NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068365

Metagenome / Metatranscriptome Family F068365

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068365
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 62 residues
Representative Sequence VCHGETTAKDFAGKPALSTCDSCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Number of Associated Samples 101
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 75.81 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.968 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(24.194 % of family members)
Environment Ontology (ENVO) Unclassified
(56.452 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(38.710 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.44%    β-sheet: 0.00%    Coil/Unstructured: 85.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF14522Cytochrome_C7 1.61
PF01381HTH_3 1.61
PF00083Sugar_tr 1.61
PF01380SIS 1.61
PF03544TonB_C 1.61
PF00563EAL 0.81
PF01464SLT 0.81
PF13398Peptidase_M50B 0.81
PF00664ABC_membrane 0.81
PF01212Beta_elim_lyase 0.81
PF07973tRNA_SAD 0.81
PF13304AAA_21 0.81
PF01261AP_endonuc_2 0.81
PF06969HemN_C 0.81
PF02785Biotin_carb_C 0.81
PF02447GntP_permease 0.81
PF02687FtsX 0.81
PF00881Nitroreductase 0.81
PF07690MFS_1 0.81
PF06863DUF1254 0.81
PF13442Cytochrome_CBB3 0.81
PF01875Memo 0.81
PF14310Fn3-like 0.81
PF12796Ank_2 0.81
PF01144CoA_trans 0.81
PF00741Gas_vesicle 0.81
PF14437MafB19-deam 0.81
PF05598DUF772 0.81
PF00903Glyoxalase 0.81
PF13602ADH_zinc_N_2 0.81
PF01522Polysacc_deac_1 0.81
PF02163Peptidase_M50 0.81
PF13744HTH_37 0.81
PF07992Pyr_redox_2 0.81
PF13620CarboxypepD_reg 0.81
PF00588SpoU_methylase 0.81
PF07238PilZ 0.81
PF00221Lyase_aromatic 0.81
PF00266Aminotran_5 0.81
PF00071Ras 0.81
PF03992ABM 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 1.61
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.61
COG2610H+/gluconate symporter GntT or related permease, GntP/DsdX familyCarbohydrate transport and metabolism [G] 1.61
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.81
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.81
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.81
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.81
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.81
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.81
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 0.81
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 0.81
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.81
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.81
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.81
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.81
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.81
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.81
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.81
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.81
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.81
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.81
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.81
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.81
COG0635Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductaseCoenzyme transport and metabolism [H] 0.81
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.81
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.81
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.81
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.81
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.81
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.81
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.81
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.81
