NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068334

Metagenome Family F068334

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068334
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence MRVLGWVLAGALALTASIGVQAGSLGPGWYPMPNGWDGDWRRAP
Number of Associated Samples 79
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.77 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 91.94 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.613 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(63.710 % of family members)
Environment Ontology (ENVO) Unclassified
(92.742 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(62.903 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.50%    β-sheet: 0.00%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF04392ABC_sub_bind 3.23
PF07690MFS_1 2.42
PF01914MarC 2.42
PF02586SRAP 1.61
PF04828GFA 1.61
PF08450SGL 1.61
PF00561Abhydrolase_1 1.61
PF00467KOW 0.81
PF11026DUF2721 0.81
PF00027cNMP_binding 0.81
PF01381HTH_3 0.81
PF13767DUF4168 0.81
PF00296Bac_luciferase 0.81
PF02796HTH_7 0.81
PF03070TENA_THI-4 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 3.23
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 2.42
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 1.61
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.61
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.61
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.61
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.61 %
UnclassifiedrootN/A23.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005764|Ga0066903_105241235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300010046|Ga0126384_11089186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium732Open in IMG/M
3300010358|Ga0126370_11689010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300010376|Ga0126381_102953342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300010376|Ga0126381_103075388Not Available661Open in IMG/M
3300012971|Ga0126369_10069484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3082Open in IMG/M
3300012971|Ga0126369_12895138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300016270|Ga0182036_10851818Not Available745Open in IMG/M
3300016294|Ga0182041_10065710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2527Open in IMG/M
3300016294|Ga0182041_10276403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1380Open in IMG/M
3300016294|Ga0182041_10875726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium806Open in IMG/M
3300016319|Ga0182033_10168141All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1712Open in IMG/M
3300016319|Ga0182033_10456057Not Available1091Open in IMG/M
3300016319|Ga0182033_11287280Not Available656Open in IMG/M
3300016319|Ga0182033_11354186Not Available640Open in IMG/M
3300016341|Ga0182035_10656790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium910Open in IMG/M
3300016357|Ga0182032_10437802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1065Open in IMG/M
3300016357|Ga0182032_10780306All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300016357|Ga0182032_11105088Not Available680Open in IMG/M
3300016371|Ga0182034_11367249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300016387|Ga0182040_10128899All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans1769Open in IMG/M
3300016387|Ga0182040_10252714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1325Open in IMG/M
3300016387|Ga0182040_11243852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300016404|Ga0182037_10178973All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300016404|Ga0182037_10721935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium854Open in IMG/M
3300016422|Ga0182039_11195719Not Available687Open in IMG/M
3300016422|Ga0182039_11658391Not Available584Open in IMG/M
3300016445|Ga0182038_10946514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300016445|Ga0182038_12120726Not Available510Open in IMG/M
3300021168|Ga0210406_10698722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300021560|Ga0126371_11609950Not Available775Open in IMG/M
3300031543|Ga0318516_10227800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1078Open in IMG/M
3300031545|Ga0318541_10145018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1300Open in IMG/M
3300031545|Ga0318541_10258273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium968Open in IMG/M
3300031546|Ga0318538_10626698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300031546|Ga0318538_10769415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031561|Ga0318528_10105223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1483Open in IMG/M
