Basic Information | |
---|---|
Family ID | F068317 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 38 residues |
Representative Sequence | ICNILIYFSEWRLMERASLALAFISEALEVVNAILLSV |
Number of Associated Samples | 28 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.81 % |
% of genes near scaffold ends (potentially truncated) | 92.74 % |
% of genes from short scaffolds (< 2000 bps) | 62.10 % |
Associated GOLD sequencing projects | 28 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.484 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens (82.258 % of family members) |
Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus (82.258 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 7.26 |
PF00665 | rve | 3.23 |
PF07727 | RVT_2 | 3.23 |
PF05970 | PIF1 | 2.42 |
PF08284 | RVP_2 | 2.42 |
PF00385 | Chromo | 1.61 |
PF03732 | Retrotrans_gag | 0.81 |
PF00098 | zf-CCHC | 0.81 |
PF01761 | DHQ_synthase | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 3.23 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 3.23 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 3.23 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 3.23 |
COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 2.42 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.48 % |
All Organisms | root | All Organisms | 39.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300011394|Ga0153970_1000706 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 7600 | Open in IMG/M |
3300011394|Ga0153970_1001033 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Coprinopsis → Coprinopsis cinerea | 6580 | Open in IMG/M |
3300011394|Ga0153970_1001099 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 6383 | Open in IMG/M |
3300011394|Ga0153970_1001759 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 5114 | Open in IMG/M |
3300011394|Ga0153970_1002210 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 4455 | Open in IMG/M |
3300011394|Ga0153970_1003111 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 3679 | Open in IMG/M |
3300011394|Ga0153970_1005223 | All Organisms → Viruses → Predicted Viral | 2717 | Open in IMG/M |
3300011394|Ga0153970_1006317 | All Organisms → Viruses → Predicted Viral | 2432 | Open in IMG/M |
3300011394|Ga0153970_1009211 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
3300011394|Ga0153970_1015835 | Not Available | 1412 | Open in IMG/M |
3300011394|Ga0153970_1022076 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1147 | Open in IMG/M |
3300011394|Ga0153970_1031716 | Not Available | 889 | Open in IMG/M |
3300011394|Ga0153970_1055264 | Not Available | 579 | Open in IMG/M |
3300011394|Ga0153970_1062006 | Not Available | 527 | Open in IMG/M |
3300011394|Ga0153970_1064766 | Not Available | 509 | Open in IMG/M |
3300011394|Ga0153970_1064784 | Not Available | 509 | Open in IMG/M |
3300011396|Ga0153960_1017522 | Not Available | 1464 | Open in IMG/M |
3300011396|Ga0153960_1023488 | Not Available | 1229 | Open in IMG/M |
3300011396|Ga0153960_1024957 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Polyporaceae → Trametes → Trametes cinnabarina | 1183 | Open in IMG/M |
3300011396|Ga0153960_1050862 | Not Available | 740 | Open in IMG/M |
3300011401|Ga0153984_1004957 | Not Available | 2899 | Open in IMG/M |
3300011401|Ga0153984_1005288 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 2808 | Open in IMG/M |
3300011401|Ga0153984_1006194 | All Organisms → Viruses → Predicted Viral | 2618 | Open in IMG/M |
