| Basic Information | |
|---|---|
| Family ID | F068375 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.45 % |
| % of genes near scaffold ends (potentially truncated) | 15.32 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (62.903 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.452 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (67.742 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.67% β-sheet: 0.00% Coil/Unstructured: 41.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005330|Ga0070690_101333723 | Not Available | 576 | Open in IMG/M |
| 3300005335|Ga0070666_10648150 | Not Available | 772 | Open in IMG/M |
| 3300005335|Ga0070666_10924034 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 646 | Open in IMG/M |
| 3300005347|Ga0070668_101484197 | Not Available | 619 | Open in IMG/M |
| 3300005355|Ga0070671_100726291 | Not Available | 862 | Open in IMG/M |
| 3300005365|Ga0070688_100754922 | Not Available | 757 | Open in IMG/M |
| 3300005367|Ga0070667_100363340 | Not Available | 1312 | Open in IMG/M |
| 3300005367|Ga0070667_101823258 | Not Available | 572 | Open in IMG/M |
| 3300005445|Ga0070708_101387677 | Not Available | 655 | Open in IMG/M |
| 3300005466|Ga0070685_11080174 | Not Available | 605 | Open in IMG/M |
| 3300005467|Ga0070706_100437493 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1217 | Open in IMG/M |
| 3300005841|Ga0068863_101238112 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 752 | Open in IMG/M |
| 3300005843|Ga0068860_101168732 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 789 | Open in IMG/M |
| 3300009177|Ga0105248_10813851 | Not Available | 1054 | Open in IMG/M |
| 3300009553|Ga0105249_11329532 | Not Available | 790 | Open in IMG/M |
| 3300009972|Ga0105137_101709 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 849 | Open in IMG/M |
| 3300009972|Ga0105137_104205 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 669 | Open in IMG/M |
| 3300009975|Ga0105129_102223 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 942 | Open in IMG/M |
| 3300009980|Ga0105135_105265 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 851 | Open in IMG/M |
| 3300009980|Ga0105135_110827 | Not Available | 701 | Open in IMG/M |
| 3300009981|Ga0105133_101724 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1117 | Open in IMG/M |
| 3300009992|Ga0105120_1023649 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 693 | Open in IMG/M |
| 3300009992|Ga0105120_1025406 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 677 | Open in IMG/M |
| 3300009993|Ga0105028_117381 | Not Available | 771 | Open in IMG/M |
| 3300009994|Ga0105126_1017465 | Not Available | 754 | Open in IMG/M |
| 3300009994|Ga0105126_1027247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 656 | Open in IMG/M |
| 3300009994|Ga0105126_1033446 | Not Available | 612 | Open in IMG/M |
| 3300009995|Ga0105139_1068789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 654 | Open in IMG/M |
| 3300009995|Ga0105139_1108193 | Not Available | 537 | Open in IMG/M |
| 3300010397|Ga0134124_11141779 | Not Available | 797 | Open in IMG/M |
| 3300010399|Ga0134127_11138966 | Not Available | 845 | Open in IMG/M |
| 3300010400|Ga0134122_13242707 | Not Available | 510 | Open in IMG/M |
| 3300010401|Ga0134121_11101915 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 787 | Open in IMG/M |
| 3300010403|Ga0134123_10715636 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 981 | Open in IMG/M |
| 3300014326|Ga0157380_11904738 | Not Available | 655 | Open in IMG/M |
| 3300015270|Ga0182183_1078536 | Not Available | 536 | Open in IMG/M |
| 3300015273|Ga0182102_1004359 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 920 | Open in IMG/M |
| 3300015278|Ga0182099_1008392 | Not Available | 897 | Open in IMG/M |
| 3300015280|Ga0182100_1026687 | Not Available | 777 | Open in IMG/M |
| 3300015280|Ga0182100_1058956 | Not Available | 605 | Open in IMG/M |
| 3300015280|Ga0182100_1062579 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 593 | Open in IMG/M |
| 3300015284|Ga0182101_1028385 | Not Available | 760 | Open in IMG/M |
| 3300015284|Ga0182101_1087129 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 528 | Open in IMG/M |
| 3300015293|Ga0182103_1073405 | Not Available | 566 | Open in IMG/M |
