NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068339

Metagenome / Metatranscriptome Family F068339

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068339
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 108 residues
Representative Sequence MAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Number of Associated Samples 87
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 75.00 %
% of genes near scaffold ends (potentially truncated) 38.71 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(71.774 % of family members)
Environment Ontology (ENVO) Unclassified
(88.710 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(74.194 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005466|Ga0070685_10368646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum986Open in IMG/M
3300005468|Ga0070707_101323878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300005615|Ga0070702_101421501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300005841|Ga0068863_101000812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum838Open in IMG/M
3300005843|Ga0068860_102423746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300009980|Ga0105135_104625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum881Open in IMG/M
3300009980|Ga0105135_125245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300009981|Ga0105133_103707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum916Open in IMG/M
3300009981|Ga0105133_122529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300009990|Ga0105132_104358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum980Open in IMG/M
3300009995|Ga0105139_1017103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1039Open in IMG/M
3300009995|Ga0105139_1037391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300009995|Ga0105139_1045601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum758Open in IMG/M
3300009995|Ga0105139_1060536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300010396|Ga0134126_12058695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300010400|Ga0134122_12292352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300010401|Ga0134121_11914113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300010401|Ga0134121_12178452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300014968|Ga0157379_10353271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1346Open in IMG/M
3300014968|Ga0157379_12008844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum571Open in IMG/M
3300015280|Ga0182100_1002583All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1485Open in IMG/M
3300015280|Ga0182100_1081311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300015290|Ga0182105_1033555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum747Open in IMG/M
3300015293|Ga0182103_1023112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum801Open in IMG/M
3300015293|Ga0182103_1080131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300015297|Ga0182104_1056329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300015297|Ga0182104_1063473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015301|Ga0182184_1065323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300015301|Ga0182184_1072928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015306|Ga0182180_1047900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300015309|Ga0182098_1103656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015310|Ga0182162_1010769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1134Open in IMG/M
3300015311|Ga0182182_1010751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1108Open in IMG/M
3300015312|Ga0182168_1067721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300015313|Ga0182164_1016387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1045Open in IMG/M
3300015313|Ga0182164_1102940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015313|Ga0182164_1125501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300015315|Ga0182120_1025175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum925Open in IMG/M