3300011401|Ga0153984_1046778 | Not Available | 927 | Open in IMG/M |
3300011401|Ga0153984_1059902 | Not Available | 804 | Open in IMG/M |
3300011401|Ga0153984_1079419 | Not Available | 685 | Open in IMG/M |
3300011401|Ga0153984_1131380 | Not Available | 518 | Open in IMG/M |
3300012054|Ga0154007_1000011 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 20327 | Open in IMG/M |
3300012054|Ga0154007_1004156 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 3216 | Open in IMG/M |
3300012054|Ga0154007_1004451 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 3095 | Open in IMG/M |
3300012054|Ga0154007_1008114 | Not Available | 2144 | Open in IMG/M |
3300012054|Ga0154007_1011668 | Not Available | 1639 | Open in IMG/M |
3300012054|Ga0154007_1016043 | Not Available | 1267 | Open in IMG/M |
3300012054|Ga0154007_1017025 | Not Available | 1206 | Open in IMG/M |
3300012054|Ga0154007_1017150 | Not Available | 1198 | Open in IMG/M |
3300012054|Ga0154007_1018913 | Not Available | 1102 | Open in IMG/M |
3300012054|Ga0154007_1020404 | Not Available | 1028 | Open in IMG/M |
3300012057|Ga0153995_1016996 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae | 1395 | Open in IMG/M |
3300012057|Ga0153995_1045042 | Not Available | 629 | Open in IMG/M |
3300012059|Ga0153991_1006498 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2794 | Open in IMG/M |
3300012059|Ga0153991_1007954 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2479 | Open in IMG/M |
3300012059|Ga0153991_1021349 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae | 1350 | Open in IMG/M |
3300012059|Ga0153991_1053246 | Not Available | 684 | Open in IMG/M |
3300012069|Ga0153965_1000196 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 12204 | Open in IMG/M |
3300012069|Ga0153965_1024172 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae | 1358 | Open in IMG/M |
3300012070|Ga0153963_1006749 | Not Available | 2349 | Open in IMG/M |
3300012070|Ga0153963_1008174 | Not Available | 2118 | Open in IMG/M |
3300012070|Ga0153963_1067665 | Not Available | 561 | Open in IMG/M |
3300012071|Ga0153983_1010446 | Not Available | 1930 | Open in IMG/M |
3300012071|Ga0153983_1015514 | Not Available | 1522 | Open in IMG/M |
3300012071|Ga0153983_1033394 | Not Available | 942 | Open in IMG/M |
3300012071|Ga0153983_1079249 | Not Available | 510 | Open in IMG/M |
3300012073|Ga0153979_1000441 | All Organisms → cellular organisms → Eukaryota | 8245 | Open in IMG/M |
3300012073|Ga0153979_1014487 | Not Available | 1847 | Open in IMG/M |
3300012073|Ga0153979_1027820 | Not Available | 1268 | Open in IMG/M |
3300012073|Ga0153979_1038923 | Not Available | 1013 | Open in IMG/M |
3300012073|Ga0153979_1040737 | Not Available | 981 | Open in IMG/M |
3300012073|Ga0153979_1054614 | Not Available | 790 | Open in IMG/M |
3300012073|Ga0153979_1097449 | Not Available | 506 | Open in IMG/M |
3300012076|Ga0153971_1002252 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 4483 | Open in IMG/M |
3300012076|Ga0153971_1002353 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 4385 | Open in IMG/M |
3300012076|Ga0153971_1004182 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 3282 | Open in IMG/M |
3300012076|Ga0153971_1010543 | All Organisms → Viruses → Predicted Viral | 1978 | Open in IMG/M |
3300012076|Ga0153971_1022553 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 1261 | Open in IMG/M |
3300012083|Ga0154000_1012869 | Not Available | 2350 | Open in IMG/M |
