| Basic Information | |
|---|---|
| Family ID | F068364 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSRLRKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.39 % |
| % of genes near scaffold ends (potentially truncated) | 95.16 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.419 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.677 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (44.355 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 21.77 |
| PF14026 | DUF4242 | 9.68 |
| PF03176 | MMPL | 4.03 |
| PF01569 | PAP2 | 2.42 |
| PF00072 | Response_reg | 1.61 |
| PF04264 | YceI | 1.61 |
| PF02687 | FtsX | 1.61 |
| PF03706 | LPG_synthase_TM | 0.81 |
| PF07366 | SnoaL | 0.81 |
| PF09348 | DUF1990 | 0.81 |
| PF08352 | oligo_HPY | 0.81 |
| PF01872 | RibD_C | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF01934 | HepT-like | 0.81 |
| PF00441 | Acyl-CoA_dh_1 | 0.81 |
| PF00083 | Sugar_tr | 0.81 |
| PF13577 | SnoaL_4 | 0.81 |
| PF06897 | DUF1269 | 0.81 |
| PF13401 | AAA_22 | 0.81 |
| PF12146 | Hydrolase_4 | 0.81 |
| PF13006 | Nterm_IS4 | 0.81 |
| PF00027 | cNMP_binding | 0.81 |
| PF00892 | EamA | 0.81 |
| PF13239 | 2TM | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF13359 | DDE_Tnp_4 | 0.81 |
| PF14690 | zf-ISL3 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 4.03 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 4.03 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.61 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.81 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.81 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.81 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.81 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.42 % |
| Unclassified | root | N/A | 47.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101510586 | Not Available | 710 | Open in IMG/M |
| 3300005468|Ga0070707_100147067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2293 | Open in IMG/M |
| 3300005471|Ga0070698_100719213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 941 | Open in IMG/M |
| 3300005764|Ga0066903_106618966 | Not Available | 603 | Open in IMG/M |
| 3300005764|Ga0066903_107554752 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005841|Ga0068863_101640486 | Not Available | 652 | Open in IMG/M |
| 3300005983|Ga0081540_1250906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300006031|Ga0066651_10764728 | Not Available | 522 | Open in IMG/M |
| 3300009545|Ga0105237_10752868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
| 3300009839|Ga0116223_10386892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300010333|Ga0134080_10642135 | Not Available | 521 | Open in IMG/M |
| 3300010359|Ga0126376_11118418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
| 3300010361|Ga0126378_12058400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300010361|Ga0126378_12562107 | Not Available | 583 | Open in IMG/M |
| 3300010361|Ga0126378_12650590 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010361|Ga0126378_12904042 | Not Available | 547 | Open in IMG/M |
| 3300010376|Ga0126381_101004973 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300010376|Ga0126381_101519424 | Not Available | 968 | Open in IMG/M |
| 3300010376|Ga0126381_101816122 | Not Available | 880 | Open in IMG/M |
| 3300010376|Ga0126381_102413365 | Not Available | 754 | Open in IMG/M |