3300015315|Ga0182120_1085782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300015316|Ga0182121_1083137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300015316|Ga0182121_1113493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015319|Ga0182130_1027712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum870Open in IMG/M
3300015319|Ga0182130_1045333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum746Open in IMG/M
3300015320|Ga0182165_1023748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum972Open in IMG/M
3300015324|Ga0182134_1033012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum867Open in IMG/M
3300015324|Ga0182134_1050288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300015326|Ga0182166_1082436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015326|Ga0182166_1101047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015326|Ga0182166_1126578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015328|Ga0182153_1095234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300015328|Ga0182153_1115946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300015329|Ga0182135_1129937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015330|Ga0182152_1041537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum824Open in IMG/M
3300015331|Ga0182131_1025182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum969Open in IMG/M
3300015332|Ga0182117_1020642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1111Open in IMG/M
3300015333|Ga0182147_1128000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015333|Ga0182147_1137555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015335|Ga0182116_1044943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum878Open in IMG/M
3300015335|Ga0182116_1140959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015336|Ga0182150_1018419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1093Open in IMG/M
3300015336|Ga0182150_1074229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300015337|Ga0182151_1043121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300015337|Ga0182151_1151036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300015340|Ga0182133_1120049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300015340|Ga0182133_1132157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015348|Ga0182115_1181490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015348|Ga0182115_1260641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015349|Ga0182185_1056379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1048Open in IMG/M
3300015349|Ga0182185_1269851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015350|Ga0182163_1252446All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300015352|Ga0182169_1251089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum575Open in IMG/M
3300015353|Ga0182179_1077512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum961Open in IMG/M
3300015353|Ga0182179_1287586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015354|Ga0182167_1140927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum889Open in IMG/M
3300015354|Ga0182167_1164925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum816Open in IMG/M
3300015354|Ga0182167_1216621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum697Open in IMG/M
3300017414|Ga0182195_1046896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum906Open in IMG/M
3300017414|Ga0182195_1077346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum760Open in IMG/M
3300017422|Ga0182201_1082434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300017439|Ga0182200_1007948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1372Open in IMG/M
3300017439|Ga0182200_1060489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300017440|Ga0182214_1036599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum967Open in IMG/M
