| Basic Information | |
|---|---|
| Family ID | F068270 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MHTRVLKPRNGPTLLVRPLRNGDVATVLAVFERLGPESRRARFNGPK |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.68 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 95.20 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.33% β-sheet: 8.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 41.60 |
| PF03167 | UDG | 18.40 |
| PF13302 | Acetyltransf_3 | 3.20 |
| PF07883 | Cupin_2 | 2.40 |
| PF08031 | BBE | 1.60 |
| PF05958 | tRNA_U5-meth_tr | 1.60 |
| PF03699 | UPF0182 | 0.80 |
| PF04073 | tRNA_edit | 0.80 |
| PF07690 | MFS_1 | 0.80 |
| PF14026 | DUF4242 | 0.80 |
| PF02574 | S-methyl_trans | 0.80 |
| PF04679 | DNA_ligase_A_C | 0.80 |
| PF02811 | PHP | 0.80 |
| PF01551 | Peptidase_M23 | 0.80 |
| PF07992 | Pyr_redox_2 | 0.80 |
| PF13180 | PDZ_2 | 0.80 |
| PF00353 | HemolysinCabind | 0.80 |
| PF12680 | SnoaL_2 | 0.80 |
| PF01475 | FUR | 0.80 |
| PF00583 | Acetyltransf_1 | 0.80 |
| PF00581 | Rhodanese | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 41.60 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 18.40 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 18.40 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 18.40 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.60 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.60 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.80 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.80 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.80 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.80 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.20 % |
| Unclassified | root | N/A | 20.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig1896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1459 | Open in IMG/M |
| 3300001361|A30PFW6_1225874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1015 | Open in IMG/M |
| 3300002568|C688J35102_120031431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300004114|Ga0062593_100919385 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300004479|Ga0062595_100131871 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300004479|Ga0062595_100318444 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005435|Ga0070714_102120283 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005437|Ga0070710_11328406 | Not Available | 535 | Open in IMG/M |
| 3300005437|Ga0070710_11543566 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005518|Ga0070699_102062551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina | 521 | Open in IMG/M |
| 3300005532|Ga0070739_10462041 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005538|Ga0070731_10237413 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005547|Ga0070693_101052159 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005547|Ga0070693_101456212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300005587|Ga0066654_10275800 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005764|Ga0066903_102148147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300005841|Ga0068863_101180598 | Not Available | 771 | Open in IMG/M |
| 3300005893|Ga0075278_1079373 | Not Available | 522 | Open in IMG/M |
| 3300006046|Ga0066652_101517414 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006046|Ga0066652_101689191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300006059|Ga0075017_101581331 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006173|Ga0070716_101307749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 586 | Open in IMG/M |
| 3300006175|Ga0070712_101089271 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006358|Ga0068871_100745485 | Not Available | 900 | Open in IMG/M |