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.81
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.97 %
UnclassifiedrootN/A4.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_103336493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii621Open in IMG/M
3300004152|Ga0062386_101577612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii547Open in IMG/M
3300005541|Ga0070733_10067456All Organisms → cellular organisms → Bacteria2251Open in IMG/M
3300009524|Ga0116225_1054511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1916Open in IMG/M
3300009624|Ga0116105_1033473All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300009628|Ga0116125_1207459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii559Open in IMG/M
3300009636|Ga0116112_1006048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5616Open in IMG/M
3300009636|Ga0116112_1006836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 1465093Open in IMG/M
3300009698|Ga0116216_10989569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii503Open in IMG/M
3300009764|Ga0116134_1261022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii597Open in IMG/M
3300014153|Ga0181527_1014964All Organisms → cellular organisms → Bacteria5336Open in IMG/M
3300014167|Ga0181528_10235904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae987Open in IMG/M
3300014169|Ga0181531_10552941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii712Open in IMG/M
3300014199|Ga0181535_10872912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii508Open in IMG/M
3300014200|Ga0181526_10008184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00687420Open in IMG/M
3300014200|Ga0181526_10623843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii681Open in IMG/M
3300014200|Ga0181526_10713492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii632Open in IMG/M
3300014200|Ga0181526_10926612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii548Open in IMG/M
3300014491|Ga0182014_10613293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii523Open in IMG/M
3300014493|Ga0182016_10020367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685945Open in IMG/M
3300014494|Ga0182017_10530541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii720Open in IMG/M
3300014496|Ga0182011_10470486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii812Open in IMG/M
3300014502|Ga0182021_10961443Not Available1027Open in IMG/M
3300014638|Ga0181536_10008359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9961Open in IMG/M
3300014654|Ga0181525_10401039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii753Open in IMG/M
3300014655|Ga0181516_10625843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii556Open in IMG/M
3300014838|Ga0182030_11542571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii546Open in IMG/M
3300014839|Ga0182027_11887056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii575Open in IMG/M
3300016701|Ga0181509_1155226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii627Open in IMG/M
3300016705|Ga0181507_1168187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii614Open in IMG/M
3300016750|Ga0181505_10107219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia1850Open in IMG/M
3300016750|Ga0181505_10108545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii885Open in IMG/M
3300017929|Ga0187849_1331709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii564Open in IMG/M
3300017931|Ga0187877_1025527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3068Open in IMG/M
3300017935|Ga0187848_10031386All Organisms → cellular organisms → Bacteria2679Open in IMG/M
3300017940|Ga0187853_10072619All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis1726Open in IMG/M