3300017440|Ga0182214_1080375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300017446|Ga0182217_1142461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300017691|Ga0182212_1153914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300017692|Ga0182210_1075071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300017693|Ga0182216_1073300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum779Open in IMG/M
3300017694|Ga0182211_1080973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300017694|Ga0182211_1158832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300020023|Ga0182178_1010730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300020031|Ga0182119_100372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1199Open in IMG/M
3300025903|Ga0207680_10502348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum864Open in IMG/M
3300025972|Ga0207668_10765293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum853Open in IMG/M
3300026088|Ga0207641_12184736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300028049|Ga0268322_1037952All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300028053|Ga0268346_1009752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300028058|Ga0268332_1048916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300028061|Ga0268314_1010821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum870Open in IMG/M
3300028061|Ga0268314_1036426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300028062|Ga0268342_1014966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum724Open in IMG/M
3300028152|Ga0268336_1000383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1776Open in IMG/M
3300028253|Ga0268316_1001093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1228Open in IMG/M
3300028476|Ga0268329_1003212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum937Open in IMG/M
3300028477|Ga0268309_1001143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1125Open in IMG/M
3300028525|Ga0268305_103432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum744Open in IMG/M
3300028529|Ga0268311_1027625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300032466|Ga0214503_1058592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1164Open in IMG/M
3300032467|Ga0214488_1040412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1019Open in IMG/M
3300032467|Ga0214488_1085116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum694Open in IMG/M
3300032469|Ga0214491_1023192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1403Open in IMG/M
3300032490|Ga0214495_1033839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1166Open in IMG/M
3300032502|Ga0214490_1142013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300032551|Ga0321339_1016801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1477Open in IMG/M
3300032589|Ga0214500_1224957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300032591|Ga0214484_1091108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300032697|Ga0214499_1114997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum829Open in IMG/M
3300032697|Ga0214499_1280030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300032698|Ga0214485_1012893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1425Open in IMG/M
3300032761|Ga0314733_1103993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300032789|Ga0314725_1030062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300032791|Ga0314748_1125015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300032889|Ga0314751_1074572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300032966|Ga0314722_1075762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300033534|Ga0314757_1073025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum824Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere71.77%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere9.68%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated7.26%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.61%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028476Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032889Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032966Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070685_1036864623300005466Switchgrass RhizosphereVAKLPLATDIPWAGKLMLAANSYLTTIVDESSAVATEPLTMVADRPSAVEPMHNIDNHLSEPMSDDELLAVVDVELLTMVADKSSAAEPMHNIDNRLPEPMSDADKPSAVRCDNQTDEQIYQHPHV*