| 3300006796|Ga0066665_10182032 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300006804|Ga0079221_11419587 | Not Available | 553 | Open in IMG/M |
| 3300006806|Ga0079220_10773446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300006854|Ga0075425_101024080 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006914|Ga0075436_100876149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 671 | Open in IMG/M |
| 3300006914|Ga0075436_101326580 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009088|Ga0099830_10971815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300009137|Ga0066709_103813259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300009143|Ga0099792_10958978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 569 | Open in IMG/M |
| 3300009148|Ga0105243_12639662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300009174|Ga0105241_10777653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 880 | Open in IMG/M |
| 3300009792|Ga0126374_11567099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300010039|Ga0126309_10495771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300010362|Ga0126377_12768297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300010366|Ga0126379_11947969 | Not Available | 690 | Open in IMG/M |
| 3300010371|Ga0134125_10285864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1832 | Open in IMG/M |
| 3300010373|Ga0134128_10874431 | Not Available | 995 | Open in IMG/M |
| 3300010399|Ga0134127_10505682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1221 | Open in IMG/M |
| 3300010400|Ga0134122_13394544 | Not Available | 501 | Open in IMG/M |
| 3300011119|Ga0105246_11751425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300012189|Ga0137388_11217724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300012189|Ga0137388_11507686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300012198|Ga0137364_10766335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300012201|Ga0137365_10188578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1544 | Open in IMG/M |
| 3300012201|Ga0137365_10947473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300012202|Ga0137363_10274903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1376 | Open in IMG/M |
| 3300012202|Ga0137363_11502458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300012206|Ga0137380_10841213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 790 | Open in IMG/M |
| 3300012209|Ga0137379_11605511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300012354|Ga0137366_10218298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1420 | Open in IMG/M |
| 3300012356|Ga0137371_11445398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 502 | Open in IMG/M |
| 3300012911|Ga0157301_10236499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 635 | Open in IMG/M |
| 3300012915|Ga0157302_10442648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300012918|Ga0137396_11081278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300012957|Ga0164303_10783838 | Not Available | 653 | Open in IMG/M |
| 3300012957|Ga0164303_11436423 | Not Available | 518 | Open in IMG/M |
| 3300012958|Ga0164299_10027418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2429 | Open in IMG/M |
| 3300012958|Ga0164299_10362824 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012960|Ga0164301_10238205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1187 | Open in IMG/M |
| 3300012960|Ga0164301_10603073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300012960|Ga0164301_11296790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300012985|Ga0164308_12031850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 536 | Open in IMG/M |