| 3300010376|Ga0126381_104614111 | Not Available | 531 | Open in IMG/M |
| 3300010379|Ga0136449_101244929 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300010398|Ga0126383_10503978 | Not Available | 1269 | Open in IMG/M |
| 3300011085|Ga0138581_1085933 | Not Available | 649 | Open in IMG/M |
| 3300012200|Ga0137382_10494011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300012201|Ga0137365_10813198 | Not Available | 682 | Open in IMG/M |
| 3300012205|Ga0137362_10105087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2382 | Open in IMG/M |
| 3300012354|Ga0137366_10477565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 902 | Open in IMG/M |
| 3300012356|Ga0137371_10150926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1821 | Open in IMG/M |
| 3300012960|Ga0164301_11026577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300012971|Ga0126369_10689680 | Not Available | 1098 | Open in IMG/M |
| 3300012971|Ga0126369_11787254 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012977|Ga0134087_10063848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1479 | Open in IMG/M |
| 3300015371|Ga0132258_13601361 | Not Available | 1059 | Open in IMG/M |
| 3300016270|Ga0182036_11286740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300016319|Ga0182033_11232989 | Not Available | 671 | Open in IMG/M |
| 3300016341|Ga0182035_12054217 | Not Available | 519 | Open in IMG/M |
| 3300016357|Ga0182032_10742914 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300016357|Ga0182032_10793014 | Not Available | 800 | Open in IMG/M |
| 3300016357|Ga0182032_12071031 | Not Available | 500 | Open in IMG/M |
| 3300016371|Ga0182034_10987667 | Not Available | 727 | Open in IMG/M |
| 3300016404|Ga0182037_10944079 | Not Available | 749 | Open in IMG/M |
| 3300016445|Ga0182038_10320998 | Not Available | 1273 | Open in IMG/M |
| 3300016445|Ga0182038_10669286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300017955|Ga0187817_10105471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 1776 | Open in IMG/M |
| 3300017955|Ga0187817_10381990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300017955|Ga0187817_10901509 | Not Available | 565 | Open in IMG/M |
| 3300017961|Ga0187778_10491168 | Not Available | 814 | Open in IMG/M |
| 3300018001|Ga0187815_10067094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1509 | Open in IMG/M |
| 3300018085|Ga0187772_10109052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1792 | Open in IMG/M |
| 3300018085|Ga0187772_10428976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300025915|Ga0207693_11002536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 638 | Open in IMG/M |
| 3300025928|Ga0207700_11715159 | Not Available | 554 | Open in IMG/M |
| 3300027812|Ga0209656_10454767 | Not Available | 566 | Open in IMG/M |
| 3300027874|Ga0209465_10641014 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031543|Ga0318516_10570715 | Not Available | 647 | Open in IMG/M |
| 3300031544|Ga0318534_10260331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300031549|Ga0318571_10462942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella muralis | 505 | Open in IMG/M |
| 3300031561|Ga0318528_10765978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300031564|Ga0318573_10296838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 865 | Open in IMG/M |
| 3300031572|Ga0318515_10273509 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031572|Ga0318515_10681271 | Not Available | 544 | Open in IMG/M |