3300017946|Ga0187879_10024590All Organisms → cellular organisms → Bacteria3691Open in IMG/M
3300017946|Ga0187879_10152147Not Available1309Open in IMG/M
3300017955|Ga0187817_11075578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii516Open in IMG/M
3300017988|Ga0181520_10676533All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300017988|Ga0181520_10704039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii690Open in IMG/M
3300018014|Ga0187860_1042115Not Available2380Open in IMG/M
3300018016|Ga0187880_1174829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60990Open in IMG/M
3300018021|Ga0187882_1112921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → Mucilaginibacter gotjawali1144Open in IMG/M
3300018023|Ga0187889_10339109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii659Open in IMG/M
3300018025|Ga0187885_10016154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4477Open in IMG/M
3300018026|Ga0187857_10000284All Organisms → cellular organisms → Bacteria64261Open in IMG/M
3300018035|Ga0187875_10177633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1182Open in IMG/M
3300018035|Ga0187875_10597361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii582Open in IMG/M
3300018037|Ga0187883_10003292All Organisms → cellular organisms → Bacteria → Acidobacteria9607Open in IMG/M
3300018037|Ga0187883_10451196All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300018037|Ga0187883_10467232All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300018040|Ga0187862_10107979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1919Open in IMG/M
3300018040|Ga0187862_10213401All Organisms → cellular organisms → Bacteria → Acidobacteria1260Open in IMG/M
3300018042|Ga0187871_10006753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8229Open in IMG/M
3300018044|Ga0187890_10651617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii594Open in IMG/M
3300018046|Ga0187851_10085054All Organisms → cellular organisms → Bacteria1988Open in IMG/M
3300018047|Ga0187859_10356476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii798Open in IMG/M
3300018047|Ga0187859_10928392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii501Open in IMG/M
3300018057|Ga0187858_10221733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1225Open in IMG/M
3300018062|Ga0187784_11000927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii664Open in IMG/M
3300019268|Ga0181514_1430109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii791Open in IMG/M
3300019788|Ga0182028_1198473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii562Open in IMG/M
3300023090|Ga0224558_1002347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis17547Open in IMG/M
3300023090|Ga0224558_1160627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii711Open in IMG/M
3300023090|Ga0224558_1186290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii636Open in IMG/M
3300023101|Ga0224557_1137904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii920Open in IMG/M
3300027867|Ga0209167_10131521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1301Open in IMG/M
3300028268|Ga0255348_1042071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii850Open in IMG/M
3300028560|Ga0302144_10303181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii517Open in IMG/M
3300028565|Ga0302145_10171536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii728Open in IMG/M
3300028577|Ga0265318_10007519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4917Open in IMG/M
3300028748|Ga0302156_10443655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii559Open in IMG/M
3300028765|Ga0302198_10497391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii545Open in IMG/M