Ga0070707_10132387813300005468Corn, Switchgrass And Miscanthus RhizosphereMVEELMLAVNSYLTTVVDESLAVAAGPLTMVADRPSAVEPMHNIDSCLLDTAEPVFDAEFLVVVDVELLTMVADRPSATKPMNNIDNHQSEPMFDADKPSAVRCDNQTDEQFYQHPHVSLYYSPCSPGC*
Ga0070702_10142150113300005615Corn, Switchgrass And Miscanthus RhizosphereMLAANSYLTTVVDESSAIAAGPLIMVADKLSTVEPMHNIDGCLPDTAEPVFDAELLAVVDVELLTMVANRPSAAEPMYNIDNRLSEPMFDADKPSAVRCDNQTDEQFYQHPHV*
Ga0068863_10100081213300005841Switchgrass RhizosphereLMAEELMLAANSYLTAVVDESSAIAAGPLTIVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0068860_10242374623300005843Switchgrass RhizosphereANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0105135_10462513300009980Switchgrass AssociatedMVADKLSAVEPMHNNDSCLPDTAEPVFDAELLAVVDVELLTMVADRPSATKPMHNIDNRQSESMFDADKPSAMRCDNQTDEQFYQYPHV*
Ga0105135_12524523300009980Switchgrass AssociatedMLAANSYLTTVVDESSAVAAGPLTMVVDKLSAVEPMHNINCCLSEPMFDAELLAVVDVELLTMVADKPSAAKPMHNIDNRQSKPMFDADK
Ga0105133_10370723300009981Switchgrass AssociatedMAEELMLAANSYLTVVVDESSAVAARPLTMVADRPSAVEPMHNIDSHLSEPMFDAKLLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSVVMHDD*
Ga0105133_12252913300009981Switchgrass AssociatedMAEELMLAANNYLTVVVDESSAVAAGLLTMVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVANRPSAAEPMYNIDNRLSEPMFDADKPSAVRCDNQTDE*
Ga0105132_10435823300009990Switchgrass AssociatedLTAKELMLAANSYLTTIVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDADLLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHND*
Ga0105139_101710313300009995Switchgrass AssociatedMAKELMLAANNYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSATEPMHNIDNRLSEPMFDAEKP
Ga0105139_103739113300009995Switchgrass AssociatedMLAANSYLTTVDESSAVAAGPLTMVADKLSAVEPMHNKDSRLSDIAEPVFDAELLAVVDVELLTMVADRPSAAESMHNIDNRLSELMFDADKPSAVRCDNQTNEQFYQYPHI*
Ga0105139_104560123300009995Switchgrass AssociatedMAEELMVVANSYLTAVVDESSAIAAGPLTMVADRPSALEPMHNIDNHLSEPMSDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0105139_106053613300009995Switchgrass AssociatedAGPLTMVVDKLSAVELMHNIDSCLPDTAEPVFDAELLAVVDVELLTMVADKPSAAEPMHNIDNCLSEPILDAEKSSAVRCDNQTDEQFYQHPHA*
Ga0134126_1205869513300010396Terrestrial SoilMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSAVEPMHNIDNHLSEPMFDDELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAVRCDNQTDEQFCQHPHV*
Ga0134122_1229235213300010400Terrestrial SoilMLAANSYLTTVVDELSAVAAGPLTMVVDKLSAVELMHNIDSCLPDTAEPVFDAELLAVVDVELLTMVADRSSAADLMHNIDNCQSEPMFDADKPSAVRCDNQTDEQFYQHSHL*
Ga0134121_1191411313300010401Terrestrial SoilMAEELMFAANSYLTTVVDESSAVAAGPLTMVADRPSAVEPMHNIDKNLSEPMFDTELLAVVDVELLTMVADKPSAPEPMHNIDNRLSESMFDADKPSAVRCDNQTDEQFYEHPHD*
Ga0134121_1217845213300010401Terrestrial SoilMAERLSASSWVAKLPRATDIPWAKELMLATNSYLTTVVDESSAVAAGPLTMVADRLPAVEPMHNIDSRLSEPMFDADKPSAMVTDKSSAAEPMHNIDNRMSEPMFDADKPSA
Ga0157379_1035327133300014968Switchgrass RhizosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTMVADKPLAAEPMHNIDNRLSELMFDAEKPSAVMHDD*
Ga0157379_1200884413300014968Switchgrass RhizosphereMVEELMLEANSYLTTAVDESSAVAAGPLTMVADRPSVVEPMHNIDYRLSEPMFDAKLLVVVDVELLTMVADKPSAAEPTHNIDNRLSEAMFDADKPPAVRCDNQIDEQFYEHPHV*
Ga0182100_100258323300015280Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVAAGPLTMVADRPSAVESMHNIDNHLLEPMFDTELLAIVDVELLTMVADKQSAAEPMHNIDTCLSEPMFDADKPSAVRCDNQTDEQFYEHPHA*
Ga0182100_108131113300015280Switchgrass PhyllospherePDDGLMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSAVEPMHNTDNHLSEPMFDDELLAVVDVELLTMVADKPSAAEPMHNIDNRLSELVFDAEKPSAVMHDD*
Ga0182105_103355513300015290Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVAAGPLTMVADRPSAVETMHNVDNHLSEPMLDTELLAIVDVKLLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSVVMHDD*