| 3300031668|Ga0318542_10157137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300031680|Ga0318574_10606800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL S-4 | 642 | Open in IMG/M |
| 3300031681|Ga0318572_10550698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300031681|Ga0318572_10903776 | Not Available | 524 | Open in IMG/M |
| 3300031681|Ga0318572_10949451 | Not Available | 511 | Open in IMG/M |
| 3300031682|Ga0318560_10811437 | Not Available | 505 | Open in IMG/M |
| 3300031723|Ga0318493_10660687 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031744|Ga0306918_10442226 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031748|Ga0318492_10242164 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031751|Ga0318494_10084057 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300031751|Ga0318494_10118809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1471 | Open in IMG/M |
| 3300031751|Ga0318494_10731894 | Not Available | 579 | Open in IMG/M |
| 3300031765|Ga0318554_10058367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
| 3300031769|Ga0318526_10236909 | Not Available | 746 | Open in IMG/M |
| 3300031777|Ga0318543_10523424 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031778|Ga0318498_10484980 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031779|Ga0318566_10286543 | Not Available | 815 | Open in IMG/M |
| 3300031782|Ga0318552_10721536 | Not Available | 509 | Open in IMG/M |
| 3300031796|Ga0318576_10536163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300031797|Ga0318550_10520491 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031797|Ga0318550_10580136 | Not Available | 539 | Open in IMG/M |
| 3300031798|Ga0318523_10215086 | Not Available | 960 | Open in IMG/M |
| 3300031798|Ga0318523_10607422 | Not Available | 538 | Open in IMG/M |
| 3300031805|Ga0318497_10222013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1046 | Open in IMG/M |
| 3300031805|Ga0318497_10846303 | Not Available | 513 | Open in IMG/M |
| 3300031835|Ga0318517_10073968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1466 | Open in IMG/M |
| 3300031859|Ga0318527_10061215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1491 | Open in IMG/M |
| 3300031880|Ga0318544_10405654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300031893|Ga0318536_10652363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300031896|Ga0318551_10343610 | Not Available | 844 | Open in IMG/M |
| 3300031910|Ga0306923_10161400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 2560 | Open in IMG/M |
| 3300031910|Ga0306923_10403991 | Not Available | 1554 | Open in IMG/M |
| 3300031910|Ga0306923_11192645 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031912|Ga0306921_11208527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300031946|Ga0310910_10307853 | Not Available | 1247 | Open in IMG/M |
| 3300031947|Ga0310909_10791905 | Not Available | 783 | Open in IMG/M |
| 3300031954|Ga0306926_10058819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4618 | Open in IMG/M |
| 3300031954|Ga0306926_11578457 | Not Available | 754 | Open in IMG/M |
| 3300032001|Ga0306922_10015933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7417 | Open in IMG/M |
| 3300032001|Ga0306922_10417390 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300032001|Ga0306922_10745003 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300032008|Ga0318562_10209904 | Not Available | 1128 | Open in IMG/M |