3300012083|Ga0154000_1019379 | Not Available | 1861 | Open in IMG/M |
3300012083|Ga0154000_1026893 | Not Available | 1525 | Open in IMG/M |
3300012083|Ga0154000_1046369 | Not Available | 1069 | Open in IMG/M |
3300012083|Ga0154000_1091055 | Not Available | 650 | Open in IMG/M |
3300012083|Ga0154000_1104647 | Not Available | 586 | Open in IMG/M |
3300012119|Ga0153988_1002624 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Coprinopsis → Coprinopsis cinerea | 4480 | Open in IMG/M |
3300012123|Ga0153968_1002254 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 4470 | Open in IMG/M |
3300012123|Ga0153968_1002646 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 4068 | Open in IMG/M |
3300012123|Ga0153968_1047112 | Not Available | 650 | Open in IMG/M |
3300012123|Ga0153968_1062787 | Not Available | 513 | Open in IMG/M |
3300012126|Ga0153997_1001064 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 7751 | Open in IMG/M |
3300012126|Ga0153997_1008707 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2496 | Open in IMG/M |
3300012131|Ga0153994_1002198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 4850 | Open in IMG/M |
3300012135|Ga0153982_1000656 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 9623 | Open in IMG/M |
3300012135|Ga0153982_1000839 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 8572 | Open in IMG/M |
3300012135|Ga0153982_1002775 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 4536 | Open in IMG/M |
3300012135|Ga0153982_1012175 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
3300012135|Ga0153982_1059057 | Not Available | 606 | Open in IMG/M |
3300012136|Ga0153985_1005809 | Not Available | 2850 | Open in IMG/M |
3300012136|Ga0153985_1019643 | Not Available | 1408 | Open in IMG/M |
3300012136|Ga0153985_1025184 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1202 | Open in IMG/M |
3300012136|Ga0153985_1031748 | Not Available | 1031 | Open in IMG/M |
3300012139|Ga0153961_1019318 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1363 | Open in IMG/M |
3300012139|Ga0153961_1022972 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1207 | Open in IMG/M |
3300012139|Ga0153961_1036996 | Not Available | 864 | Open in IMG/M |
3300012139|Ga0153961_1039816 | Not Available | 820 | Open in IMG/M |
3300012141|Ga0153958_1006514 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 3173 | Open in IMG/M |
3300012141|Ga0153958_1089254 | Not Available | 524 | Open in IMG/M |
3300012144|Ga0153996_1004679 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 4491 | Open in IMG/M |
3300012144|Ga0153996_1009595 | Not Available | 2778 | Open in IMG/M |
3300012144|Ga0153996_1013021 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 2281 | Open in IMG/M |
3300012144|Ga0153996_1016481 | Not Available | 1952 | Open in IMG/M |
3300012144|Ga0153996_1087123 | Not Available | 549 | Open in IMG/M |
3300012180|Ga0153974_1022343 | Not Available | 1362 | Open in IMG/M |
3300012180|Ga0153974_1078974 | Not Available | 736 | Open in IMG/M |
3300012674|Ga0153962_1010701 | Not Available | 1894 | Open in IMG/M |
3300012674|Ga0153962_1012040 | Not Available | 1760 | Open in IMG/M |
3300012995|Ga0157361_1002545 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 5692 | Open in IMG/M |
3300012995|Ga0157361_1004635 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 3893 | Open in IMG/M |
3300012995|Ga0157361_1007866 | Not Available | 2746 | Open in IMG/M |