Ga0182103_102311213300015293Switchgrass PhyllosphereAANSCLTTVVDESSALAARPLTMVADRPSAVEPMYNIDNHLSEPMFDAELLVVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182103_108013123300015293Switchgrass PhyllosphereMAEELMLAANSYLTTVVDESSTIAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLLS*
Ga0182104_105632923300015297Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTAVVDESSAAAAGPSTMVADKLSAMEPMYNIDSRLSEPMFDADKPSAMVADKSSAVQPMHNIDNRLSEPMFDADKPSAVRCDNQTDEQFYEHPHV*
Ga0182104_106347323300015297Switchgrass PhyllosphereNLAANSYLTAIVDESSAIAAGPLTKVADRPSALEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHGD*
Ga0182184_106532313300015301Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTIVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAMMHDD*
Ga0182184_107292813300015301Switchgrass PhyllosphereMLAANSYLTTVVDESSVVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDAELLTVVDVDLLTMIADRPSAAEPMHNIDNRLSEPMFDTD
Ga0182180_104790023300015306Switchgrass PhyllosphereMAEELMLAANSYLTTVVDESSAVAAGPLTIVADRPSAVEPMHNIDNHLSELIFDVELLAVVDVELLTMVADKPSTAEPMHNIVNRLS
Ga0182098_110365613300015309Switchgrass PhyllosphereVPDDKLLAEQLFARSWMAKQLMLAANSYLTTIVDESSAIAAGPLTMVADRPSAVEPIHNIDNHLSEPMFDTELLVVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182162_101076913300015310Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSVVAAGPLTMVADRPSAVEPMHNIDSHLSEPMFDAKLLVVVDVELLTMVADRPSAAEPMHNIDNRLSESMFDADKPSAVRCDNQTDEQIYQHPHV*
Ga0182182_101075133300015311Switchgrass PhyllosphereMAELLHASDIPWAEELMLAANSYLTTVVDESSAIATGPLTMVADKLSAVEPMHNVDSCLPDTAEPAFDAELLAVVDVELLTMVADRSSAAEPMHNIDNHLSEPMFDAEKSSALRYDNQTDEQF*
Ga0182168_106772123300015312Switchgrass PhyllosphereEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHMSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSTVMHDD*
Ga0182164_101638713300015313Switchgrass PhyllosphereLTDKLMLVANSHLTAVVDESPAVAVEPLTRVADKLSAVEPMHNIDNHMFDTAESVSDAELLAVVDVELLTMVADRSSAAEPMHNIDNRQSEPMFDADRPSAVRCDNQTNEQFYQYPHI*
Ga0182164_110294013300015313Switchgrass PhyllosphereMLAANSYLTTVVDESSAVAAGPLTMVADRPSAVEPMYNIDNHLSEPMFDTELLPVVDVDLLTMVADKPSAAEPMHNIDNRLSEPMF
Ga0182164_112550113300015313Switchgrass PhyllosphereMAEELMLAANSYLTAAVDESSVVAAGPLTMVADRPSAVEPMHNIDNHLSELIFDVELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDA
Ga0182120_102517523300015315Switchgrass PhyllosphereMAEEPMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAVEPMHNIDNRLSEPMFDAEKP
Ga0182120_108578223300015315Switchgrass PhyllosphereMLAANSYLTTVVDESSAVAAGLLTTVADKLSAVEPMHNKDSHLSDIAELVFDAELLAVVDVELLTMVADRPSAAEPMHNIDNRLSEPMFDADKPSAVRCDNQTNEQFYQYPHI*
Ga0182121_108313723300015316Switchgrass PhyllosphereMAEELMLAANIYLTTVVDESSALAARPLTMVADRPSAVEPMYNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD*
Ga0182121_111349313300015316Switchgrass PhyllosphereLMLAANSYLTAVVDKSSVVAAGLLTIVADRPSAVEPMHNIDNHLSEPMVDTELLVVVDVELLTMVADKPSAAEPMHNIDNSLSEPMFDTEKPSAVRYDNQTDERFYQHPHH*
Ga0182130_102771213300015319Switchgrass PhyllospherePIGPDDELLAGQLSARSWMAEQLLLAANSYLTAVVDESTAVATGPLTMAADRPSAVEPMYNIDNHLSEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSDPMFDAEKPSAVMHDD*
Ga0182130_104533323300015319Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLFEPIFDTELLAVVDVELLTMVADKPSAAEPMHNIDNCLSEPMFDVEKPSAVMHDD*
Ga0182165_102374813300015320Switchgrass PhyllosphereMAEELMLAANSYLTTVVDESSALAARPLTMVADRPSAVEPMYNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182134_103301223300015324Switchgrass PhyllosphereVAELPLATDIPWTEELMLAANSYLTVVVDESLAVAAGPLTMVADKLSAVEPMHNIDSCLSDTAEPVFDAELLVVVDVELLTMVADRPSATEPMHNIDNRLSEPMFDADKPSAVRCDNQIDEQFY*
Ga0182134_105028813300015324Switchgrass PhyllosphereMVEELMLAVNSYLTTVVDESSAVATGPLTMVADKLSAVEPMHNVDSCLPDTAEPVFDAELLAVVDVELLTMVADRSSAAEPMHNIDNRQSEPMFDADRPSAVRCDNQTDEQ
Ga0182166_108243623300015326Switchgrass PhyllosphereLLAERLFTKSWVAELPHATDITWAEKLMLAANSYLTTVVDESSAVAAGPLTMVADKLSAVEPMHNIDSCLSEPMFDAELLAVVDVELLTMVADRSSAANLMHNIDNCQSEPMFDADKPSAVRCDNQIDEQFYEHPHV*
