797 | Freshwater And Sediment | LFPIDLAGVYAGMAADAIGDAYCTTDACEVKFVVENNK |
| Ga0209354_100950061 | 3300027808 | Freshwater Lake | PIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENANG |
| Ga0209400_10795987 | 3300027963 | Freshwater Lake | YEDEGTLRLFPIDFSGVYAGMAADAIGEAYCTTDACEVRLIKENI |
| (restricted) Ga0247834_13375412 | 3300027977 | Freshwater | MKLMPIDLEGVYNGLGLEAIGEAYCTTDACEVKLLKD |
| Ga0247723_10760141 | 3300028025 | Deep Subsurface Sediment | VMKLFPIDFSGVYAGMAADAIGEAYCTTDSCEVKLITENNK |
| Ga0247723_10914232 | 3300028025 | Deep Subsurface Sediment | YAMKLFEIDLAGVYAGMAADAIGDSYCTTDACEVKFVVENNK |
| Ga0304730_100644620 | 3300028394 | Freshwater Lake | PIDFSGVYAGMAADAIGEAYCTTDACEVKLITDNQPK |
| Ga0315908_108830233 | 3300031786 | Freshwater | YVFKLMPIDFAGVYAGLAADAIGEAYCTTDACEIKLIQ |
| Ga0315909_109244111 | 3300031857 | Freshwater | IDFVGVYQGMAADAVGEAYCTTDACEIKLIKDNTKE |
| Ga0315901_103154193 | 3300031963 | Freshwater | DGVMKLFPIDFSGVYAGLASDAIGEAYCTTDACEVKLIRENQ |
| Ga0334979_0343862_3_122 | 3300033996 | Freshwater | KLFPIDFSGVYAGMAADAIGEAYCTTDSCEIKFIQDNSK |
| Ga0335023_0422359_9_128 | 3300034050 | Freshwater | MKLFPIDLSGVYAGMAADAIGEAYCTTDACEVKLIKLNN |
| Ga0334995_0163585_1_132 | 3300034062 | Freshwater | ESATKLFPIDFAGIYAGLGLDGIGEAYCTTDACEIKLIVENQK |
| Ga0335000_0442298_627_746 | 3300034063 | Freshwater | MKLFPIDFTGVYAGMAADAVGEAYCTTDACEVRLIKDNV |
| Ga0334990_0129853_1258_1371 | 3300034068 | Freshwater | FPIDFTGVYAGMASDAIGDAYCTTDACEVKLIVENLK |
| Ga0335027_0393313_790_900 | 3300034101 | Freshwater | PIDFAGIYAGMGLDAVGEKYCTTDACEIKLIVENSK |
| Ga0335029_0180350_1280_1420 | 3300034102 | Freshwater | EYQEEGLMKLFPIDLTGVYAGMAADAIGESYCTTDSCEVKFIKDNS |
| Ga0335029_0593265_17_136 | 3300034102 | Freshwater | MKLFPIDFSGVYAGMAADAIGEAYCTTDACEVKLIRDNQ |
| Ga0335029_0653077_468_578 | 3300034102 | Freshwater | IDFSGVYAGMAADAIGEAYCTTDACEVRLIKENSNG |
| Ga0335036_0168760_23_148 | 3300034106 | Freshwater | MDLFPIDFSGVYAGLAADAIGENYCTTDSCEIKFIKENVKG |
| Ga0335037_0407602_608_730 | 3300034107 | Freshwater | MTLFPIDFTGVYEGMGLDAVGESYCTTDACEVKLIRDNQV |
| Ga0335066_0445129_3_113 | 3300034112 | Freshwater | PIDFTGVYAGMASDAIGDAYCTTDACEVRLIVENLK |
| Ga0335061_0683072_397_510 | 3300034168 | Freshwater | PIDFAGVYAGMAADAVGESYCTTDSCEIKLIKDNIAR |
| Ga0335049_0586391_571_693 | 3300034272 | Freshwater | KLFPIDFAGVYAGMASDAVGESYCTTDSCEIKLIKDNIAK |
| Ga0335048_0071806_1_117 | 3300034356 | Freshwater | LFPIDFTGVYGGLAADAIGEAYCTTDACEIKFIKENNK |
| ⦗Top⦘ |