3300012995|Ga0157361_1033308 | Not Available | 980 | Open in IMG/M |
3300012995|Ga0157361_1049983 | Not Available | 712 | Open in IMG/M |
3300012995|Ga0157361_1067369 | Not Available | 563 | Open in IMG/M |
3300012998|Ga0157362_1049920 | Not Available | 2398 | Open in IMG/M |
3300012998|Ga0157362_1061794 | Not Available | 2040 | Open in IMG/M |
3300012998|Ga0157362_1093522 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 1416 | Open in IMG/M |
3300012998|Ga0157362_1225196 | Not Available | 569 | Open in IMG/M |
3300013000|Ga0157360_1000761 | All Organisms → cellular organisms → Eukaryota | 12044 | Open in IMG/M |
3300013000|Ga0157360_1033696 | Not Available | 1600 | Open in IMG/M |
3300013000|Ga0157360_1047596 | Not Available | 1333 | Open in IMG/M |
3300013000|Ga0157360_1048734 | Not Available | 1318 | Open in IMG/M |
3300013000|Ga0157360_1058700 | Not Available | 1199 | Open in IMG/M |
3300013000|Ga0157360_1101126 | Not Available | 917 | Open in IMG/M |
3300013000|Ga0157360_1150448 | Not Available | 749 | Open in IMG/M |
3300013001|Ga0157365_10215313 | Not Available | 623 | Open in IMG/M |
3300013002|Ga0157364_1036493 | Not Available | 4093 | Open in IMG/M |
3300013002|Ga0157364_1054699 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 2805 | Open in IMG/M |
3300013002|Ga0157364_1121430 | Not Available | 1233 | Open in IMG/M |
3300013002|Ga0157364_1142887 | Not Available | 1035 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 82.26% |
Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 17.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300011394 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA054 MetaG | Host-Associated | Open in IMG/M |
3300011396 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL044 MetaG | Host-Associated | Open in IMG/M |
3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
3300012054 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC091 MetaG | Host-Associated | Open in IMG/M |
3300012057 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC079 MetaG | Host-Associated | Open in IMG/M |
3300012059 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC075 MetaG | Host-Associated | Open in IMG/M |
3300012069 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL049 MetaG | Host-Associated | Open in IMG/M |
3300012070 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG | Host-Associated | Open in IMG/M |
3300012071 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA067 MetaG | Host-Associated | Open in IMG/M |
3300012073 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA063 MetaG | Host-Associated | Open in IMG/M |
3300012076 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA055 MetaG | Host-Associated | Open in IMG/M |
3300012083 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC084 MetaG | Host-Associated | Open in IMG/M |
3300012119 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC072 MetaG | Host-Associated | Open in IMG/M |
3300012123 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA052 MetaG | Host-Associated | Open in IMG/M |
3300012126 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC081 MetaG | Host-Associated | Open in IMG/M |
3300012131 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC078 MetaG | Host-Associated | Open in IMG/M |
3300012135 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA066 MetaG | Host-Associated | Open in IMG/M |
3300012136 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA069 MetaG | Host-Associated | Open in IMG/M |