| 3300015301|Ga0182184_1059248 | Not Available | 605 | Open in IMG/M |
| 3300015306|Ga0182180_1030840 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 752 | Open in IMG/M |
| 3300015309|Ga0182098_1086583 | Not Available | 579 | Open in IMG/M |
| 3300015310|Ga0182162_1102458 | Not Available | 550 | Open in IMG/M |
| 3300015311|Ga0182182_1116772 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 511 | Open in IMG/M |
| 3300015312|Ga0182168_1040688 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 786 | Open in IMG/M |
| 3300015313|Ga0182164_1066343 | Not Available | 664 | Open in IMG/M |
| 3300015315|Ga0182120_1139060 | Not Available | 503 | Open in IMG/M |
| 3300015316|Ga0182121_1103834 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 579 | Open in IMG/M |
| 3300015317|Ga0182136_1044347 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 770 | Open in IMG/M |
| 3300015319|Ga0182130_1036255 | Not Available | 802 | Open in IMG/M |
| 3300015319|Ga0182130_1056764 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 692 | Open in IMG/M |
| 3300015320|Ga0182165_1012449 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1185 | Open in IMG/M |
| 3300015320|Ga0182165_1068268 | Not Available | 679 | Open in IMG/M |
| 3300015324|Ga0182134_1067707 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 679 | Open in IMG/M |
| 3300015324|Ga0182134_1143831 | Not Available | 508 | Open in IMG/M |
| 3300015325|Ga0182148_1019697 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 995 | Open in IMG/M |
| 3300015327|Ga0182114_1124799 | Not Available | 562 | Open in IMG/M |
| 3300015328|Ga0182153_1034406 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 862 | Open in IMG/M |
| 3300015329|Ga0182135_1023729 | Not Available | 982 | Open in IMG/M |
| 3300015329|Ga0182135_1050273 | Not Available | 769 | Open in IMG/M |
| 3300015329|Ga0182135_1078119 | Not Available | 657 | Open in IMG/M |
| 3300015330|Ga0182152_1108742 | Not Available | 580 | Open in IMG/M |
| 3300015332|Ga0182117_1141027 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 546 | Open in IMG/M |
| 3300015333|Ga0182147_1072469 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 708 | Open in IMG/M |
| 3300015333|Ga0182147_1151212 | Not Available | 528 | Open in IMG/M |
| 3300015336|Ga0182150_1076715 | Not Available | 683 | Open in IMG/M |
| 3300015337|Ga0182151_1083304 | Not Available | 662 | Open in IMG/M |
| 3300015340|Ga0182133_1186411 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 509 | Open in IMG/M |
| 3300015349|Ga0182185_1073378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 946 | Open in IMG/M |
| 3300015349|Ga0182185_1106077 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 811 | Open in IMG/M |
| 3300015350|Ga0182163_1253945 | Not Available | 551 | Open in IMG/M |
| 3300015353|Ga0182179_1309015 | Not Available | 515 | Open in IMG/M |
| 3300015354|Ga0182167_1139555 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 894 | Open in IMG/M |
| 3300015354|Ga0182167_1204921 | Not Available | 721 | Open in IMG/M |
| 3300015354|Ga0182167_1215101 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 700 | Open in IMG/M |
| 3300015354|Ga0182167_1357948 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 509 | Open in IMG/M |
| 3300017412|Ga0182199_1085771 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 704 | Open in IMG/M |
| 3300017412|Ga0182199_1149449 | Not Available | 570 | Open in IMG/M |
| 3300017414|Ga0182195_1094444 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 706 | Open in IMG/M |
| 3300017422|Ga0182201_1100255 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 573 | Open in IMG/M |
| 3300017432|Ga0182196_1035297 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 833 | Open in IMG/M |
| 3300017432|Ga0182196_1051501 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 737 | Open in IMG/M |
| 3300017432|Ga0182196_1061750 | Not Available | 694 | Open in IMG/M |
| 3300017439|Ga0182200_1080815 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 646 | Open in IMG/M |
| 3300017440|Ga0182214_1046346 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 867 | Open in IMG/M |
| 3300017440|Ga0182214_1096156 | Not Available | 628 | Open in IMG/M |