3300031564|Ga0318573_10180461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1115Open in IMG/M
3300031564|Ga0318573_10545568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300031564|Ga0318573_10615543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300031572|Ga0318515_10055813All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans1998Open in IMG/M
3300031572|Ga0318515_10118209Not Available1400Open in IMG/M
3300031572|Ga0318515_10149194Not Available1246Open in IMG/M
3300031573|Ga0310915_10732630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300031640|Ga0318555_10444867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium702Open in IMG/M
3300031640|Ga0318555_10790542Not Available512Open in IMG/M
3300031668|Ga0318542_10044824All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300031681|Ga0318572_10224445All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300031681|Ga0318572_10233235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1080Open in IMG/M
3300031681|Ga0318572_10254155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1034Open in IMG/M
3300031682|Ga0318560_10798743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300031719|Ga0306917_10056168All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans2670Open in IMG/M
3300031719|Ga0306917_10149522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1731Open in IMG/M
3300031723|Ga0318493_10522108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300031724|Ga0318500_10283184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300031724|Ga0318500_10657043Not Available533Open in IMG/M
3300031736|Ga0318501_10609680Not Available599Open in IMG/M
3300031736|Ga0318501_10718040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300031744|Ga0306918_10664826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300031747|Ga0318502_10363075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium858Open in IMG/M
3300031747|Ga0318502_10599139Not Available663Open in IMG/M
3300031748|Ga0318492_10376016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300031751|Ga0318494_10096278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1627Open in IMG/M
3300031763|Ga0318537_10270951Not Available629Open in IMG/M
3300031764|Ga0318535_10421306Not Available595Open in IMG/M
3300031768|Ga0318509_10746809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031770|Ga0318521_10391439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium827Open in IMG/M
3300031771|Ga0318546_10079130All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans2117Open in IMG/M
3300031777|Ga0318543_10247775Not Available794Open in IMG/M
3300031778|Ga0318498_10370439Not Available638Open in IMG/M
3300031780|Ga0318508_1064686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium984Open in IMG/M
3300031781|Ga0318547_10155804All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300031781|Ga0318547_10244659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1081Open in IMG/M
3300031793|Ga0318548_10151602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1130Open in IMG/M
3300031793|Ga0318548_10445546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300031795|Ga0318557_10447763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300031819|Ga0318568_10244490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1111Open in IMG/M
3300031831|Ga0318564_10267513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300031845|Ga0318511_10261208Not Available778Open in IMG/M
3300031846|Ga0318512_10432412Not Available663Open in IMG/M
3300031859|Ga0318527_10451494Not Available548Open in IMG/M
3300031860|Ga0318495_10443400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300031879|Ga0306919_10011411All Organisms → cellular organisms → Bacteria5040Open in IMG/M
3300031879|Ga0306919_10432628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1011Open in IMG/M
3300031890|Ga0306925_10404210All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300031890|Ga0306925_10943002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria884Open in IMG/M
3300031893|Ga0318536_10020684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2981Open in IMG/M
3300031893|Ga0318536_10589144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031897|Ga0318520_10634119Not Available666Open in IMG/M
3300031910|Ga0306923_10143664Not Available2720Open in IMG/M
3300031912|Ga0306921_11106919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium887Open in IMG/M