| 3300032010|Ga0318569_10462469 | Not Available | 592 | Open in IMG/M |
| 3300032039|Ga0318559_10026994 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300032039|Ga0318559_10469046 | Not Available | 587 | Open in IMG/M |
| 3300032041|Ga0318549_10431844 | Not Available | 593 | Open in IMG/M |
| 3300032043|Ga0318556_10492504 | Not Available | 641 | Open in IMG/M |
| 3300032052|Ga0318506_10356300 | Not Available | 649 | Open in IMG/M |
| 3300032054|Ga0318570_10458480 | Not Available | 582 | Open in IMG/M |
| 3300032067|Ga0318524_10309355 | Not Available | 818 | Open in IMG/M |
| 3300032068|Ga0318553_10207746 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300032068|Ga0318553_10674568 | Not Available | 541 | Open in IMG/M |
| 3300032076|Ga0306924_10400750 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300032089|Ga0318525_10242120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300032160|Ga0311301_10239934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3012 | Open in IMG/M |
| 3300032180|Ga0307471_103557398 | Not Available | 551 | Open in IMG/M |
| 3300032261|Ga0306920_100943716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1259 | Open in IMG/M |
| 3300032261|Ga0306920_101927855 | Not Available | 830 | Open in IMG/M |
| 3300032783|Ga0335079_11748546 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032805|Ga0335078_11348577 | Not Available | 810 | Open in IMG/M |
| 3300033289|Ga0310914_11316923 | Not Available | 625 | Open in IMG/M |
| 3300033805|Ga0314864_0175522 | Not Available | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015105861 | 3300000364 | Soil | MGIARRAAEIPAGGWTKWLVLGFWLVVVVVAFPLSGK |
| Ga0070707_1001470672 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTG |
| Ga0070698_1007192133 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRIRKAAEIPAGSWTKWVVVGFWVAVLLIALPLAGKLKG |
| Ga0066903_1066189662 | 3300005764 | Tropical Forest Soil | MSRLSKIAEIPAGSWTKWVVVGFWVVVLVITFPLSTKLMGAEK |
| Ga0066903_1075547521 | 3300005764 | Tropical Forest Soil | MNKVARRLAEIPAGSWTKWVVMGFWVAVLVVALPLA |
| Ga0068863_1016404863 | 3300005841 | Switchgrass Rhizosphere | MKNVARRFAEIPVGSWTKWVVVGFWVVAVAVAYPLSGK |
| Ga0081540_12509062 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSNVARRLAEIPAGSWTKWLVVGFWVVVVAVAYPLAG |
| Ga0066651_107647281 | 3300006031 | Soil | MNVARKIVEFPAGSWTKWLVVGFWVVVLVIAFPLSSKL |
| Ga0105237_107528681 | 3300009545 | Corn Rhizosphere | MGSLRRIAEIPAGSWTKWLVVGFWLVVLILAFPLSTKLTGAE |
| Ga0116223_103868922 | 3300009839 | Peatlands Soil | MSRLRKIAEIPAGSWTKWIVVGFWVLMLVILFPLSA |
| Ga0134080_106421351 | 3300010333 | Grasslands Soil | MNVARKIVEFPAGSWTKWLVVGFWVVVLVIAFPLSSKLTGA |
| Ga0126376_111184182 | 3300010359 | Tropical Forest Soil | MSKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPLAG |
| Ga0126378_120584001 | 3300010361 | Tropical Forest Soil | MNKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPLA |
| Ga0126378_125621072 | 3300010361 | Tropical Forest Soil | MSRVRRIAEVPTGSRAKWLVVGFWVVVLVDSFPLSK |
| Ga0126378_126505901 | 3300010361 | Tropical Forest Soil | MSRLGKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLMGAEK |
| Ga0126378_129040421 | 3300010361 | Tropical Forest Soil | MSGIRRIAEFPAGSWTKWVVVGFWVVVLVITFPLSKKLNH |
| Ga0126381_1010049733 | 3300010376 | Tropical Forest Soil | MNKVARRLTEIPAGSWTKWVVVGFWVVVLVITFPLSKKLNHA |