3300028779|Ga0302266_10016294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684087Open in IMG/M
3300028785|Ga0302201_10214769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii793Open in IMG/M
3300028798|Ga0302222_10294876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii632Open in IMG/M
3300028801|Ga0302226_10269075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola721Open in IMG/M
3300028813|Ga0302157_10024687All Organisms → cellular organisms → Bacteria4834Open in IMG/M
3300028813|Ga0302157_10621420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii555Open in IMG/M
3300028874|Ga0302155_10202342All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300029883|Ga0311327_10002557All Organisms → cellular organisms → Bacteria16152Open in IMG/M
3300029911|Ga0311361_10042218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis7581Open in IMG/M
3300029944|Ga0311352_10711277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola792Open in IMG/M
3300029951|Ga0311371_11533262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella paludicola739Open in IMG/M
3300029953|Ga0311343_10139232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682669Open in IMG/M
3300029953|Ga0311343_11241715Not Available565Open in IMG/M
3300029954|Ga0311331_10685361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii949Open in IMG/M
3300029986|Ga0302188_10135917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1070Open in IMG/M
3300029993|Ga0302304_10166511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni826Open in IMG/M
3300029997|Ga0302302_1359360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii515Open in IMG/M
3300030011|Ga0302270_10387725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii748Open in IMG/M
3300030020|Ga0311344_11197642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300030044|Ga0302281_10374450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii553Open in IMG/M
3300030519|Ga0302193_10013699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685930Open in IMG/M
3300030646|Ga0302316_10015733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3969Open in IMG/M
3300030646|Ga0302316_10092343All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1297Open in IMG/M
3300031234|Ga0302325_10084123All Organisms → cellular organisms → Bacteria6063Open in IMG/M
3300031235|Ga0265330_10034073All Organisms → cellular organisms → Bacteria2275Open in IMG/M
3300031239|Ga0265328_10094801All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300031258|Ga0302318_10376373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii714Open in IMG/M
3300031259|Ga0302187_10457177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii593Open in IMG/M
3300031261|Ga0302140_10770549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii692Open in IMG/M
3300031670|Ga0307374_10432920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii740Open in IMG/M
3300031712|Ga0265342_10657898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii526Open in IMG/M
3300031726|Ga0302321_101477662All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031788|Ga0302319_11905819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium509Open in IMG/M
3300032770|Ga0335085_12071272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii575Open in IMG/M
3300032895|Ga0335074_10208636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2367Open in IMG/M
3300032896|Ga0335075_11230766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii646Open in IMG/M
3300032898|Ga0335072_10757782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii937Open in IMG/M