3300031945|Ga0310913_10046082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2832Open in IMG/M
3300031946|Ga0310910_10203076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1538Open in IMG/M
3300031946|Ga0310910_10300700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas → unclassified Methylomonas → Methylomonas sp. WSC-61262Open in IMG/M
3300031946|Ga0310910_11009075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300031954|Ga0306926_10096489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin13620Open in IMG/M
3300031959|Ga0318530_10216564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300031981|Ga0318531_10135163All Organisms → cellular organisms → Bacteria → Proteobacteria1100Open in IMG/M
3300032035|Ga0310911_10062039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1976Open in IMG/M
3300032035|Ga0310911_10168966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1236Open in IMG/M
3300032035|Ga0310911_10200746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1134Open in IMG/M
3300032039|Ga0318559_10260384Not Available803Open in IMG/M
3300032039|Ga0318559_10526004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300032041|Ga0318549_10332480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300032042|Ga0318545_10073075All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300032043|Ga0318556_10242131Not Available941Open in IMG/M
3300032044|Ga0318558_10189748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1000Open in IMG/M
3300032052|Ga0318506_10238216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium805Open in IMG/M
3300032052|Ga0318506_10350445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300032055|Ga0318575_10438721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300032059|Ga0318533_10884286Not Available655Open in IMG/M
3300032063|Ga0318504_10053533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1704Open in IMG/M
3300032063|Ga0318504_10055049All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300032063|Ga0318504_10506660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300032063|Ga0318504_10619789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300032076|Ga0306924_10157536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2601Open in IMG/M
3300032076|Ga0306924_11124207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300032076|Ga0306924_11240443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300032076|Ga0306924_12640190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300032090|Ga0318518_10518810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300032091|Ga0318577_10202965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria948Open in IMG/M
3300032261|Ga0306920_102036461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium803Open in IMG/M
3300033290|Ga0318519_10527032Not Available713Open in IMG/M
3300033290|Ga0318519_11048331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil63.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066903_10524123513300005764Tropical Forest SoilMEAPQETSMRVLGWVLAGALALTAPIGVQAGSLGPGWYPMPN
Ga0126384_1108918613300010046Tropical Forest SoilMRVLGWVLAGALALITSIGVQAGSLGPGYHPMPNGWNGDWRRAPS
Ga0126370_1168901023300010358Tropical Forest SoilMRVLGLVLAGALALTTPIAVQAGSLGPSWHPMPNGWNGDWRRAPGLSR
Ga0126381_10295334213300010376Tropical Forest SoilMRVLGWVLAGVLALTASIGVQAGSLGPGYYPMPNGWNGYWRRAPGPSRQ
Ga0126381_10307538813300010376Tropical Forest SoilMRVLGLVLAGALALTAPTAVQAASLGPSWYPMPNGWDGDWRRAPHPSHQWNG
Ga0126369_1006948443300012971Tropical Forest SoilMRVLGWVLAGALALITSIGVQAGSLGPGYHPMPNGWN
Ga0126369_1289513823300012971Tropical Forest SoilMRVLGLVLAGALALTAPTAVQAGSLGPGWYPMPNGWNGDWRR
Ga0182036_1085181813300016270SoilMARKPAETYMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNRDWRRAPGPSR
Ga0182041_1006571013300016294SoilMRVLGWVLAGALALTVSIGAQAGSLGPSYYPMPNGWNG
Ga0182041_1027640343300016294SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDW
Ga0182041_1087572623300016294SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASR
Ga0182033_1016814123300016319SoilMRVLGWVLAGALAVTASIGVQAGSLGPGWYPMPNGWDG
Ga0182033_1045605723300016319SoilMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNRDWRRAPGPSRQW
Ga0182033_1128728023300016319SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQ
Ga0182033_1135418613300016319SoilMRVRGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAP
Ga0182035_1065679033300016341SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVP
Ga0182032_1043780223300016357SoilMRVLGWVLAGALALPASIGVQAGSLVPGWYPMPNGWDGDWRR