| Ga0126381_1015194242 | 3300010376 | Tropical Forest Soil | MNNTVRRLAEIPAGSWTKWVVVGFWVVVLVLAFPLQK |
| Ga0126381_1018161221 | 3300010376 | Tropical Forest Soil | MTKAARRLAEIPGGSWTKWLVMGFWVAVIVVALPL |
| Ga0126381_1024133653 | 3300010376 | Tropical Forest Soil | MNRLRKIAEIPAGSWTKWVVVGVWVVVLVIALPLSSKLTGA |
| Ga0126381_1046141112 | 3300010376 | Tropical Forest Soil | MNKVARRLAEIPAGSWTKWVVVAFWLVVLVIALPLSS |
| Ga0136449_1012449292 | 3300010379 | Peatlands Soil | MNSVKKLAEIPSGSWTKWIVVGFWLVVLVITLPLSSKLTGA* |
| Ga0126383_105039782 | 3300010398 | Tropical Forest Soil | MSTARRIAEIPAGSWTRWVVVGFWLVMLVVMFPLSG |
| Ga0138581_10859331 | 3300011085 | Peatlands Soil | MSRLRKIAEIPAGSWTKWVVVGFWVAVLVVMFSLSAKLMGAEKND |
| Ga0137382_104940112 | 3300012200 | Vadose Zone Soil | MSRARRIAEIPAGSWTKWLVVGFWLVVVVVAFPLSNKLMGA |
| Ga0137365_108131981 | 3300012201 | Vadose Zone Soil | MSRARRIAEIPAGSWTKWLVVGFWLVVVVVAFPLSNKLMGAEK |
| Ga0137362_101050874 | 3300012205 | Vadose Zone Soil | MSKLRRIAEIPAGSWTKWVVVGFWVVVLVLALPLSGVPAL* |
| Ga0137366_104775651 | 3300012354 | Vadose Zone Soil | MSGLRRIVEIPAGSWTKWLVVGFWVVVLVVAFPLS |
| Ga0137371_101509261 | 3300012356 | Vadose Zone Soil | MSRARRIAEIPAGSWTKWLVVGFWLVVEVVAFPLSNKLMGAEK |
| Ga0164301_110265771 | 3300012960 | Soil | MSKARRIAEIPAGSWTKWLVVGLWAVVLIISFPLA |
| Ga0126369_106896802 | 3300012971 | Tropical Forest Soil | MNKVARRLAEIPAGSWTKWVVMGFWVAVIVVAFPL |
| Ga0126369_117872542 | 3300012971 | Tropical Forest Soil | MNGVRKLAEIPAGSWTKWVVLGFWVIVLVITLPLSSKLI |
| Ga0134087_100638482 | 3300012977 | Grasslands Soil | MNVARKIVEFPAGSWTKWLVVGFWVVVLVIEVISAK* |
| Ga0132258_136013611 | 3300015371 | Arabidopsis Rhizosphere | MKNVAQRFAEIPVGSWTKWVVVGFWVVAVAVAYPLSGKLTGA |
| Ga0182036_112867402 | 3300016270 | Soil | MSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQ |
| Ga0182033_112329892 | 3300016319 | Soil | VSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKL |
| Ga0182035_120542171 | 3300016341 | Soil | MSKLGKIAEIPAGRWTKWLVVGFWVVMVAVLYPLSSKLTAA |
| Ga0182032_107429141 | 3300016357 | Soil | MSKLSKIAEIPAGSWTKWLVVGVWLVVVAVLYPLSTKLMGAEKN |
| Ga0182032_107930142 | 3300016357 | Soil | MSRLRTIAAIPAGSWTKWAVVGFWLVVLVVAHPLQSKLTALAGEMA |
| Ga0182032_120710312 | 3300016357 | Soil | MNKVARRLAEIPAGSWTKWVVMGFWVAVIVVALPLAGKLQHAYNNN |
| Ga0182034_109876672 | 3300016371 | Soil | MNRLRKIAEIPAGSWTKWVVVGVWVVVLVIALPLSS |
| Ga0182037_109440793 | 3300016404 | Soil | VSTLRKIAEIPTGSGTKWLVVGFWVVVLVAAFPLSK |
| Ga0182038_103209982 | 3300016445 | Soil | MSRLRRVAEIPAGSWTKWVVVGFWLAVLVLALPLSSKLSG |
| Ga0182038_106692863 | 3300016445 | Soil | MNKVGRRLVGIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSGVEKAA |
| Ga0187817_101054714 | 3300017955 | Freshwater Sediment | MSRLGKIAEIPAGSWTKWVVVGFWVLMLVILFPLSTKLN |
| Ga0187817_103819901 | 3300017955 | Freshwater Sediment | MSRLRKIAEIPAGSWTKWLVVGVWLVVIVLAFPLSSKLTGA |
| Ga0187817_109015091 | 3300017955 | Freshwater Sediment | MSRLRKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL |
| Ga0187778_104911681 | 3300017961 | Tropical Peatland | MSRLRTIAAIPAGSWTKWLAVGFWVAVLVVMFPLSAKL |
| Ga0187815_100670941 | 3300018001 | Freshwater Sediment | MSRLGKIAEIPAGSWTKWIVVGFWVVVLVLAFPLSKKLT |
| Ga0187772_101090521 | 3300018085 | Tropical Peatland | MSRLRKITLIPAGSWTQRVVVGSWVLMLVTLSRCQHS |
| Ga0187772_104289762 | 3300018085 | Tropical Peatland | MSRLRNVAEIPAGSWTKWVVVGFWVVVLVVMFPLS |