Ga0182166_110104713300015326Switchgrass PhyllosphereGPDDGLMAEELMLAANSYLTAVVDKSSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDAKLLAVVDVELLTMVGDKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182166_112657813300015326Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVAAGPLTMVADRPSAVETMHNIDNHLSEPMLDTELLAIVDVERLTMVADKPSAAEPMHNIDNRLSEPMFDAEKP
Ga0182153_109523423300015328Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVATGPLTMVADRPSAVEPMHNIDSRLSDTAELVFDVELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSLLEHLHWK
Ga0182153_111594623300015328Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTAVVDESSAVAAGPSTMVADKLSAVEPMHNIDSRLSEPMFDVDKPTPMVADKSLAVEPMHNIDNHLSEPMFDADKPSAVRCENQTDEQFYQ
Ga0182135_112993713300015329Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVAAGPLTMVADMPSAVEPMHNIDNHMSEPMYDAELLAVVDVELLTMVADRSSAAEPMYNIDNR*
Ga0182152_104153723300015330Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182131_102518223300015331Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTIVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDSRLSEPMFDAEKPSAMMHDD*
Ga0182117_102064223300015332Switchgrass PhyllosphereMLAANSYLTTVNESSAVAAGPLTMVADKLSAVEPMHNIDSCLPDTAEPVFDAELLAVVDVELLTMVADRPSATKPMHNIDNRQSESMFDADKTSAVRCDNQTDEQFYQHPHVSLYYLPCSLGC*
Ga0182147_112800023300015333Switchgrass PhyllosphereMLAANSYLTTVVDESSAVAAGLLTTVADKLSAVEPMHNVDSCLPDTAEPAFDAELLAVVDVELLTMVADRSSAAEPMHNIDNRQSEPMFDADKPSAVRCDNQTDEQFYQHPHI*
Ga0182147_113755523300015333Switchgrass PhyllosphereVAELPLATDIPWTEELMLAANSYLTVVVDESLAVAAGPLTMVADKLSAVEPMHNIDSCLSDTAEPVFDAELLVVVDVELLTMVADRSSAADLMHNIDNCQSEPMFDADKPSAVRCD
Ga0182116_104494313300015335Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTAVVDESSAVAAGPMTMVADKLSAVEPMHNIDNRLSDTAEPVFDAERLAIVDVELLTMVADRPPAAEPMHNIDNRQSELMFDADKPSAVRCDNQTHEQFYQHPHV*
Ga0182116_114095913300015335Switchgrass PhyllosphereMAELLHASDIPWAEELMLAANSYLTTVVDESSAIATGPLTMVADKLSAVEPMHNVDSCLPDTAEPTFDAKLLAVVDVELLTMIADKPSAVEPMHNIDNRLSEPMFHTRI*
Ga0182150_101841913300015336Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAARPLTMVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVM
Ga0182150_107422913300015336Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDARKPSAVMHDD*
Ga0182151_104312113300015337Switchgrass PhyllosphereGPLTMVADRPSAVEPMHNIDNHLFEPMFDTELLAVVDVELLTMVANRPSAAEPTHNIDNRLSEPMFDADKPPAVRCDNQIDEQFYEHPHV*
Ga0182151_115103613300015337Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTVVVDESSAVAAGPSTMVADKLSAVEPMHNIDNHLSEPMFDTELLVVVDVELLTMVADKPSAPEPMHNIDNRQSEP
Ga0182133_112004913300015340Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSAVEPMHNIDNPLSELIFDAELLAVVDVELLAMVADEPSATEPMHNIDNHLSEPMFDAEKPSAVMHDD*
Ga0182133_113215713300015340Switchgrass PhyllosphereMLAANSYLTTVVDESSAVVAGPLTMVADKLLAVEPMHNIDSRLSDTAEPVFDVELLAVVDVELLIMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD*
Ga0182115_118149013300015348Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAEPLTMVADRPSAVEPMHNIDNHMSEPMFDTELLAVVDVELLTMIADKPSAVEPMHNIDNRLSEPMFHTRI*
Ga0182115_126064113300015348Switchgrass PhyllosphereSYLTVVVDELLAVAAGPSTMVADKLSAVEPMHNIDSHLSEPMFDANKPSAMVVDKSSAAEPMHNIDNRLSKPMFDADKPSAVRCDDQTDEQFYQHSHL*
Ga0182185_105637923300015349Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADK
Ga0182185_126985123300015349Switchgrass PhyllosphereMLAANSYLTTVVDESSAIATGPLTMVADKLSAVEPMHNVDSCLLDTAEPAFDAKLLAVVDVELLTMVADKSSAAEPMHNIDNRQSEPMFDADKPSAVRCDNQTDEQFYQHPHI*
Ga0182163_125244623300015350Switchgrass PhyllosphereMLAANSYLTTIVDELSAVAAGPLTMVADKLLAVEPMHNIDGCLPDTAEPVFDAELLAVVDVELLTMVADRPSAAEPMHNIDNRLSEPMFDADKPSAVRCDNQTNE*
Ga0182169_125108913300015352Switchgrass PhyllosphereMLAANSYLTTVDESLAVAAGPLTMIAYKLSAVEPMHNIDRRLSDTAHPVFDAELLVVVDVELLTMVADKPSAAELMHIIDNCLSEPMFDADKPSAVRCDNQTDEQFYQHPHV*
Ga0182179_107751213300015353Switchgrass PhyllosphereMAEELMLAANSYLTTVVDESSAVATGPLTMAADRPSAVEPMYNIDNHLSEPMFDAELLAVVDVELSAMIADRPSAAEPMHNIDNRLSEPMFDADKVSAVRCDNQTDEQFCQHPHV*
Ga0182179_128758613300015353Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSAVEPMHNIDSHLSEPMFDADKPSAMVVDKSSAAEPMHNIDNRLSKLMFDADKPSAVRCDDQTDEQFYQHSHL*