| 3300012988|Ga0164306_10513681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
| 3300013102|Ga0157371_11469649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300013105|Ga0157369_10643268 | Not Available | 1094 | Open in IMG/M |
| 3300013297|Ga0157378_12346197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300013308|Ga0157375_10396827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1546 | Open in IMG/M |
| 3300013308|Ga0157375_11471504 | Not Available | 803 | Open in IMG/M |
| 3300014058|Ga0120149_1244224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 504 | Open in IMG/M |
| 3300014968|Ga0157379_12123286 | Not Available | 557 | Open in IMG/M |
| 3300015242|Ga0137412_10100617 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300015372|Ga0132256_100464377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1374 | Open in IMG/M |
| 3300015373|Ga0132257_101419195 | Not Available | 884 | Open in IMG/M |
| 3300015374|Ga0132255_101960919 | Not Available | 891 | Open in IMG/M |
| 3300017937|Ga0187809_10406609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300017947|Ga0187785_10566669 | Not Available | 577 | Open in IMG/M |
| 3300017947|Ga0187785_10667526 | Not Available | 542 | Open in IMG/M |
| 3300018073|Ga0184624_10370748 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020070|Ga0206356_11666191 | Not Available | 560 | Open in IMG/M |
| 3300021560|Ga0126371_11010935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 973 | Open in IMG/M |
| 3300021560|Ga0126371_12240457 | Not Available | 659 | Open in IMG/M |
| 3300025898|Ga0207692_10955103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300025912|Ga0207707_10225697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1630 | Open in IMG/M |
| 3300025914|Ga0207671_10072984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2562 | Open in IMG/M |
| 3300025919|Ga0207657_10691364 | Not Available | 792 | Open in IMG/M |
| 3300025926|Ga0207659_10317698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1284 | Open in IMG/M |
| 3300025927|Ga0207687_10101001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
| 3300025928|Ga0207700_10245326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1528 | Open in IMG/M |
| 3300025932|Ga0207690_10948978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300025934|Ga0207686_10253188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
| 3300025937|Ga0207669_11234604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300025939|Ga0207665_10103896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1988 | Open in IMG/M |
| 3300025939|Ga0207665_11189312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300025944|Ga0207661_11102258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300025944|Ga0207661_11110528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300026078|Ga0207702_10635707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
| 3300026325|Ga0209152_10106218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
| 3300027725|Ga0209178_1093119 | Not Available | 1000 | Open in IMG/M |
| 3300027869|Ga0209579_10309338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300027869|Ga0209579_10343980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
| 3300027873|Ga0209814_10383621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Bailinhaonella → Bailinhaonella thermotolerans | 617 | Open in IMG/M |
| 3300027874|Ga0209465_10574692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300028799|Ga0307284_10494531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300028824|Ga0307310_10105844 | Not Available | 1256 | Open in IMG/M |