| 3300017447|Ga0182215_1126441 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 581 | Open in IMG/M |
| 3300017693|Ga0182216_1201702 | Not Available | 524 | Open in IMG/M |
| 3300017694|Ga0182211_1058768 | Not Available | 884 | Open in IMG/M |
| 3300017694|Ga0182211_1070457 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 808 | Open in IMG/M |
| 3300020031|Ga0182119_101281 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 829 | Open in IMG/M |
| 3300025931|Ga0207644_11749797 | Not Available | 520 | Open in IMG/M |
| 3300026035|Ga0207703_10706827 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 959 | Open in IMG/M |
| 3300028049|Ga0268322_1021638 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 693 | Open in IMG/M |
| 3300028051|Ga0268344_1007939 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 721 | Open in IMG/M |
| 3300028055|Ga0268338_1010376 | Not Available | 784 | Open in IMG/M |
| 3300028055|Ga0268338_1032141 | Not Available | 560 | Open in IMG/M |
| 3300028058|Ga0268332_1073364 | Not Available | 517 | Open in IMG/M |
| 3300028153|Ga0268320_1011365 | Not Available | 672 | Open in IMG/M |
| 3300028472|Ga0268315_1003675 | Not Available | 910 | Open in IMG/M |
| 3300028525|Ga0268305_102146 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 861 | Open in IMG/M |
| 3300028529|Ga0268311_1002664 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1039 | Open in IMG/M |
| 3300032464|Ga0214492_1108861 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 510 | Open in IMG/M |
| 3300032465|Ga0214493_1064699 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 869 | Open in IMG/M |
| 3300032466|Ga0214503_1043160 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1330 | Open in IMG/M |
| 3300032466|Ga0214503_1175660 | Not Available | 668 | Open in IMG/M |
| 3300032469|Ga0214491_1162494 | Not Available | 516 | Open in IMG/M |
| 3300032490|Ga0214495_1068087 | Not Available | 830 | Open in IMG/M |
| 3300032502|Ga0214490_1060567 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 863 | Open in IMG/M |
| 3300032514|Ga0214502_1233150 | Not Available | 703 | Open in IMG/M |
| 3300032551|Ga0321339_1098948 | Not Available | 665 | Open in IMG/M |
| 3300032589|Ga0214500_1086860 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 885 | Open in IMG/M |
| 3300032625|Ga0214501_1037520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1477 | Open in IMG/M |
| 3300032699|Ga0214494_1074594 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 646 | Open in IMG/M |
| 3300032791|Ga0314748_1033942 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1068 | Open in IMG/M |
| 3300032915|Ga0314749_1092578 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 651 | Open in IMG/M |
| 3300033526|Ga0314761_1080436 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 724 | Open in IMG/M |
| 3300033530|Ga0314760_1125306 | Not Available | 631 | Open in IMG/M |
| 3300033540|Ga0314764_1020493 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1061 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 62.90% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 11.29% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 7.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.03% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020031 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033540 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070690_1013337231 | 3300005330 | Switchgrass Rhizosphere | MLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0070666_106481502 | 3300005335 | Switchgrass Rhizosphere | MTKSEEIMLQVDIKDKEGVVHGFWMVQSTKDVLDRGKESHQEVTRER* |
| Ga0070666_109240342 | 3300005335 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHRYWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0070668_1014841971 | 3300005347 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0070671_1007262912 | 3300005355 | Switchgrass Rhizosphere | MTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0070688_1007549221 | 3300005365 | Switchgrass Rhizosphere | MLQVDIKGKEGVVHMIWAVQSIQDVLDRSKELHQEATREN* |
| Ga0070667_1003633401 | 3300005367 | Switchgrass Rhizosphere | MTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0070667_1018232581 | 3300005367 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTR |
| Ga0070708_1013876771 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR* |
| Ga0070685_110801741 | 3300005466 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0070706_1004374932 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0068863_1012381122 | 3300005841 | Switchgrass Rhizosphere | MTQSEEIILQVDNKDKEEVVHGFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0068860_1011687321 | 3300005843 | Switchgrass Rhizosphere | MTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR* |
| Ga0105248_108138512 | 3300009177 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQKVTRER* |
| Ga0105249_113295322 | 3300009553 | Switchgrass Rhizosphere | MTQSEEVILNVDNKVKEGVVHGFWMVQSIKDVLDRGKELHQEVTRER* |
| Ga0105137_1017093 | 3300009972 | Switchgrass Associated | MTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0105137_1042052 | 3300009972 | Switchgrass Associated | MTQSEEVILQVDNKDKEGLVHGFWMVQSIKNVLDRGKKLRQEVTRER* |
| Ga0105129_1022231 | 3300009975 | Switchgrass Associated | KDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0105135_1052652 | 3300009980 | Switchgrass Associated | MTQSEKIMLQVHNKDKEGAVHGFWMVQSIKDVLDRGKKLRQEVTRKR* |
| Ga0105135_1108272 | 3300009980 | Switchgrass Associated | MTQSEEVILQVDNKDKEGVVHGFWTVQTIKDVLDRGKESHQEVTRER* |
| Ga0105133_1017241 | 3300009981 | Switchgrass Associated | MTQIEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0105120_10236492 | 3300009992 | Switchgrass Associated | MTQSEEIILQVDNKDKEGVVHGFWKVQSIKDVLNRGKESHQEVTIER* |
| Ga0105120_10254062 | 3300009992 | Switchgrass Associated | MTQSEKIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0105028_1173811 | 3300009993 | Switchgrass Associated | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER* |
| Ga0105126_10174652 | 3300009994 | Switchgrass Associated | MTQSEEIMLQVDNKDKEGVVHRFWMVQSIKDVLDRGKKLRQEVTRER* |
| Ga0105126_10272472 | 3300009994 | Switchgrass Associated | MTQTEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER* |
| Ga0105126_10334462 | 3300009994 | Switchgrass Associated | MTQSEEIMLQVDNKVKEGVVHGFWTVQSIKYVLDRGKKLRQEVTRER* |
| Ga0105139_10687891 | 3300009995 | Switchgrass Associated | MTQSGEIMLQVDIKGKEGVVHMIWAVQSIKDVLYRGKKLRQEVTRER* |
| Ga0105139_11081931 | 3300009995 | Switchgrass Associated | MTQSEEVILQVENKDNEGVVHGFWMVQNIKDVLDRGKESHQKVTRER* |
| Ga0134124_111417791 | 3300010397 | Terrestrial Soil | MTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0134127_111389662 | 3300010399 | Terrestrial Soil | MGQSEEIMLPVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0134122_132427071 | 3300010400 | Terrestrial Soil | MTQSEEIILHVDNKDKEGVVHGFWTVQSIKDVLDRGKKL |
| Ga0134121_111019152 | 3300010401 | Terrestrial Soil | MTQSEEIMLQVDNKDKEGVVHEFWMVQSIKDVLDRGKKLLQEVTRER* |
| Ga0134123_107156362 | 3300010403 | Terrestrial Soil | MTQSEEIILHVDNKDKEGVVHGFWTVQSIKDVLDRGKKLHQGVTRKRGSEGGPGTP* |
| Ga0157380_119047382 | 3300014326 | Switchgrass Rhizosphere | MTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0182183_10785362 | 3300015270 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESYQEVTRER* |
| Ga0182102_10043592 | 3300015273 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGIWTVQSTKYELDRSNEFHQEATRERRSGGGPEMP* |
| Ga0182099_10083922 | 3300015278 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVIRER* |
| Ga0182100_10266872 | 3300015280 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQEVTRER* |
| Ga0182100_10589562 | 3300015280 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGVWTVQSIKDELDRGKESHQEVTRER* |
| Ga0182100_10625792 | 3300015280 | Switchgrass Phyllosphere | MTQSEETMLQVDNMDKEGVVHGFWTEQSIKDVLDRGKKLR* |
| Ga0182101_10283851 | 3300015284 | Switchgrass Phyllosphere | MTQSEEIMLQVDMKYKGVVHEFWMVQSTKDVQDKGKELHQEATSER* |
| Ga0182101_10871291 | 3300015284 | Switchgrass Phyllosphere | EIMLQVDIKDKEGVVHEFWTVQSIKDILDRGKKLRQEVTRER* |
| Ga0182103_10734051 | 3300015293 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKL |
| Ga0182184_10592482 | 3300015301 | Switchgrass Phyllosphere | MTHSEEAILQVDNKDKEGVVQRFWMVKSIKDVLDRGKESHQEVTRER* |
| Ga0182180_10308402 | 3300015306 | Switchgrass Phyllosphere | MTQSEEVILQVDIKDKEGVVHRFWTVQSIKDVLDRGKESHQEVIRER* |
| Ga0182098_10865832 | 3300015309 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER* |