Ga0182167_114092723300015354Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSSVEPMHNIDSHLSEPMFDAKLLVVVDVELLTMVADRPSAAEPTHNIDNRLSEAMFDADKPPAVRCDNQTDEQFYEHPHD*
Ga0182167_116492523300015354Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESLAVAAGPLTMVADRPSAVETMHNIDNHLSEPMLDTELLAIVDVERLTMVADKPSAAEPMHNIDNRLSEPTFDAEKPSAVMHGD*
Ga0182167_121662123300015354Switchgrass PhyllosphereMLAANSYLTTVDESSAVAAGPLTMVADKLSAVELMHNIDSCQSEPMFDANKPSAMVANKSSAMEPMHNIDNRLSEPMFDADKPSAVRCDNQTDEQFYQHPHI*
Ga0182195_104689613300017414Switchgrass PhyllosphereLMAEELMLAANSYLTTVVDESSALAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0182195_107734623300017414Switchgrass PhyllosphereMLAANSYLTTVVDESSAVAAGLLTTVADKLSAVEPMHNVDSCLPDTAEPAFDAELLAVVDVELLTMVADRSSAAEPMHNIDNRQSEPMFDADRPSAVRCDNQTDEQFY
Ga0182201_108243413300017422Switchgrass PhyllosphereLTMVADKLSAVEPMHNKDSLMSDIAEPVFDAELLAVVDVELLTMVADRPSATKPMHNIDNRQSESMFDADKPSAVRCDNQTDEQFYQHPHV
Ga0182200_100794823300017439Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGLLTTVADKLSAVEPMHNVDSCLPDTAEPAFDAELLAVVDVELLTMVADRSSAAEPMHNIDNRQSEPMFDADKPSAVRCDNQTDEQFYQHSHL
Ga0182200_106048913300017439Switchgrass PhyllosphereLMAEELMLAANSYLTTVVDESSAVAAGPLTIVADRPSAVEPMHNIDNHLSDPMFDAELLAVVDVELLTMVADRPSAAEPMHNIDNRLSEPMFDANKPSAVRCDNQTDEQFYQHSHL
Ga0182214_103659923300017440Switchgrass PhyllosphereLLAEQLSARSWMAEQLMLAANSYLTTIVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTIVADKPSAAEPMHNIDNRLSEPMFDAEKSSAVMHDDYTDGINCLQLYF
Ga0182214_108037523300017440Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTTVVDESSAVAAGPMTMVADKLSAVEPMHNIDNRLSDTAEPVFDAERLAIVDVELLTMVADRPPAAEPMHNIDNRQSELMFDADKPSAVRCDNQTDEQFYQHSHL
Ga0182217_114246113300017446Switchgrass PhyllosphereMAEQLLLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPIHNIDNRLSETMFDAEKPLAVMHDD
Ga0182212_115391413300017691Switchgrass PhyllosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVADRPSATKPMHNIDNRQSESMFDADKPS
Ga0182210_107507123300017692Switchgrass PhyllosphereMLAANSYLTAVVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVKLLTMVANKPSAAEPMHNIDNRLSEPMFDAEKPSALRYDN
Ga0182216_107330013300017693Switchgrass PhyllosphereWMAELLRAADIPWAEELMLAGSSYLTTVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLSEPMFDAEKPSAVMHDD
Ga0182211_108097323300017694Switchgrass PhyllosphereLMAEELMLAANSYLTAVVDESSTVAAGPLTMVADRPSAVEPMHNIDNHLSELMFDAELLAVVDVELLTMVADRPSAVEPMHNIDNRLSEPMFDDEKPSAVMHDD
Ga0182211_115883223300017694Switchgrass PhyllosphereAANSYLTAVVDESSAAAAGPSTMVADKLSAVEPMYNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAPEPMHNIDNRQSEPMFDADRPSAVRCDNQTDEQFYQHPHI
Ga0182178_101073013300020023Switchgrass PhyllosphereVAELPRATDIPWAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVADKPSAAEQMHNIDNRQSEPMFDADKPSAVRCDNQTDEQFYQHPHV
Ga0182119_10037233300020031Switchgrass PhyllosphereMVEELMLAANSYLTAVVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVM
Ga0207680_1050234813300025903Switchgrass RhizosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSVVEPMHNIENHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSALRCDNQTDEQFYRHPHV
Ga0207668_1076529323300025972Switchgrass RhizosphereLMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDSHLSEPMFDAKLLVVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAVRCDNQIDEQFYEHPHV
Ga0207641_1218473613300026088Switchgrass RhizosphereMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAIVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0268322_103795213300028049PhyllosphereMAEELMLAANSYLTAVVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVAEKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0268346_100975213300028053PhyllosphereLMAEELMLAANSYLTAVVDESSAVAAGQLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0268332_104891613300028058PhyllosphereVAELPLATDISWTEELMLAANSYLTVGVDESLAVAAGPLTMIAYKLSAVEPMHNMDSRLSDTAHPVFDAELLVVVDVELLTMVADRPSAAEPMHIIDNCLSEPMFDADKPSAMRCDNQTD
Ga0268314_101082123300028061PhyllosphereLMAEELMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHMSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAMMHDD
Ga0268314_103642613300028061PhyllosphereMLAANSYLTTIVDESSAVAAGPLTMVADKLSAVEPMHNIDSRLSEPMFDVDKPSAMVADKSSAVEPMHNIDNRLSEPMFDADKPSAVRCDNQTDEQFYQHPHVSLYY
Ga0268342_101496613300028062PhyllosphereLMAEELMLAANSYLTAVVDESSAVAAGPLIMVADRPSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSS
Ga0268336_100038333300028152PhyllosphereLMAEELMVVANSYLTAVVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLSEPMSDAELLAVVDVELLTMVADKPSAAEPMHNIDNCLSEPMFDAEKPSLVMHDD
Ga0268316_100109333300028253PhyllosphereLMAEELMLAANSYLTAVVDESSALAARPLTMVADRPSAVEPMHNIDSHLSEPMFDAKLLVVVDVELLTMVADKPSAPEPMHNIDNRQSEPMFDADKPSAVRCENQTDEQFYQHPHVSLYYSPCSPGS
Ga0268329_100321223300028476PhyllosphereLMAEEPMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD
Ga0268309_100114313300028477PhyllosphereLMAEELMLAANSYLTTVVDESSALAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDAELLVVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0268305_10343223300028525PhyllosphereLMAEELMLAANSYLTTVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLFEPMFDAELLAVVDVELLTMVADRPSAAEPMHNIDNRLSEPMFDANKPSAVRCDNQTDEQFYEHPHV
Ga0268311_102762513300028529PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKSSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0214503_105859223300032466Switchgrass PhyllosphereLMAEELMLAANSYLTAVVDKSSAVAAGLLTMVADRPSAVKTMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD
Ga0214488_104041213300032467Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRC
Ga0214488_108511613300032467Switchgrass PhyllosphereMAEELMLAANSYLTTVGDESSAVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDE
Ga0214491_102319223300032469Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIGNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSLLEHLHWKIHDDIVVSHWACQKMC
Ga0214495_103383913300032490Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLIMVADRPSAVEPMHNIDNHLSEPMFDTELLIVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSLLEHLR
Ga0214490_114201313300032502Switchgrass PhyllosphereMAEELMLAANSYLTSIVDESSAVAAGPLTMVADSPSAVEPMHNIDNHLSEPMSDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSLLEHLHWKIHDDIVVSHWAC
Ga0321339_101680123300032551Switchgrass PhyllosphereMAEELMLAANSYLTAVVDKSSAVAAGLLTMVADRPSAVKTMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD
Ga0214500_122495713300032589Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRRSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDAEKPSAVMHDD
Ga0214484_109110813300032591Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDE
Ga0214499_111499713300032697Switchgrass PhyllosphereTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELSAMIADRPSAAEPIHNIDNRLSEPMFDAEKSSAVRYDNQTNEQFYKRPHF
Ga0214499_128003013300032697Switchgrass PhyllosphereMAEELMLAANNYLTAVVDESSVVVAGPLTMVADRPSAVEPMHNIDSHLSEPMFDAKLLVVVDVELLTMVADKPSAAEPTHNIDNRLSEAMFDADKPPAVRC
Ga0214485_101289323300032698Switchgrass PhyllosphereMAEELMLAANSYLTTIVDESSAIAAGPLTMVADRPSAVEPMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD
Ga0314733_110399313300032761Switchgrass PhyllosphereEELMLAANSYLTAVVDKSSAVAAGLLTMVADRPSAVKTMHNIDNHLSEPMFDTELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAAMHYDYTDGINC
Ga0314725_103006213300032789Switchgrass PhyllosphereSYLTTVVDESSAVAAGPLTMVADKLLAVEPMHNIYGCLPDTAEPVFDAELLAVVDVELLTMVADRSSAADLMHNIDNCQSEPMFDADKPSAVRCDNQTNEQFYKRPHL
Ga0314748_112501523300032791Switchgrass PhyllosphereMLAANSYLTTVVDESSAVAAGPLTMVADKLLAVEPMHNIYGCLPDTAEPVFDAELLAVVDVELLTMVADKPSAAEPMHNIDNHLFEPMFDAEKPSAVMHDD
Ga0314751_107457213300032889Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLIMVADRPSAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSLLEHLR
Ga0314722_107576223300032966Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDAELLAVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNQ
Ga0314757_107302513300033534Switchgrass PhyllosphereMLAANSYLTAVVDESSAVAAGPLTMVADRPLAVEPMHNIDNHLSEPMFDTELLTVVDVELLTMVADKPSAAEPMHNIDNRLSEPMFDADKPSAMRCDNRTDEQFHQYPHVLLYYSSCSIGCYSPVAHCLFHSL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.