3300012139 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL045 MetaG | Host-Associated | Open in IMG/M |
3300012141 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL042 MetaG | Host-Associated | Open in IMG/M |
3300012144 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC080 MetaG | Host-Associated | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012674 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL046 MetaG | Host-Associated | Open in IMG/M |
3300012995 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM2 | Host-Associated | Open in IMG/M |
3300012998 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM3 | Host-Associated | Open in IMG/M |
3300013000 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1 | Host-Associated | Open in IMG/M |
3300013001 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM3 | Host-Associated | Open in IMG/M |
3300013002 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0153970_10007062 | 3300011394 | Attine Ant Fungus Gardens | MIYFSEWRLMERASLALAFISEALEVVNAILLSV* |
Ga0153970_10010334 | 3300011394 | Attine Ant Fungus Gardens | MLIYFSEWRFIERASMALAFISEALEVVNAILLSI* |
Ga0153970_10010991 | 3300011394 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGRAFLALAFISEALEVVNAILLSV* |
Ga0153970_10017591 | 3300011394 | Attine Ant Fungus Gardens | NICKIIIYFSEWRLIEGAFLALAFISEALEVVNAILLSV* |
Ga0153970_10022105 | 3300011394 | Attine Ant Fungus Gardens | NILIYFSEWRLIERASLALVFISEALEVVNAILLSV* |
Ga0153970_10031117 | 3300011394 | Attine Ant Fungus Gardens | CNILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0153970_10052234 | 3300011394 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0153970_10063171 | 3300011394 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0153970_10092111 | 3300011394 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMEGASLALAFISEALEVVNAILLST* |
Ga0153970_10158353 | 3300011394 | Attine Ant Fungus Gardens | ILIYFSEWRLIERASLALAFISEALEVVNVILLSM* |
Ga0153970_10220764 | 3300011394 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMKGAFLALAFISEALEIVNAILLSV* |
Ga0153970_10317161 | 3300011394 | Attine Ant Fungus Gardens | NILIYLSGWRLMERASLALAFISEALEVVNAILLSV* |
Ga0153970_10552641 | 3300011394 | Attine Ant Fungus Gardens | LIYFSEWRLMERAFLALAFISEALEVVNAILLSV* |
Ga0153970_10620061 | 3300011394 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMERAFLALAFISEALEVVNAILLSV* |
Ga0153970_10647662 | 3300011394 | Attine Ant Fungus Gardens | LIYFSEWRLIERASLALAFISEALEVVNAILLSV* |
Ga0153970_10647842 | 3300011394 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGAFLALAFISEALEVVNATLLSV* |
Ga0153960_10175222 | 3300011396 | Attine Ant Fungus Gardens | SNICNILIYFSEWRLMGRAFLALAFISEALEVVNMILLSM* |
Ga0153960_10234881 | 3300011396 | Attine Ant Fungus Gardens | ILIYFSEWRLMGRAFLALAFISEALEVVNAILLSV* |
Ga0153960_10249571 | 3300011396 | Attine Ant Fungus Gardens | VSDICNILIYFSEWRLMGRAFLALAFISEALEVVNAILLSV* |
Ga0153960_10508621 | 3300011396 | Attine Ant Fungus Gardens | ILIYFSEQRLIERASLALAFISEALEVVNAIFLSV* |
Ga0153984_10049572 | 3300011401 | Attine Ant Fungus Gardens | MLIYFSEWRFIERASMALAFISEALEVINAILLSV* |
Ga0153984_10052881 | 3300011401 | Attine Ant Fungus Gardens | ICNILIYFSEWRLIERAFLALAFISEALEVVNAILLSM* |
Ga0153984_10061944 | 3300011401 | Attine Ant Fungus Gardens | CNILIYFSEWRLMERAFLTLAFISEALEVVNVILLSV* |
Ga0153984_10467781 | 3300011401 | Attine Ant Fungus Gardens | ILIYFSEWRLMERASLALAFISEALEVVNAILLSM* |