3300033134|Ga0335073_10893607All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300033134|Ga0335073_11723803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii590Open in IMG/M
3300033134|Ga0335073_11878809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii555Open in IMG/M
3300033402|Ga0326728_10127412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2888Open in IMG/M
3300033402|Ga0326728_11060505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii554Open in IMG/M
3300033405|Ga0326727_10050720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686529Open in IMG/M
3300033405|Ga0326727_10275331Not Available1696Open in IMG/M
3300033405|Ga0326727_10592559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii926Open in IMG/M
3300033405|Ga0326727_10744619All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300033561|Ga0371490_1016487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2581Open in IMG/M
3300033822|Ga0334828_151086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii536Open in IMG/M
3300033823|Ga0334837_064536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii865Open in IMG/M
3300033983|Ga0371488_0196317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1020Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland24.19%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog17.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog10.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.26%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil6.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.65%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.03%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen4.03%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.23%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.42%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.61%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.61%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.81%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028874Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10333649323300001213WetlandPHGDNGVECTTCHGETTAADFASRPALSTCETCHTDQVAQLKSEPFMKGKTCVNCHQAHVFVAHKKAAPAGEK*
Ga0062386_10157761213300004152Bog Forest SoilETIAKDFAGTPGLSTCATCHSDQVAQLKSDPFMNGKTCVNCHQAHIFAEHKKAVPAEK*
Ga0070733_1006745633300005541Surface SoilTCHKAVYDQWQASPHAANGIECTGCHNEPTSKEFAGMPALSTCDTCHTDQVAQLKLDPFMKGKTCVNCHQAHTFVEHKKAAAAGK*
Ga0116225_105451123300009524Peatlands SoilVECTVCHGETTAKDFAGKPGLSTCETCHADQVAQLKSDPFMKGRTCVSCHQAHTFVEHKKAPPAGQ*
Ga0116105_103347313300009624PeatlandHAANDVECTVCHGETTSRDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK*
Ga0116125_120745913300009628PeatlandAANGVECTVCHGETTAKDFAATPAFSTCEACHTEQVAQLKSDPFMSGKTCVSCHQAHIFVEHKTAAPAAKQ*
Ga0116112_100604873300009636PeatlandAGTPALSTCDNCHADQVPQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPAVK*
Ga0116112_100683693300009636PeatlandVCHGETTAKDFAGKPALSTCDSCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK*
Ga0116216_1098956923300009698Peatlands SoilEPTAKDFAGMPALSACDTCHTDQVAQLKSDPFMKGRTCVSCHQAHTFVEHKKAPPAGQ*
Ga0116134_126102223300009764PeatlandSRDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK*
Ga0181527_101496413300014153BogDKDFAGMPAKSTCEACHSDQVAQLKSDPFMQGKTCVSCHQAHIFVEHKKTAPADK*
Ga0181528_1023590413300014167BogTSKDFAGTPALSTCDTCHTDQVAQLKSDAFMKDKTCVSCHQAHTFVEHKKAAPTGN*
Ga0181531_1055294113300014169BogSPDFAGTPALSTCDTCHTDQVAQLKSDAFMKDKTCVSCHQAHTFVEHKKAAPTGN*
Ga0181535_1087291223300014199BogSRDFAVTPALSTCETCHADQVPQLKSEPVMKGKTCVSCHQAHIFVEHKKVAPADK*
Ga0181526_1000818493300014200BogDFAGTPALSTCDTCHTDQVAQLKSDAFMKDKTCVSCHQAHTFVEHKKAAPTGN*
Ga0181526_1062384313300014200BogAANGVECTVCHGETTAKDFAGTPALSTCDTCHTDQVAQLKSDPFMKDKTCVSCHQAHTFVEHKKAAAAPAGE*