| Ga0207693_110025361 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRLRKIAEFPAGSWTKWVVVGVWVVVLVILFPLSKKI |
| Ga0207700_117151591 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNVARRFAEIPAGSWTKWVVVGFWVVAVAVAYPLSGKLT |
| Ga0209656_104547672 | 3300027812 | Bog Forest Soil | MSRLGKIAEIPAGSWTKWVVVGFWVLMLVILFPLSTKLNGAEKNDAK |
| Ga0209465_106410141 | 3300027874 | Tropical Forest Soil | MKNVARRLTEIPAGSWTKWVVVGFWLVVLVIAAPLS |
| Ga0318516_105707151 | 3300031543 | Soil | MSRLRKIAEIPAGSWTKWLVVGCWLVVVVVAYPLQSKLMG |
| Ga0318534_102603312 | 3300031544 | Soil | MSRLRKIAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSGVEKAA |
| Ga0318571_104629421 | 3300031549 | Soil | MSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSKLTG |
| Ga0318528_107659781 | 3300031561 | Soil | MSSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSSKL |
| Ga0318573_102968381 | 3300031564 | Soil | MSKLSKIAEIPAGSWTKWLVVGVWLVVVAVLYPLSTK |
| Ga0318515_102735093 | 3300031572 | Soil | MSNVARRLAEIPAGSWTKWLVVGFWVVVVAVAYPL |
| Ga0318515_106812711 | 3300031572 | Soil | MSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSTRLT |
| Ga0318542_101571372 | 3300031668 | Soil | MSRLSKIAEIPAGSWTKWVVVGFWVVMLVILAPLSTKLMGA |
| Ga0318574_106068001 | 3300031680 | Soil | VRRIAEIPSGSRTRWLVVGFWLVVVVLAGPLSGKLT |
| Ga0318572_105506981 | 3300031681 | Soil | MSRLSRIAAIPAGSWTKWVVMGFWLVVLVVAYPLSSK |
| Ga0318572_109037761 | 3300031681 | Soil | MSRLRRIAEIPAGSWTRWVVVGFWLAVLVLALPLSS |
| Ga0318572_109494511 | 3300031681 | Soil | MNRLRKIAEIPAGSWTKWVVVGVWAVVLVIALPLS |
| Ga0318560_108114371 | 3300031682 | Soil | MSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSKLT |
| Ga0318493_106606871 | 3300031723 | Soil | VSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKLKHAEKN |
| Ga0306918_104422261 | 3300031744 | Soil | MSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLM |
| Ga0318492_102421643 | 3300031748 | Soil | MSKLSKIAEIPAGSWTKWLVVGVWVVVVAVLYPLSTKLM |
| Ga0318494_100840571 | 3300031751 | Soil | MNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSSKLMG |
| Ga0318494_101188092 | 3300031751 | Soil | MSRLRKIAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLSG |
| Ga0318494_107318942 | 3300031751 | Soil | MSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSS |
| Ga0318554_100583671 | 3300031765 | Soil | MSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLST |
| Ga0318526_102369091 | 3300031769 | Soil | MSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSS |
| Ga0318543_105234242 | 3300031777 | Soil | MNGVKKLAEIPAGSWTKWVVLGFWVVVLVITLPLSSKLM |
| Ga0318498_104849801 | 3300031778 | Soil | MNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSS |
| Ga0318566_102865431 | 3300031779 | Soil | MNKVGRRLAEIPAGSWTKWIVVGFWLVVLLIALPLSGKL |
| Ga0318552_107215361 | 3300031782 | Soil | MSRLRKIAEIPAGSWTKWLVVGLWLVVVAVAYPLQS |
| Ga0318576_105361631 | 3300031796 | Soil | MSSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSS |
| Ga0318550_105204911 | 3300031797 | Soil | MNGVKKLADIPAGSWTKWVVMGFWVVVLVIALPLSSK |
| Ga0318550_105801361 | 3300031797 | Soil | MNKVGRRLAGIPAGSWTKWLVVGFWVVIFAVAYPLAGKLG |
| Ga0318523_102150862 | 3300031798 | Soil | MSRLRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLTGAEKN |
| Ga0318523_106074221 | 3300031798 | Soil | MSKLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSTRL |
| Ga0318497_102220133 | 3300031805 | Soil | MSKLSKIAEIPAGSWTKWLVVGVWVVVVAVLYPLSTK |