Ga0153984_10599021 | 3300011401 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGGASLALAFISEALEVVNAILLSM* |
Ga0153984_10794191 | 3300011401 | Attine Ant Fungus Gardens | IIYFSEWRLMGRASLALAFISEALEVVNAILLSM* |
Ga0153984_11313801 | 3300011401 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLIGRASLALAFISEALEVVNATLLSV* |
Ga0154007_10000111 | 3300012054 | Attine Ant Fungus Gardens | ICNILIYFSEWRLIGRASLALAFISEALEVVNAILLSV* |
Ga0154007_10041561 | 3300012054 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0154007_10044513 | 3300012054 | Attine Ant Fungus Gardens | MLIYFLEWRFIERASMALAFISEALEVVNAILLSI* |
Ga0154007_10081141 | 3300012054 | Attine Ant Fungus Gardens | ICNILIYFSEQRLIKEVFLTLAFISEALEVVNAILLSV* |
Ga0154007_10116681 | 3300012054 | Attine Ant Fungus Gardens | FNICNILIYFSEWRLIGRASLALAFISEALEVVNAILLSM* |
Ga0154007_10160431 | 3300012054 | Attine Ant Fungus Gardens | MLIYFLEWRFIERASMALAFISEALEVVNAILLSV* |
Ga0154007_10170253 | 3300012054 | Attine Ant Fungus Gardens | NICKILIYFSEWRLMERAFLALAFISEALEVVNAILLSV* |
Ga0154007_10171501 | 3300012054 | Attine Ant Fungus Gardens | NICNILIYFSEWRLIERASLALAFISEALEIVNAILLSM* |
Ga0154007_10189132 | 3300012054 | Attine Ant Fungus Gardens | MGGASLALAFISEWRLMGGASLALAFISEALEVVNAILLSV* |
Ga0154007_10204041 | 3300012054 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMERAFLALAFISETLEVVNVILLSV* |
Ga0153995_10169961 | 3300012057 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGGAFLALAFISEALEVVNAIFLSV* |
Ga0153995_10450422 | 3300012057 | Attine Ant Fungus Gardens | ICNILIYFLEWRSIGRASLALAFIPEALEVVNAILLSV* |
Ga0153991_10064983 | 3300012059 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMEGASLALAFISEALEVVNVILLSV* |
Ga0153991_10079541 | 3300012059 | Attine Ant Fungus Gardens | NICNILIYFSEWRLIGRASLALAFISEALEVVNATLLSV* |
Ga0153991_10213494 | 3300012059 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMKGAFLALAFISEALEVVNVILLSM* |
Ga0153991_10532461 | 3300012059 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGTSLALAFISEALEVVNVILLSV* |
Ga0153965_100019613 | 3300012069 | Attine Ant Fungus Gardens | LIYFSEWRLMERASLALAFISEALEVVNAILLSV* |
Ga0153965_10241724 | 3300012069 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGASLALAFISEALEVVNAILLSV* |
Ga0153963_10067491 | 3300012070 | Attine Ant Fungus Gardens | VSNICKILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0153963_10081741 | 3300012070 | Attine Ant Fungus Gardens | NILIYFSEWRLIEGAFLALAFISEALEVVNAILLSV* |
Ga0153963_10676651 | 3300012070 | Attine Ant Fungus Gardens | VLNICNILIYFSEWRLIGGASLALAFILEALEVVNVILLSV* |
Ga0153983_10104461 | 3300012071 | Attine Ant Fungus Gardens | SNICNILIYFSEWRLMERAFLALAFISEALEVVNMVFLSV* |
Ga0153983_10155141 | 3300012071 | Attine Ant Fungus Gardens | VFNICNMLIYFSEWRFIERASMALAFISEALEVINAILLSV* |
Ga0153983_10333941 | 3300012071 | Attine Ant Fungus Gardens | SDICNILIYFSEWRLMERASLALAFISEALEVVNAILLSM* |
Ga0153983_10792491 | 3300012071 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMEGASLALAFISEALEVVNAILLSV* |
Ga0153979_100044115 | 3300012073 | Attine Ant Fungus Gardens | NILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0153979_10144873 | 3300012073 | Attine Ant Fungus Gardens | ICKIIIYFSEWRLMGRAFLALAFILEALKVVNAILLSV* |
Ga0153979_10278202 | 3300012073 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMERAFLALAFISEALEVVNAILLSV* |
Ga0153979_10389232 | 3300012073 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMERAFLALAFISEALEVVNAIFLSV* |