Ga0181526_1071349223300014200BogVCHGETTAKGFAGTPGLSTCDSCHTDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGK*
Ga0181526_1092661213300014200BogVCHGETTAKDFASVPAFSTCDSCHSDQVAQLKSDPFMKGKTCVNCHQPHVFAEHKKAAADTK*
Ga0182014_1061329323300014491BogCTVCHGETTAKDFAGKPGLSTCDSCHTDQVAQLKSDPFMNGKTCVSCHQAHAFVEHKTAAPAAK*
Ga0182016_1002036713300014493BogTAKDFAAVPAFSTCDSCHTDQVAQLKSDPFMAGRTCVSCHQAHVFVEHKKPAPPAK*
Ga0182017_1053054113300014494FenKASPHADVVECTVCHGETTSPDFTGTPVLSTCDTCHSDQVAQLKSDPFMNGKTCVSCHQAHIFVEHKKAAPAVK*
Ga0182011_1047048613300014496FenNGVECTVCHGETTSKDFAGRPALSTCDNCHTDQVPQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAVK*
Ga0182021_1096144313300014502FenKASPHADNGVECTVCHGETTAKDFAGTPGLSTCDTCHTDQVAQLKSDPFMNGKTCVSCHQAHIFAEHKKAAPEVK*
Ga0181536_1000835913300014638BogGVECTVCHGETTDKDFAGMPAKSTCEACHSDQVAQLKSDPFMQGKTCVSCHQAHIFVEHKKTAPADK*
Ga0181525_1040103913300014654BogHGETTSKDFAGTPALSTCDTCHTDQVAQLKSDAFMKDKTCVSCHQAHTFVEHKKAAPTGN
Ga0181516_1062584313300014655BogKALYDQWKASPHGSNGVECTACHGETTAPDFAGTPALSACDTCHTDQVAQLKSDPFMKGRTCVSCHQAHIFVEHKKAAPAGN*
Ga0182030_1154257113300014838BogASPHAANGVECTVCHGETTAKDFAGTPALSTCDNCHTDQVAQLKSDPFMKGRTCVSCHQAHIFVEHKMAAPAGK*
Ga0182027_1188705613300014839FenNGVECTVCHGETTAPDFAGTPGLSTCETCHTDQVAQLKSDPFMKGRTCVSCHQAHIFVEHKTAAPAGK*
Ga0181509_115522613300016701PeatlandANSVECTVCHGETTAPDFAGKPGLGTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPADKK
Ga0181507_116818713300016705PeatlandKASPHGANGVECTVCHGETTAKDFAGKPGLSTCDSCHTDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGK
Ga0181505_1010721913300016750PeatlandHGETKSPDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAPPAGK
Ga0181505_1010854513300016750PeatlandHGETKSPDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0187849_133170913300017929PeatlandGETTSKDFAGTPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187877_102552713300017931PeatlandTAKDFASKPALSACDSCHADQVAQLKSDPFMNGKTCVSCHQAHAFVEHKKAAPAAQ
Ga0187848_1003138643300017935PeatlandGETTSRDFAGTPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187853_1007261913300017940PeatlandGVECTVCHGETTAKDFAGTAGISTCDACHTDQVAQLKSDPFMNGKTCVSCHQAHTFVEHKKAAPADK
Ga0187879_1002459063300017946PeatlandDFAGMPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0187879_1015214723300017946PeatlandVCHGETTAKDFAGKPGLSTCESCHTDQVAQLKSDPFMNGRTCVSCHQAHIFVEHKKAASAGK
Ga0187817_1107557813300017955Freshwater SedimentGETTAKDFAGTPAKSTCDTCHTDQVAQLKSDPFMKDRTCVSCHQAHTFVEHKKAAQAGQ
Ga0181520_1067653313300017988BogASPHAANGVECTVCHGETTAQDFAGIPGLSTCDTCHTDQVAQLKSDPFMKGKTCVNCHQPHVFAEHKKAAADTK
Ga0181520_1070403913300017988BogKPALSTCDSCHTDQVAQLKSDPFMNGKTCVSCHQAHAFVEHKKAAPAAQ
Ga0187860_104211513300018014PeatlandTTDKDFAGTPALSTCDACHGDQVAQLKSDAFMKDKTCVSCHQAHIFAEHKKAAPAGK
Ga0187880_117482913300018016PeatlandPHAANGVECTVCHGETTAKDFAAVPALSTCDSCHTDQVAQLKSDPFMTGKTCVSCHQAHTFVEHKTAVPAGK
Ga0187882_111292113300018021PeatlandANGVECTVCHGETTAKDFAGTPAISTCDACHTDQVAQLKSDPFMNGKTCVSCHQAHTFVEHKKAAPADK
Ga0187889_1033910923300018023PeatlandECTVCHGETTSRDFAGTPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187885_1001615413300018025PeatlandPHADNGVECTVCHGETTAKDFAGTPALSTCETCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAAK
Ga0187857_1000028413300018026PeatlandDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAPPAGK
Ga0187875_1017763313300018035PeatlandKDFAAVPALSTCDSCHSDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGQ
Ga0187875_1059736113300018035PeatlandDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVNCHQAHTFVEHKKAAPAGK
Ga0187883_1000329213300018037PeatlandNDVECTVCHGETTSRDFAGTPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187883_1045119613300018037PeatlandANGVECTVCHGETTAKDFASRPALSTCETCHTEQVAQLKSDPFMKDRTCVSCHQAHIFVEHKKAAPAGK
Ga0187883_1046723223300018037PeatlandHAANGVECTVCHGETTAKDFAAVPALSTCDSCHSDQVAQLKSDPFLNGKTCVSCHQAHIFVEHKKAAPAGK