| Ga0182162_11024582 | 3300015310 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTREI* |
| Ga0182182_11167721 | 3300015311 | Switchgrass Phyllosphere | MIQSEEIMLQVDIKDKEGVVHRFWTAQITKDVLDRGKESHQEVTRER* |
| Ga0182168_10406881 | 3300015312 | Switchgrass Phyllosphere | MTQSEEIILQVDNNNKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0182164_10663431 | 3300015313 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHSFWMVQSIKDVLDRGKKSHPEVTRER* |
| Ga0182120_11390601 | 3300015315 | Switchgrass Phyllosphere | MTQSEEIMLQVDIKDKEGVLHGFWTVQSTKDVLDRGKESHQEATRERRSGGGPGEL* |
| Ga0182121_11038342 | 3300015316 | Switchgrass Phyllosphere | MTQSKEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0182136_10443472 | 3300015317 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKGGVVHGFWMGQSIKDVLDRGKESHKEVTRER* |
| Ga0182130_10362551 | 3300015319 | Switchgrass Phyllosphere | MTQSEEEILQVENKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRKR* |
| Ga0182130_10567641 | 3300015319 | Switchgrass Phyllosphere | MTQSGEIILQVDYKDKEGVVHRIWTVQSTKDELDRSNEFHQEATRERRSGGGPEMP* |
| Ga0182165_10124493 | 3300015320 | Switchgrass Phyllosphere | MTQSEKIMLQVDNKDKEGMVHGFWTVQSIKDVLDRGKKLRQEVTRKR* |
| Ga0182165_10682681 | 3300015320 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVYGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0182134_10677072 | 3300015324 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLCQEVTRER* |
| Ga0182134_11438311 | 3300015324 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKGKEGVVHGFWMMQSIKDVLDRGNKLRQEVTRER* |
| Ga0182148_10196971 | 3300015325 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQKVTRERSSRGGPGTP* |
| Ga0182114_11247991 | 3300015327 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGVVHSFWMVQSIKDVLDRGKKSHPEVTRER* |
| Ga0182153_10344061 | 3300015328 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKKLHQEVTRER* |
| Ga0182135_10237291 | 3300015329 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKKLLQEVTRER* |
| Ga0182135_10502733 | 3300015329 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHEFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0182135_10781192 | 3300015329 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRQR* |
| Ga0182152_11087421 | 3300015330 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLR* |
| Ga0182117_11410272 | 3300015332 | Switchgrass Phyllosphere | DNKDKEGVVHGFWIVQSIKDVLDRGKKLRREVTRKR* |
| Ga0182147_10724692 | 3300015333 | Switchgrass Phyllosphere | LQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER* |
| Ga0182147_11512121 | 3300015333 | Switchgrass Phyllosphere | MTQSEEIILQVDIKDKEGVVYGFWTVQSTKDVLDRGKESHQEVTRERRSGGGPGTP* |
| Ga0182150_10767152 | 3300015336 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTR* |
| Ga0182151_10833042 | 3300015337 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGLWTVQSIKDVLYRGKKLRQEVTRER* |
| Ga0182133_11864111 | 3300015340 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWMVKSIKDVLDRGKKLRQEVTRER* |
| Ga0182185_10733782 | 3300015349 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQRIKDVLDRGKKLCQEVTRKR* |
| Ga0182185_11060772 | 3300015349 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTREI* |
| Ga0182163_12539452 | 3300015350 | Switchgrass Phyllosphere | MTQNDEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR* |
| Ga0182179_13090151 | 3300015353 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWTVQNIKDVLDRGKKLRQEVTRER |
| Ga0182167_11395551 | 3300015354 | Switchgrass Phyllosphere | QVDNKDKEGVVHRFWTVQSIKDVLDRGKESHQEVTRER* |
| Ga0182167_12049211 | 3300015354 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQEVTRE |
| Ga0182167_12151011 | 3300015354 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDALDRGQKLRQEVTRER* |
| Ga0182167_13579481 | 3300015354 | Switchgrass Phyllosphere | MTQSEEIMLQVDIKDKEGVVHGFWTAQSTKDVLDRGKESHQEVTRERRSGGGPGTP* |
| Ga0182199_10857713 | 3300017412 | Switchgrass Phyllosphere | LQVDNKDKEGVVHGFWTVQIIKDVLDRDKKSHQEVTRER |
| Ga0182199_11494491 | 3300017412 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWTMQSIKDVLDRGKESHQKVTRER |
| Ga0182195_10944442 | 3300017414 | Switchgrass Phyllosphere | MTQSEEIMLQVDIKNKEGVVHGFWTVQSTKDVLDRGKELHQEATRER |
| Ga0182201_11002551 | 3300017422 | Switchgrass Phyllosphere | VDNKDKEGVVHGLWTVQSIKDVLYRGKKLRQEVTRER |