Ga0153979_10407371 | 3300012073 | Attine Ant Fungus Gardens | NILIYFSEWRLIGRASLALAFISEALEVVNAILLSV* |
Ga0153979_10546141 | 3300012073 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGRASLALAFISEALEVVNVILLSM* |
Ga0153979_10974492 | 3300012073 | Attine Ant Fungus Gardens | NICKILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0153971_10022529 | 3300012076 | Attine Ant Fungus Gardens | CNILIYFSEWRLMGRASLALAFISEALEVVNAILSSV* |
Ga0153971_10023537 | 3300012076 | Attine Ant Fungus Gardens | ICKIIIYFSEWRLIEGAFLALAFISEALEVVNAILLSV* |
Ga0153971_10041825 | 3300012076 | Attine Ant Fungus Gardens | KIIIYFSEWRLIGRASLALAFISEALEVVNAILLSV* |
Ga0153971_10105431 | 3300012076 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGASLALAFISEALEVVNAILLST* |
Ga0153971_10225533 | 3300012076 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGGAFLALVFISEALEVVNAILLSV* |
Ga0154000_10128691 | 3300012083 | Attine Ant Fungus Gardens | ILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0154000_10193792 | 3300012083 | Attine Ant Fungus Gardens | LIYFSEWRLMERAFLALAFISEALEVVNMIFLSV* |
Ga0154000_10268931 | 3300012083 | Attine Ant Fungus Gardens | NICNILIYFSEWRLIDRASLALVFISEALEVVNAILLSV* |
Ga0154000_10463691 | 3300012083 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGAFLALAFISEALEVVNVILLSM* |
Ga0154000_10910552 | 3300012083 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLIGRASLALAFISEALEVVNAILLSV* |
Ga0154000_11046471 | 3300012083 | Attine Ant Fungus Gardens | NICNILIYFSEWRLIGRASLALAFISEALEIVNVILLSV* |
Ga0153988_10026241 | 3300012119 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLIERAFLALVFISEALEVVNAILLSV* |
Ga0153968_10022541 | 3300012123 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLIERASLALVFISEALEVVNAILLSV* |
Ga0153968_10026469 | 3300012123 | Attine Ant Fungus Gardens | CNILIYFSEWRLMERASLALAFISEALEVVNAILLSM* |
Ga0153968_10471121 | 3300012123 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMGGAFLALAFISEALEVVNAILLSL* |
Ga0153968_10627872 | 3300012123 | Attine Ant Fungus Gardens | ILIYFSEWRLMGRASLALAFISEALEVVNAILLSV* |
Ga0153997_10010648 | 3300012126 | Attine Ant Fungus Gardens | CNILIYFSEWRLIERASLALAFISEALEVVNAILLSI* |
Ga0153997_10087074 | 3300012126 | Attine Ant Fungus Gardens | ILIYFSEWRLIERASLALAFISEALEIVNAILLSM* |
Ga0153994_10021981 | 3300012131 | Attine Ant Fungus Gardens | VPNICNILIYFSEWRLMGRASLALAFISEALEVVNAILSSV* |
Ga0153982_100065615 | 3300012135 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMERASLALAFISEALEVINAILLSM* |
Ga0153982_10008391 | 3300012135 | Attine Ant Fungus Gardens | NICKIIIYFSEWRLKEEASLALAFISEALEVVNAILLSV* |
Ga0153982_10027759 | 3300012135 | Attine Ant Fungus Gardens | LIYFSEWRLMEGAFLALAFISEALEVVNAILLSI* |
Ga0153982_10121752 | 3300012135 | Attine Ant Fungus Gardens | CNILIYFSEWRLMEGASLALAFISEALEVVNAILLST* |
Ga0153982_10590572 | 3300012135 | Attine Ant Fungus Gardens | NILIYFSEWRLMGRAFLALAFISEALEVVNVILLSV* |
Ga0153985_10058091 | 3300012136 | Attine Ant Fungus Gardens | IPIYFSEWRLMERASLALAFISEALKVVNAILLSV* |
Ga0153985_10196431 | 3300012136 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMERASLALAFISEALEVVNVILLSV* |
Ga0153985_10251841 | 3300012136 | Attine Ant Fungus Gardens | NICNILIYFSEWRLMEGAFLALAFISEALEVVNAILLSI* |
Ga0153985_10317482 | 3300012136 | Attine Ant Fungus Gardens | ILIYFSEWRSMGEASLALAFISEALEIVNAILLSM* |
Ga0153961_10193181 | 3300012139 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMEGAFLALAFISEALEVVNAILLSM* |