Ga0187862_1010797933300018040PeatlandECTVCHGEPTSKDFAGMPALSACDTCHTDQVAQLKSDPFMKGKTCVSCHQAHIFVGHKKAAPAVK
Ga0187862_1021340133300018040PeatlandVCHGETTAKDFAGTPGLSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187871_1000675313300018042PeatlandDFAGTPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187890_1065161713300018044PeatlandCTVCHGETTDKDFAGKPGLGTCQTCHSDQVAQLKSDPFMKGRTCVSCHQAHTFVEHKQPAPADK
Ga0187851_1008505423300018046PeatlandGTPALSTCETCHTDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGK
Ga0187859_1035647633300018047PeatlandSRDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0187859_1092839213300018047PeatlandAANGVECTVCHGETTAKDFAAVPALSTCDSCHSDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGQ
Ga0187858_1022173313300018057PeatlandKASPHAANDVECTVCHGETTSRDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKTAPAGK
Ga0187784_1100092713300018062Tropical PeatlandSKDFAGMPALSACETCHTDQVAQLKSDPFMSGKTCVSCHQAHTFTEHKKAAPAAEK
Ga0181514_143010913300019268PeatlandNGVECTVCHGETTAKGFAGTPGLSTCDSCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0182028_119847313300019788FenGVECTECTVCHGETTSKDFAGRPALSTCDNCHTDQVPQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAVK
Ga0224558_1002347163300023090SoilDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFAEHKKAAPAGK
Ga0224558_116062713300023090SoilDFAGTPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0224558_118629013300023090SoilKPGLSTCDSCHTDQVAQLKSDPFMNGKTCVSCHQAHTFVEHKKAAPAGK
Ga0224557_113790413300023101SoilDQWKASPHAANGVECTVCHGETTAPDFAGTPALSACDNCHTDQVAQLKTDPFMKGRTCVSCHQAHIFVEHKKAAPAVK
Ga0209167_1013152113300027867Surface SoilAGMPALSTCDTCHTDQVAQLKLDPFMKGKTCVNCHQAHTFVEHKKAAAAGK
Ga0255348_104207123300028268SoilGEITAQSVAATPALSACDTCHAEQVAQLKSDPFKQGKTCVNCHQPHTFLGHPKAAPVGN
Ga0302144_1030318113300028560BogGETTSKDFAGRPALSTCDNCHTDQVPQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAVK
Ga0302145_1017153633300028565BogGETTSRDFAGMPALSTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAGK
Ga0265318_1000751953300028577RhizosphereATDFAGKPGLGTCDTCHTDQVAQLKSDPFMKGKTCVSCHHAHIFTEHKKAAPEGK
Ga0302156_1044365513300028748BogVECTVCHGETTAPDFAGIPGVSTCDTCHTDQVAQLKSDPFMKGKTCVNCHQPHVFAEHKKAAADTK
Ga0302198_1049739123300028765BogCTVCHGEITAQSVAAPPALSVCDTCHGEQVAQLKSDPFMKGKTCVNCHSPHTFLGHPKAAPAGK
Ga0302266_1001629433300028779BogASPHASNGVECTVCHGETTAPDFAGRPGLSACDTCHSDQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAVPAVK
Ga0302201_1021476913300028785BogCHGETTATDFAAIPALSTCGTCHDDQVAQLKSDPFMKDRTCVSCHQAHIFVEHKKTAPAG
Ga0302222_1029487623300028798PalsaSVECTVCHGETTAKDFAGKPGLSTCETCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPTS
Ga0302226_1026907513300028801PalsaTNSVECTVCHGETTAPDFAGKPGLSTCETCHSDQVASLKSDPFMNGKTCVSCHQAHAFVEHKTAAPASK
Ga0302157_1002468713300028813BogCHGETTAKDFAGKPALSTCDNCHTEQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPAE
Ga0302157_1062142013300028813BogFAGKPALSTCDSCHADQVAQLKIDPFMKDKTCVSCHQAHVFVEHKKDAPVAK
Ga0302155_1020234223300028874BogHAANGVECTVCHGETTAPDFAGIPGVSTCDTCHTDQVAQLKSDPFMKGKTCVNCHQPHVFAEHKKAAADTK
Ga0311327_10002557203300029883BogVECTVCHGETTAPDFAGRPALSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKAPPADKK
Ga0311361_1004221813300029911BogGTPALSTCDTCHSDQVAQLKSDAFMKGKTCVNCHQAHTFVEHKKAAPAGK
Ga0311352_1071127723300029944PalsaPDFAGKPGLSTCETCHSDQVASLKSDPFMNGKTCVSCHQAHAFVEHKTAAPASK
Ga0311371_1153326213300029951PalsaTTAPDFAGKPGLSTCETCHSDQVASLKSDPFMNGKTCVSCHQAHAFVEHKTAAPAGK
Ga0311343_1013923213300029953BogANGVECTACHGETTAPDFAGTPGLSACDTCHTEQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAPPQGK
Ga0311343_1124171523300029953BogFAGTPALSTCESCHSDQVAQLKSDPFMAGKTCVSCHQAHIFVEHKKAAPADK