| 3300028828|Ga0307312_10486355 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300028872|Ga0307314_10290414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300031231|Ga0170824_116373408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300031572|Ga0318515_10154338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
| 3300031847|Ga0310907_10874970 | Not Available | 507 | Open in IMG/M |
| 3300031959|Ga0318530_10370645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300031996|Ga0308176_12566745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300032001|Ga0306922_11931796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300032044|Ga0318558_10087459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1443 | Open in IMG/M |
| 3300032074|Ga0308173_10394435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 1216 | Open in IMG/M |
| 3300032089|Ga0318525_10313461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300032782|Ga0335082_10178453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2034 | Open in IMG/M |
| 3300032783|Ga0335079_11333493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300032829|Ga0335070_11066295 | Not Available | 744 | Open in IMG/M |
| 3300033004|Ga0335084_11368874 | Not Available | 703 | Open in IMG/M |
| 3300033412|Ga0310810_10620963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1031 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.20% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01666040 | 2124908044 | Soil | MHTRVIKPRHGPTLLVRPLERGDVATVSAVFERLGDESRR |
| A30PFW6_12258743 | 3300001361 | Permafrost | MHTRVLKPRNGPTLLVRPLRNGDVATVLAVFERLGPESRRARFNGPK |
| C688J35102_1200314311 | 3300002568 | Soil | MQTRYLTPKDGPHLIVRPLRNGDGTTVLQVFERLGADSRRARFNGPKPCLSAAE |
| Ga0062593_1009193851 | 3300004114 | Soil | MHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARFNGPKPCLRKAELQR |
| Ga0062595_1001318713 | 3300004479 | Soil | MHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGGLGERSRRTRFNGPK |
| Ga0062595_1003184442 | 3300004479 | Soil | MHTRILKPRHAPSLLVRPLRHRDMQTVLAVFERLSDESRRNRFNGPKPSLT |
| Ga0070714_1021202832 | 3300005435 | Agricultural Soil | MHTRILTPKHGPALVVRPLRDGDTGTVAAVFARLGPESRR |
| Ga0070710_113284062 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VHTRVLKLKHGPTIHVRTLRNGDVDTVISMFNRLGEQARRKRFN |
| Ga0070710_115435661 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRVLHLKHGPALLVRPLRRGDVRTVMAVFERLGEASRRARFNGPKPCLRMSEL |
| Ga0070699_1020625511 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRVLKPKHGPTLLVRPLRHGDVGTIVAVFERLGERSRRARFNGPK |
| Ga0070739_104620411 | 3300005532 | Surface Soil | MHTRLVTLKHGPPLLVRPLRHGDRQTVLAVFARLGDASRRSRFNGPKPCLDEGELERLARVDDGHH |
| Ga0070731_102374131 | 3300005538 | Surface Soil | MHTRSLHLRDGRSLVVRPLRDGDLATVAAVFARVGPESRRARFNGP |
| Ga0070693_1010521592 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCL |
| Ga0070693_1014562121 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRILKPKHGPVLLVRPLRRGDVRTVMAVFERLSESSRRARFNGPKPCLKTSELRQLAAID |
| Ga0066654_102758004 | 3300005587 | Soil | VHTRIVKPKHGPRLVVRPLRDGDALTVLALFERLSERSRR |
| Ga0066903_1021481471 | 3300005764 | Tropical Forest Soil | MHARIVKAKRGPEIIVRPLRHGDVDTVSAVFSRLGEESRRTRFLGPKLGLGETELRW |
| Ga0068863_1011805983 | 3300005841 | Switchgrass Rhizosphere | MHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFN |
| Ga0075278_10793732 | 3300005893 | Rice Paddy Soil | VNTRVLESKHGLSVLVRPLRNGDVDTVLAVFHRLGQESRRTRFNG |
| Ga0066652_1015174142 | 3300006046 | Soil | MHTRVVKPKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLK |
| Ga0066652_1016891911 | 3300006046 | Soil | MHTRVIKPRHGPTLIVRPLRHGDVRTVLAVFERLGDQSRRARFNGPKPCLSRDELRRLATIDS |
| Ga0075017_1015813311 | 3300006059 | Watersheds | MHTRILKAKHGPTLLVKPLRNGDVRPIMAVFERLGDQSRRARFN |
| Ga0070716_1013077491 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRLIKPPHGPSLIVRPLRDGDADTVRSVFGRLGDESRRMRFNGPKPCLSDV |
| Ga0070712_1010892712 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRVLKPRNGPTLIVRPLRHGDVGTVLAVFDRLGPES |
| Ga0068871_1007454851 | 3300006358 | Miscanthus Rhizosphere | MHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGN |
| Ga0066665_101820323 | 3300006796 | Soil | MHTRVIKPKHGPTLIVRPLRHGDVRTVLAVFERLGDQSRRARFNGPKPCLSRDELRQLAT |
| Ga0079221_114195873 | 3300006804 | Agricultural Soil | VHTRVLTATRGPVLVVRPLRHGDVRTVAAVFERLSDQSRRARFNGPKPCLSRTDLRQLALVDAT |
| Ga0079220_107734461 | 3300006806 | Agricultural Soil | MHTRILTPKHGPALVVRPLRDGDTGTVAAVFARLGPESRRLRFNGPKPCLPDE |
| Ga0075425_1010240801 | 3300006854 | Populus Rhizosphere | MHTRVVKPKRGPEILVRPFRRGDTAPVEAVFERLGEASRRARFNGAK |
| Ga0075436_1008761491 | 3300006914 | Populus Rhizosphere | MHTRALNPKHGPALLVRPLRRGDVRTVMAVFHRLSDESRRARFNGS |
| Ga0075436_1013265802 | 3300006914 | Populus Rhizosphere | MHTRVVKAKHGPELVVRPLRHGDTATVQAVFERLGDASRRARFN |
| Ga0099830_109718151 | 3300009088 | Vadose Zone Soil | MHTRVIKPRHGPELLVRPLRRGDVATVLAVFERLGDDSRRARFHGPKP |
| Ga0066709_1038132591 | 3300009137 | Grasslands Soil | MHTRVVRPKHGPELVVRPLRHGDSATVQAVFERLGDASRR |
| Ga0099792_109589782 | 3300009143 | Vadose Zone Soil | MVSKLTMHTRVLKPRNGQTLIVRPLRNGDVGTVVAAFDRLGPESR |
| Ga0105243_126396621 | 3300009148 | Miscanthus Rhizosphere | MRSRILEPGHSLSLQVRPLRHGDVRTVMAVFGRLGDESRRARFNRPKPCLTAGELRQLAT |
| Ga0105241_107776533 | 3300009174 | Corn Rhizosphere | MHTRILKPKHGPTRLVRPLRRGDVRTVMAVFERLS |
| Ga0126374_115670992 | 3300009792 | Tropical Forest Soil | MHTRVVRPKHGPELIVRPLRRGDTATVQAVFDRLGE |
| Ga0126309_104957711 | 3300010039 | Serpentine Soil | MHTRIVKPERVSALLVRPLRHGDVRTVMSVFERLGDRSRRARFNGAKPCLSRSELRQLAS |
| Ga0126377_127682972 | 3300010362 | Tropical Forest Soil | MYTRLVQPKHGPPLVVRPLRRGDVRTVLAVFERLGPDSRRLRFNG |
| Ga0126379_119479691 | 3300010366 | Tropical Forest Soil | MHTRIVKPKRGPELLVRPLRHGDTATVAAVFARLGEASRLARFN |
| Ga0134125_102858644 | 3300010371 | Terrestrial Soil | MHTRVVKPGYGPELVVRPLKPGDTASVHALFERLGEASRR |
| Ga0134128_108744311 | 3300010373 | Terrestrial Soil | MHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCLPEAELRHLAR |
| Ga0134127_105056823 | 3300010399 | Terrestrial Soil | MHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGL |
| Ga0134122_133945442 | 3300010400 | Terrestrial Soil | MHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARF |
| Ga0105246_117514251 | 3300011119 | Miscanthus Rhizosphere | MHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLKHRLGEQ |
| Ga0137388_112177242 | 3300012189 | Vadose Zone Soil | MHTRVIKPRHGPTLLVRPLRHGDVQTVLAVFGRLGEQSRRTRFNGPKPCLSALELEQLAA |
| Ga0137388_115076862 | 3300012189 | Vadose Zone Soil | MHTRVIKPRHGPELLVRPLRRGDVATVLAVFERLGDDSRRARFHGPKPCLSDV |
| Ga0137364_107663352 | 3300012198 | Vadose Zone Soil | MHTRVLKPKHGPTLLVRPLRHGDVRTVMAVFERLGH |
| Ga0137365_101885783 | 3300012201 | Vadose Zone Soil | MHTRVIKPKHGPTLLVRPLRHGDVRTVLAVFERLGDRSRRTRFNGPKPCLSAAELRQLARIDS |
| Ga0137365_109474731 | 3300012201 | Vadose Zone Soil | MHTRLVKPRQGPELLVRPLTSGDVETVTAVFARLG |
| Ga0137363_102749033 | 3300012202 | Vadose Zone Soil | MHTRVLKPRNGPTLIVRPLRHGDVGTVLAVFDRLGPESRRARFNG |
| Ga0137363_115024582 | 3300012202 | Vadose Zone Soil | MHTRAIKLKHGPTILVRPLRGGDVATVRAVFEQLGDESRRARFNG |
| Ga0137380_108412131 | 3300012206 | Vadose Zone Soil | MHTRVIKLKHGPTILVRPLRAGDVATVRAVFEQLGDESRRTRFNGPKPCLSDAELAQLAA |