Ga0153961_10229722 | 3300012139 | Attine Ant Fungus Gardens | VSNICNILIYFSEWRLMEGAFLALAFISEALEIVNAILLSV* |
Ga0153961_10369961 | 3300012139 | Attine Ant Fungus Gardens | NICNILIYFSEWKLMERAFLALAFISEALEVVNAILLSM* |
Ga0153961_10398161 | 3300012139 | Attine Ant Fungus Gardens | MLIYFSEWRFIERASMALAFISEAFEVINAILLSV* |
Ga0153958_10065146 | 3300012141 | Attine Ant Fungus Gardens | LIYFSEWRLIGRASLALAFISEALEVVNAILLSV* |
Ga0153958_10892541 | 3300012141 | Attine Ant Fungus Gardens | MLIYFSEWRLIGRAFLALAFISEALEVVNAILLSV |
Ga0153996_10046796 | 3300012144 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMGGVSLALAFISEALEVVNAILLSV* |
Ga0153996_10095951 | 3300012144 | Attine Ant Fungus Gardens | ILIYFSEWRLMGRASLALAFISEALEVVNVILLSM* |
Ga0153996_10130214 | 3300012144 | Attine Ant Fungus Gardens | ILIYFSEWRLMGGASLALAFISEALKVVNAILLSV* |
Ga0153996_10164812 | 3300012144 | Attine Ant Fungus Gardens | MLIYFSEWRFIERASMALAFISEALEVVNAILLSV* |
Ga0153996_10871231 | 3300012144 | Attine Ant Fungus Gardens | ICNILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0153974_10223431 | 3300012180 | Attine Ant Fungus Gardens | LIYFSEWRLMERASLALAFISEALEVVNVILLSV* |
Ga0153974_10789741 | 3300012180 | Attine Ant Fungus Gardens | CNILIYFSEWRLIERASLALAFISEALEVVNMILLSV* |
Ga0153962_10107012 | 3300012674 | Attine Ant Fungus Gardens | SNICNILIYFSEWRLMEGASLALAFISEALEVVNAILLST* |
Ga0153962_10120402 | 3300012674 | Attine Ant Fungus Gardens | NICNILIYFSEWRLIGGASLALAFISEALEVVNAILLSM* |
Ga0157361_10025454 | 3300012995 | Fungus Garden | ILIYFSEWRLMERASLALAFISEALEIVNAILLSM* |
Ga0157361_10046351 | 3300012995 | Fungus Garden | VSNICNILIYFSEWRLMEGASLALAFISEALEVVNAILLSV* |
Ga0157361_10078661 | 3300012995 | Fungus Garden | ICNILIYFSEWRLMGGASLALAFISEALEVVNAILLSM* |
Ga0157361_10333081 | 3300012995 | Fungus Garden | IILIYFSEWRLMKRAFLALVFTSEALEIINVILLSV* |
Ga0157361_10499831 | 3300012995 | Fungus Garden | SNICKIIIYFSEWRLIGGAALVLAFISEALEIINAILLSM* |
Ga0157361_10673692 | 3300012995 | Fungus Garden | ICNILIYFSEWRLMERASLALAFISEALEVVNAILLSV* |
Ga0157362_10499205 | 3300012998 | Fungus Garden | NICNILIYFSEWRLMERAFLALAFISEALEVVNVILLSV* |
Ga0157362_10617943 | 3300012998 | Fungus Garden | IIIYFSEWRLIEGAFLALAFISEALEVVNAILLSV* |
Ga0157362_10935221 | 3300012998 | Fungus Garden | VSNICNILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0157362_12251962 | 3300012998 | Fungus Garden | NICNILIYFSEWRLMEGAFLALAFISEALEVVNAILLSV* |
Ga0157360_10007611 | 3300013000 | Fungus Garden | NICNILIYFSEWRLMGRAFLALAFISEALEVVNMILLSV* |
Ga0157360_10336962 | 3300013000 | Fungus Garden | CNILIYFSEWRLIERASLALAFISEALEVVNAILLSV* |
Ga0157360_10475961 | 3300013000 | Fungus Garden | VSNIYKILIYFSEWRLMEGAFLALVFISEALEVVNAILLSV* |
Ga0157360_10487343 | 3300013000 | Fungus Garden | ICNILIYFLEWRLMERAFLALAFISEALEVVNAILLSM* |
Ga0157360_10587002 | 3300013000 | Fungus Garden | ICNILIYFSEWRLMGRAFLALAFISEALEVINAILLSI* |
Ga0157360_11011262 | 3300013000 | Fungus Garden | MLIYFSEWRLIEGAFLALAFISEALEVVNAILLSV* |
Ga0157360_11504482 | 3300013000 | Fungus Garden | CNILIYFLEWRLMGGAFLALAFISEALEVVNAILLSV* |
Ga0157365_102153131 | 3300013001 | Fungus Garden | NILIYFSEWRLMEKASLVLAFISEALGVVNAILLSV* |
Ga0157364_10364934 | 3300013002 | Fungus Garden | SNICKIIIYFSEWRLMGRASLALAFISEALEVVNAILLSM* |
Ga0157364_10546991 | 3300013002 | Fungus Garden | NICNILIYFSEWRLMGGASLALAFISEALEVVNMILLSV* |
Ga0157364_11214301 | 3300013002 | Fungus Garden | IIIYFSEWRLIGGAFLALAFILEALEVVNVILLSV* |
Ga0157364_11428871 | 3300013002 | Fungus Garden | VSNICNILIYFSEWRLMGGASLALAFISEALEVVNVILLSV* |
⦗Top⦘ |