Ga0182032_1078030613300016357SoilMRILGLVLSGVLALNATIGVQAGSLGPGWYPMPNGWNGDWRRAPGPSRQWNGGP
Ga0182032_1110508813300016357SoilMARKPAETYMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGW
Ga0182034_1136724923300016371SoilMRVLGLVLAGALALTVPIGVQAGSLGPGSYSMPNGWDGDWRRA
Ga0182040_1012889943300016387SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWN
Ga0182040_1025271443300016387SoilMRVLGLVLAGALALTAPIGVHAASLGPGSYPMHNGWNGDW
Ga0182040_1124385213300016387SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAP
Ga0182037_1017897313300016404SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQW
Ga0182037_1072193513300016404SoilMRVLGLVLAGALVLTASIGVQAGSLGPGYYPMPNGWDG
Ga0182039_1119571913300016422SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQWN
Ga0182039_1165839113300016422SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDW
Ga0182038_1094651423300016445SoilMRVLGLVLAGVLALTAAVGVQAGSLGPGWYLMPNGWDGDWRRTPGPSRQW
Ga0182038_1212072613300016445SoilMRVLGLVLTGALALTAPTAVEAASLGPSWHPMPNGWDSDWRRAPHRS
Ga0210406_1069872213300021168SoilMRVLGLVLSGALALTASIGVQAGSLGPNYYPMPNGWNGD
Ga0126371_1160995013300021560Tropical Forest SoilMRVLGLALAGALALTAPTAVQAASLGPSWYRMPNGWDGQAPHPS
Ga0318516_1022780033300031543SoilMRVLGWVLAGALALTASIGVRAGSLGPGWYPMPNGWDGDWR
Ga0318541_1014501833300031545SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWR
Ga0318541_1025827333300031545SoilMRVLGLVLSGSLALTAPMAVQAGSLGPSWHPMTNGWN
Ga0318538_1062669813300031546SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAA
Ga0318538_1076941523300031546SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQW
Ga0318528_1010522333300031561SoilMRVLGWVLAGALALTASIGVQAGSLGPGWYPMPNGWDGDWRRAP
Ga0318573_1018046133300031564SoilMRVLGLVLAGALALTAPIGVQAGSLGPGSYSMPNGWDGDWRRATAPT
Ga0318573_1054556813300031564SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWD
Ga0318573_1061554313300031564SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWN
Ga0318515_1005581313300031572SoilMRVRGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVS
Ga0318515_1011820913300031572SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWRRAPGRSRQ
Ga0318515_1014919413300031572SoilMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNGDWR
Ga0310915_1073263023300031573SoilMRILGLVLSGVLALNATIGVQAGSLGPGWYPMPNGWNGDWRR
Ga0318555_1044486723300031640SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGWDG
Ga0318555_1079054213300031640SoilMARKPAETYMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNRDWRRA
Ga0318542_1004482443300031668SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRLTPGPSR
Ga0318572_1022444533300031681SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDW
Ga0318572_1023323523300031681SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGW
Ga0318572_1025415513300031681SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQRNGGPV
Ga0318560_1079874313300031682SoilMRVLGLVLSGSLALTAPMAVQAGSLGPSWHPMTNGWNSDWRRAHGPS
Ga0306917_1005616813300031719SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQW
Ga0306917_1014952233300031719SoilMRILGLVLVGGLALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPS
Ga0318493_1052210823300031723SoilMRVLGLVLAGVLALTAAVGVQAGSLGPGWYPMPNGWDGDWRRTPGP
Ga0318500_1028318413300031724SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGWDGDWRRAPA
Ga0318500_1065704313300031724SoilMRVLGWVLAGALALITSIGVQAGSLGPGYHPMPNGW
Ga0318501_1060968023300031736SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGR
Ga0318501_1071804013300031736SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWN
Ga0306918_1066482623300031744SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGW
Ga0318502_1036307533300031747SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAAGASRQWNGGPVSRHWG
Ga0318502_1059913913300031747SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWV
Ga0318492_1037601613300031748SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQR
Ga0318494_1009627833300031751SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSRTSP
Ga0318537_1027095123300031763SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGD
Ga0318535_1042130613300031764SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWDGDWR
Ga0318509_1074680923300031768SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVPSP
Ga0318521_1039143913300031770SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRAPS
Ga0318546_1007913033300031771SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRW
Ga0318543_1024777523300031777SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSGQWNGRWVS
Ga0318498_1037043913300031778SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNG
Ga0318508_106468613300031780SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWR
Ga0318547_1015580413300031781SoilMRVLGSVLAGALALITSIEVQAGSLGPSYHPMPNGWDGDWRRAPSSSRQWNRGPV
Ga0318547_1024465923300031781SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDW
Ga0318548_1015160223300031793SoilMRVLGWVLAGALALTVSIGAQAGSLGPSYYPMPNGWNGDWH
Ga0318548_1044554623300031793SoilMRVLGLVLAGALALTAPIGVQAGSLGPGSYSMPNGWDG
Ga0318557_1044776313300031795SoilMRVLGLVLAGALALTVPIGVQAGSLGPGSYSMPNGW
Ga0318568_1024449013300031819SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAPAPSHQ
Ga0318564_1026751313300031831SoilMRVLGLVLAGALALTASIGVQAGSLGPGWYPMPNGWD
Ga0318511_1026120813300031845SoilMRILGLILAGALALTASMGVQAGSLGPGWYPMPNGWD
Ga0318512_1043241223300031846SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAP
Ga0318527_1045149423300031859SoilMRILGLILAGALALTASMGVQAGSLGSGWYPMPNGWDGD
Ga0318495_1044340023300031860SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNG
Ga0306919_1001141113300031879SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWD
Ga0306919_1043262813300031879SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPS
Ga0306925_1040421013300031890SoilMRVLGLVLAGALVLTAPLGLQAGSLGPGYHPMPNGWNGDSRRVP
Ga0306925_1094300213300031890SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQWNGG
Ga0318536_1002068413300031893SoilMRVLGLILAGALALTAPIGVQAGSLGPGYHPMPNGWDGDWRRVPSPSPQWNGG
Ga0318536_1058914413300031893SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQWNGGP
Ga0318520_1063411923300031897SoilMRILGLILAGALALTASIGAQAGSLGPGWSPMPNGWDGD
Ga0306923_1014366433300031910SoilMRVLGWIFAGALALTAPTAVQAGSLGPGWYPMPNG
Ga0306921_1110691923300031912SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNGDWRRAPSP
Ga0310913_1004608213300031945SoilMRVLGLVLAGALALTAPIGVQAGSLGPGSYSMPNGWDGDWR
Ga0310910_1020307643300031946SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAPGASRQW
Ga0310910_1030070033300031946SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRA
Ga0310910_1100907513300031946SoilMRVLGLVLAGALALTAPIGVHAGSLGPGSYPMPNGWNGDWRQAPSPSRQWNG
Ga0306926_10096489103300031954SoilMRVLGLVLAGALVLTAPIVLQAGSLGPGWYPMPDGWDDDWRRAAGASR
Ga0318530_1021656413300031959SoilMRVLGWVLAGALALTAPTAVHAGSLGPGSYSMPNGWDGDWRRASA
Ga0318531_1013516313300031981SoilMRVLGLVLAGALALTVPIGVQAGSLGPGSYSMPNGWDGDWRRATAPS
Ga0310911_1006203943300032035SoilMARKPAETYMRVLGLVLAGALALTAPIGVQAGSLGPSWHPMPNGWNRDW
Ga0310911_1016896613300032035SoilMRVLGLVLAGALALTAPIGVQAGSLGPGSYSMPNGWDGDWRRATAPSHQRS
Ga0310911_1020074613300032035SoilMRVLGLVLVGALALTAPTAVHAGSLGPGSYSMPNGWDGDWHRAPGP
Ga0318559_1026038413300032039SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPSRQWNG
Ga0318559_1052600413300032039SoilMRFLGLVLAGALALTATTAVQARSLGPGSYPMPNGWDGDWRRAPA
Ga0318549_1033248013300032041SoilMRVLGLVLAGALALTAPIGVQAGSLGPVWYPMPNGWNG
Ga0318545_1007307533300032042SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGWDGDWRRAPS
Ga0318556_1024213113300032043SoilMRVLGWVLAGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPGPS
Ga0318558_1018974833300032044SoilMRVLGWVLAGALALTAPIGVQAASLGPGSYSMPNGWDGDWRRAP
Ga0318506_1023821623300032052SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWRRAPG
Ga0318506_1035044523300032052SoilMRVLGLVLAGALALTAPIGGYAGSLGPGSYSMPNGWDGDWRRAPGPSRQWNGGPV
Ga0318575_1043872113300032055SoilMRFLGLVLAGALALTATTAVQAGSLGPGYYPMPNGWNGDWRRLPGPSHQWNGGQ
Ga0318533_1088428623300032059SoilMRFLGLVLAGALALTATTAVQAGSLGPGWYPMPNGWDGDWR
Ga0318504_1005353313300032063SoilMRVLGWVLAGALALTVSIGAQAGSLGPSYYPMPNGWNGDWHRAPGPSHQWNGGPV
Ga0318504_1005504913300032063SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGWNGDWRRAPAPSRQWNGRW
Ga0318504_1050666013300032063SoilMRVLGLVLSGALALTAPIAVQAGSLGPSWHPMPNGWNGDWR
Ga0318504_1061978913300032063SoilMRFLGLVLAGALALTATTAVQAGSLGPGYYPMPNGW
Ga0306924_1015753653300032076SoilMRFLGLVLAGALALTATTAVQAGSLGPGSYPMPNGWDGDWRRAPAPTRQW
Ga0306924_1112420723300032076SoilMRVLGWVLAGALALTASIAVQAGSLGPGYYPMPNGWNG
Ga0306924_1124044333300032076SoilMRVLGLVLAGALALTAPTAVQAASLGPRWYPMPNGWNGDWRRAPHPAH
Ga0306924_1264019013300032076SoilMRVLGWVLAGALALTASIGVRAGSLGPGWYPMPNGWDGDWRRAP
Ga0318518_1051881013300032090SoilMRVLGLVLAGALALTAPIGVHAGSLGPGSYPMPNGWNGDWRQAPSPSRQWNGGP
Ga0318577_1020296533300032091SoilMRVLGLVLAGVLALTAAVGVQAGSLGPGWYLMPNGWDGDWRRTPGPSRQ
Ga0306920_10203646113300032261SoilMRVLGLVLAGALALTAPTGVHAGSLGPGSYSMPNGWNGDWRRAPGPSRQWNGGPV
Ga0318519_1052703213300033290SoilMRVLGWVLGGALALTASIGAQAGSLGPGWYPMPNGWDGDWRRTPG
Ga0318519_1104833123300033290SoilMRVLGLVLAGALALTASIGVQAGSLGPGYYPMPNGWNGDWHRTPGVSRDRVPNGCPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.