Ga0311331_1068536113300029954BogTTAPDFAGKPGLSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPAEKK
Ga0302188_1013591723300029986BogETTSKDFAGRPALSTCDNCHTDQVPQLKSDPFMKGKTCVSCHQAHTFVEHKKAAPAVK
Ga0302304_1016651113300029993PalsaAASSVECTVCHGETTAPDFAATPALATCDTCHADQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPAAK
Ga0302302_135936023300029997PalsaCHGETTAPDFAGKPGLSTCETCHSDQVASLKSDPFMNGKTCVSCHQAHAFVEHKTAAPAG
Ga0302270_1038772513300030011BogHGETTAQDFAGTPALSTCDTCHSDQVAQLKSDAFMKGKTCVNCHQAHTFVEHKKAAPAGK
Ga0311344_1119764223300030020BogFAGRPALSTCDTCHSDQVAQLKSDPFMAGKTCVSCHQAHTFVEHKKTAPAGK
Ga0302281_1037445013300030044FenFAGIPGVSTCDTCHTDQVAQLKSDPFMKGKTCVNCHQPHVFAEHKKAAADTK
Ga0302193_1001369913300030519BogTAKDFAAVPAFSTCDSCHTDQVAQLKSDPFMAGRTCVSCHQAHVFVEHKKPAPPAK
Ga0302316_1001573343300030646PalsaASPHATNSVECTVCHGETTAPDFAGKPGLSTCETCHSDQVASLKSDPFMNGKTCVSCHQAHAFVEHKTAAPAGK
Ga0302316_1009234333300030646PalsaTAKDFAGKPGLSACETCHSDQVAQLKSDPFMNGKTCVTCHQAHTFVEHKKGAPTS
Ga0302325_1008412373300031234PalsaCHGETTAPDFAATPALATCDTCHADQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAAPAA
Ga0265330_1003407343300031235RhizosphereGKPGLGTCDTCHTDQVAQLKSDPFMKGKTCVSCHQAHIFTEHKKAAPEGK
Ga0265328_1009480123300031239RhizosphereNGVECTVCHGETTAKDFAGTPGLSTCATCHDDQVAQLKSDPFMKGKTCVSCHQAHIFAEHKKAAPAGK
Ga0302318_1037637313300031258BogCTVCHGETTAPDFAGRPGLSACDTCHSDQVAQLKSDPFMKGKTCVSCHQAHIFVEHKKAVPAVK
Ga0302187_1045717713300031259BogASGVECTVCHGEITAQSVAAPPALSVCDTCHGEQVAQLKSDPFMKGKTCVNCHSPHTFLGHPKAAPAGK
Ga0302140_1077054913300031261BogTTAKDFAAVPAFSTCDSCHSDQVAQLKSDPFMAGRTCVSCHQAHVFVEHKKAAPPAK
Ga0307374_1043292023300031670SoilCHGETTAKDFAGLPGLSTCENCHSDQVAQLKSDPFMKGKTCVSCHEAHIFVEHKKAAPAG
Ga0265342_1065789813300031712RhizosphereASPHAANGVECTVCHGETTADDFAGTPGLSTCETCHTDQVAQLKSDPFMKGKTCVSCHQAHVFAEHKKADAAGK
Ga0302321_10147766213300031726FenTAPDFAGTPALSSCDACHSDQVAQLKSDPFMKGKTCVNCHQAHIFVEHKKAAPTGK
Ga0302319_1190581913300031788BogHGETTAKDFAGKPGLSTCDSCHTDQVAQLKSDPFMKDKTCVSCHQAHIFVEHKKAAPAGK
Ga0335085_1207127213300032770SoilNGIECTMCHGDPASKEFAGMPALSTCDSCHSDQVAQVKSDPFMKDKTCVSCHQAHNFVEHKKAASAAK
Ga0335074_1020863613300032895SoilGTPALSTCATCHADQVEQLKSDPFMKGRTCVSCHQAHVFAEHKKAAPAGK
Ga0335075_1123076613300032896SoilDFAGTPGLSTCDACHGDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKPAPAGE
Ga0335072_1075778213300032898SoilGETTAKDFAGTPALSTCDLCHGDQVAQLKSDPFMKGKTCVSCHQAHTFVEHKKPAPAGE
Ga0335073_1089360713300033134SoilGIPGLSACDSCHSDQVAQLKSDEFMKGKTCVNCHQAHGFVAHKKAAATGEK
Ga0335073_1172380323300033134SoilRDFAGKPGLSTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHAFVEHKKAAPAGQ
Ga0335073_1187880913300033134SoilCTVCHGETTAKDFAGMPGLGTCDTCHSDQVAQLKSDPFMKGKTCVSCHQAHTFMEHKKADPAGKS
Ga0326728_1012741243300033402Peat SoilHGETTAKDFAGTPALSTCESCHTDQVAQLKSDPFMKGRTCVSCHQAHTFVEHKKAAPAGN
Ga0326728_1106050513300033402Peat SoilGLEFAGTPALSTCAACHDDQVAQLKSDPFMKGKTCVTCHQAHIFVEHKKAAPAPK
Ga0326727_1005072013300033405Peat SoilCTVCHGETTAPDFAGRPALSTCETCHSDQVPQLKSDPFMKGKTCVNCHQAHTFVMHKKAAPAGKQ
Ga0326727_1027533123300033405Peat SoilHAANGVECTVCHGETTDKDFAGMPAKSTCEACHSDQVAQLKSDPFMQGKTCVSCHQAHIFVEHKKTAPADK
Ga0326727_1059255923300033405Peat SoilCHGETTAKDFAGKPGLSTCETCHSDQVAQFKSSDQYKKGWRCVTCHQAHTFVEHKKAAPAGQ
Ga0326727_1074461923300033405Peat SoilETTAPEFAGRPALSTCDNCHGDQVAQLKTDPFMKGRTCVSCHQAHIFVEHKKAAPAGK
Ga0371490_101648733300033561Peat SoilDFAGTPALSTCDSCHSDQVAQLKSDPFMKGATCVNCHQAHVFVEHKKATPADK
Ga0334828_151086_340_5283300033822SoilVCHGETTSHDFAATPALSACDTCHADQVAQLKTDPFMKGKTCVNCHQAHTFVEHKKAAPAGE
Ga0334837_064536_1_2343300033823SoilQWKASPHAANGVECTVCHGETTAPDFAGTPALSACDSCHTDQVAQLKSDPFMKGKTCVNCHQAHIFVEHTKAAPAVK
Ga0371488_0196317_2_1753300033983Peat SoilTTDKDFAGMPAKSTCEACHSDQVAQLKSDPFMQGKTCVSCHQAHIFVEHKKTAPADK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.