| Ga0318497_108463032 | 3300031805 | Soil | MSRPRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLS |
| Ga0318517_100739684 | 3300031835 | Soil | MSKVARRLAGIPAGSWTKYAVVGFWVVVLVVAFPLAGKLGHAYKN |
| Ga0318527_100612151 | 3300031859 | Soil | MSKAARRLAEIPGGSWTKWLVMGFWVAVMVVAFPLSAK |
| Ga0318544_104056542 | 3300031880 | Soil | MSSLRKIAEIPAGSWTKWVVVGFWLVILVLAFPLS |
| Ga0318536_106523631 | 3300031893 | Soil | MSWLRKAAEIPAGSWTKWVVVGFWVAVLVITFPLAG |
| Ga0318551_103436102 | 3300031896 | Soil | MNGLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQKKLTGAE |
| Ga0306923_101614002 | 3300031910 | Soil | MNGLKKIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKL |
| Ga0306923_104039911 | 3300031910 | Soil | MSKLGKIAEIPAGSWTKWLVVGFWVVMVAVLYPLSSKLTAA |
| Ga0306923_111926451 | 3300031910 | Soil | MSKVVRRLAEIPAGSWTKWVVMGFWVAAVVVALPLAGKLMHA |
| Ga0306921_112085272 | 3300031912 | Soil | MSKLGKIAEIPAGRWTKWLVVGFWVVMVAVLYPLSSKL |
| Ga0310910_103078531 | 3300031946 | Soil | MSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSSKL |
| Ga0310909_107919051 | 3300031947 | Soil | MSAVARRLAGIPAGSWTKWLVVGFWVVVVVAAYPLQNK |
| Ga0306926_100588191 | 3300031954 | Soil | MSRLRTIAAIPAGSWTKWVVVGFWLVVLVVAYPPQS |
| Ga0306926_115784572 | 3300031954 | Soil | MSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSTL |
| Ga0306922_100159337 | 3300032001 | Soil | MSRLSKIAEIPAGSWTKWVVVGFWVVVLVLAFPLQK |
| Ga0306922_104173902 | 3300032001 | Soil | MSLRRIAEIPAGSWTKWVVVGFWLVILVLAFPLSS |
| Ga0306922_107450031 | 3300032001 | Soil | MDKVARRIAGIPAGSWTKWLVVGFWVVVVLVAYPL |
| Ga0318562_102099042 | 3300032008 | Soil | MSKLRRIAEIPAGTWTKWVVVGFWLAVLVLALPLSSK |
| Ga0318569_104624691 | 3300032010 | Soil | MNKVGRRLAGIPAGSWTKWLVVGFWVVIFAVAYPLAGKLGH |
| Ga0318559_100269941 | 3300032039 | Soil | MSAVARRLAGIPAGSWTKWLVVGFWVVVVVAAYPLSGK |
| Ga0318559_104690462 | 3300032039 | Soil | MSTLRKIAEIPAGSWIKWLVVGFWVAVLVAAFPLSK |
| Ga0318549_104318441 | 3300032041 | Soil | MNKVGRRLAEIPAGSWTKWIVVGFWLVVLLIALPLS |
| Ga0318556_104925042 | 3300032043 | Soil | VSTLRKIAEIPAGSWTKWLVVGFWVAVLAVASPLAIKLKH |
| Ga0318506_103563001 | 3300032052 | Soil | MSKVVRRLAEIPAGSWTKWVVMGFWLVVVVVAAPLAG |
| Ga0318570_104584801 | 3300032054 | Soil | MNKVGRRLVGIPAGSWTKWLVVGFWVVIFAVAYPLA |
| Ga0318524_103093553 | 3300032067 | Soil | MNKVGRRLAEIPAGSWTKWLVVGFWVVIFVVAYPLSG |
| Ga0318553_102077461 | 3300032068 | Soil | VSTLRRIAEIPTGSWTKWLVVGFWVVVLVVAFPLSKKLNGAE |
| Ga0318553_106745681 | 3300032068 | Soil | MNRLRKIAEIPAGSWTKWVVVGVWAVVLVIALPLSSKLT |
| Ga0306924_104007502 | 3300032076 | Soil | MSRLRNIAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTGA |
| Ga0318525_102421202 | 3300032089 | Soil | MSRLSRIAAIPAGSWTKWVVMGFWLVVLVVAYPLSGKLT |
| Ga0311301_102399344 | 3300032160 | Peatlands Soil | MSRLRKIAEIPAGSWTKWIVVGFWVLMLVILFPLSAKLQGAEK |
| Ga0307471_1035573981 | 3300032180 | Hardwood Forest Soil | MSKIARRLAEIPAGSWTKWLVVGFWLVVVVVAYPLQSKLNGVEK |
| Ga0306920_1009437161 | 3300032261 | Soil | MSTLKKLAEIPAGSWTKWVVVGFWVVVLVLAFPLSKKLTGAEK |
| Ga0306920_1019278551 | 3300032261 | Soil | MNNTARRLAEIPAGSWTKWVVVGFWVLMLVLLYPLSAKLQH |
| Ga0335079_117485462 | 3300032783 | Soil | MNRIGRLAEIPAGSWTKWVVVGFWVVVLVIMAPLSSK |
| Ga0335078_113485771 | 3300032805 | Soil | MSTLKKLAEIPAGSWTKWVVVGFWVVVLVLAFPLSKK |
| Ga0310914_113169231 | 3300033289 | Soil | MSRLRRIAEIPAGSWTKWVVVGFWLVVLVLAFPLSSK |
| Ga0314864_0175522_3_107 | 3300033805 | Peatland | MSTLRRIAEVPAGSWTKWVVVGFWVVVLVLAFPLS |
| ⦗Top⦘ |