| Ga0182196_10352972 | 3300017432 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQKVTRER |
| Ga0182196_10515011 | 3300017432 | Switchgrass Phyllosphere | MTQSEEIILQVDNKEKEGVVHRFWMVQSIKDVLDRGKKLRQEVTRER |
| Ga0182196_10617502 | 3300017432 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRKR |
| Ga0182200_10808151 | 3300017439 | Switchgrass Phyllosphere | MTQSVRVILEVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER |
| Ga0182214_10463461 | 3300017440 | Switchgrass Phyllosphere | MTQSEEIMLQVDIKGKEGVVHRIWMVQSMKDVLDRSKQLHQQATREN |
| Ga0182214_10961562 | 3300017440 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKES |
| Ga0182215_11264412 | 3300017447 | Switchgrass Phyllosphere | NKDKEGVVHGFWTVQSIKDVLDRGKKLHQEVTRER |
| Ga0182216_12017021 | 3300017693 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKSHPEVTRER |
| Ga0182211_10587682 | 3300017694 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGGVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Ga0182211_10704572 | 3300017694 | Switchgrass Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER |
| Ga0182119_1012812 | 3300020031 | Switchgrass Phyllosphere | MLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR |
| Ga0207644_117497971 | 3300025931 | Switchgrass Rhizosphere | MTQSEEIMLQVDNKDKEGVVHRFWMVQRTKYVLDRGKKLHQEVTRER |
| Ga0207703_107068272 | 3300026035 | Switchgrass Rhizosphere | MTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Ga0268322_10216382 | 3300028049 | Phyllosphere | MTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTREI |
| Ga0268344_10079391 | 3300028051 | Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER |
| Ga0268338_10103762 | 3300028055 | Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR |
| Ga0268338_10321411 | 3300028055 | Phyllosphere | MTQSEEIILEVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER |
| Ga0268332_10733641 | 3300028058 | Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVKSIKDVLDRGKKLRQEVTRER |
| Ga0268320_10113651 | 3300028153 | Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDGGKKLRQEVTRKR |
| Ga0268315_10036751 | 3300028472 | Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTR |
| Ga0268305_1021462 | 3300028525 | Phyllosphere | MTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER |
| Ga0268311_10026642 | 3300028529 | Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLCQEVARER |
| Ga0214492_11088611 | 3300032464 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Ga0214493_10646993 | 3300032465 | Switchgrass Phyllosphere | MLQVDNKDKEGVVHGFWMVESIKDVLDRGKKLRQEVTRER |
| Ga0214503_10431602 | 3300032466 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHRFWMVQSIKYVLDRGKKLRQEVTRER |
| Ga0214503_11756601 | 3300032466 | Switchgrass Phyllosphere | MLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER |
| Ga0214491_11624942 | 3300032469 | Switchgrass Phyllosphere | MTQSEETMLQVDNMDKEGVVHGFWTEQSIKDVLDRGKKLRQEVPRER |
| Ga0214495_10680871 | 3300032490 | Switchgrass Phyllosphere | MTQSGEIMLQVDIKGKEGVVHMIWVVQSIQDVLDRSKSLHQEATREN |
| Ga0214490_10605672 | 3300032502 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER |
| Ga0214502_12331501 | 3300032514 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVQGFWTVQSIKDVLDRGKKLRQEVPRER |
| Ga0321339_10989482 | 3300032551 | Switchgrass Phyllosphere | MTQSEEVILQVDNKDKEGVVHGFWTEQSIKDVLDRGKKLR |
| Ga0214500_10868602 | 3300032589 | Switchgrass Phyllosphere | MLQVDNKDKEGVVHGFWTAQSIKELLDRGKKLRQEVTRER |
| Ga0214501_10375202 | 3300032625 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVPRER |
| Ga0214494_10745941 | 3300032699 | Switchgrass Phyllosphere | MTQSKEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Ga0314748_10339422 | 3300032791 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKYVLDRVKKLRQEVTRER |
| Ga0314749_10925782 | 3300032915 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTAQSIKELLDRGKKLRQEVTRER |
| Ga0314761_10804362 | 3300033526 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTAQRIKDVLDRGKKLRQKVTRER |
| Ga0314760_11253062 | 3300033530 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGWVHGFWTVQSIKDVLDRGKKLRQEVTRER |
| Ga0314764_10204932 | 3300033540 | Switchgrass Phyllosphere | MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVPRER |
| ⦗Top⦘ |