| Ga0137379_116055111 | 3300012209 | Vadose Zone Soil | MHTRVLKPKHGPTLLVRPLRHGDVRTVMAVFERLGHESRRARFNGPKPCLSRDELRQLAS |
| Ga0137366_102182981 | 3300012354 | Vadose Zone Soil | MHTRVIKPKHGPTLLVRPLRHGDVRTVLAIFERLGDRSRRTRFNGPKPCLSGEELRQLATID |
| Ga0137371_114453982 | 3300012356 | Vadose Zone Soil | MHTRLVKPRQGPELLVRPLTSGDVETVTAVFARLGERSRRARFMGPK |
| Ga0157301_102364991 | 3300012911 | Soil | VNLAHGRQLLIRPLRNGDVETVLDVFERLGERSRRARFNG |
| Ga0157302_104426482 | 3300012915 | Soil | VHTRIVKPKRGPSLFVRPLRRGDTATVSAMFERLGEQSRRTRFLGPKPRLSATDLE |
| Ga0137396_110812782 | 3300012918 | Vadose Zone Soil | MHTRVLKPRNGPMLIVRPLRHGDVGTVLAVFDRLGPESRRARFNGPKPCLSS |
| Ga0164303_107838381 | 3300012957 | Soil | MHTSIIRPKHGPELIVRPLKHGDTVTIQTVFERLGEASRR |
| Ga0164303_114364231 | 3300012957 | Soil | MHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNA |
| Ga0164299_100274183 | 3300012958 | Soil | MHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFNGLKRELGE* |
| Ga0164299_103628241 | 3300012958 | Soil | MHTRVLQCHAGTLLVRPLRRGDVRTVLAVFERLGEESRRRRFNGAKPCL |
| Ga0164301_102382053 | 3300012960 | Soil | MHTRVLKPRNGPTLIVRPLRHGDVATVYADFGRLRERSRRPRFNGPKPCLSRA |
| Ga0164301_106030732 | 3300012960 | Soil | MHTRVLKPKHGPTLLVRPLRHGDVRTVVAVFERLGPQSRRARFNGPKPCLTAAELRQ |
| Ga0164301_112967902 | 3300012960 | Soil | MHTRVLHLKHGPALLVRPLRRCDVRTVMAVFERLGEASRRARFNGPKPC |
| Ga0164308_120318501 | 3300012985 | Soil | MHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRTRFNG |
| Ga0164306_105136811 | 3300012988 | Soil | MHTRVLKPRNGPTLIVRPLRHGDVATVAAVFGRLGARSRRTRFNGPKPCLSPA |
| Ga0157371_114696492 | 3300013102 | Corn Rhizosphere | MHTRILKPKHGPTLLVRPLRRGDVRTVMAVFERLSESSRRARFNGPKPCLKTSELP |
| Ga0157369_106432681 | 3300013105 | Corn Rhizosphere | MHTRILKPRHAPTLLVRPLRHRDTQTVLALFERLSDES |
| Ga0157378_123461971 | 3300013297 | Miscanthus Rhizosphere | MHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGDASRRARFNGLKHR |
| Ga0157375_103968274 | 3300013308 | Miscanthus Rhizosphere | MHTRVLKPKNGPTLLVRPLRRGDVGTVCAMFARLGERSRRAR |
| Ga0157375_114715042 | 3300013308 | Miscanthus Rhizosphere | MHTRVVKAKHGPELVVRPLKHGDTATVQAVFERLGD |
| Ga0120149_12442241 | 3300014058 | Permafrost | MYTRVIKPRHGPTLLVRPLERGDVATVSAVFEQLGEQSRRARFNGPK |
| Ga0157379_121232863 | 3300014968 | Switchgrass Rhizosphere | MHTRVVKAKHGPELLVRPLRDGDTATVQAVFERLGNASRLARFNGL |
| Ga0137412_101006174 | 3300015242 | Vadose Zone Soil | MHTRAIKLKHGPTILVRPLRAGDVATVRAVFEQLGDSSRRARFNGPKPCLSDAEL |
| Ga0132256_1004643773 | 3300015372 | Arabidopsis Rhizosphere | MHTRVVKAKHGPELVVRPLRHGDTATVQAVFERLGDAS |
| Ga0132257_1014191953 | 3300015373 | Arabidopsis Rhizosphere | MHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDES |
| Ga0132255_1019609192 | 3300015374 | Arabidopsis Rhizosphere | MHTRILESRHAPTLLVRPLRHRDVHTVLAVFERLSDESR |
| Ga0187809_104066091 | 3300017937 | Freshwater Sediment | MHTRVVKAKHGPELLVRPLRQGDTATVAAVFARLGDASRRARFNGL |
| Ga0187785_105666691 | 3300017947 | Tropical Peatland | MRQALTDGSSSTRYLTPERGASVTARPLRHGDVRTVIGIFDRLSDRSRRYRFNGPKPCLS |
| Ga0187785_106675262 | 3300017947 | Tropical Peatland | VHTRVLKSLGPALFVRPLRHGDTATVLAVFARLGEESRRARFNGAKPSLGESELRQLARVDG |
| Ga0184624_103707481 | 3300018073 | Groundwater Sediment | MHTRVIKPKLAPTLLVRPLRHGDVRTVWGLFERLG |
| Ga0206356_116661912 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VHTRVITPKHGPSLVVRPLRDGDTATVLAVFERLGEASRRARFNG |
| Ga0126371_110109353 | 3300021560 | Tropical Forest Soil | MYTRIVKPKRGPEILIRPLRPGDTSTVEAVFERLGE |
| Ga0126371_122404571 | 3300021560 | Tropical Forest Soil | MHTRVVRTKRGPELIVRPLRRGDTATVQAVFDRLGADSRLARFN |
| Ga0207692_109551032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGISNRLMHTRVLHLKHGPALLVRPLRRGDVRTVMAVFERLGEASRRARFNGPKPCLRMSELRQLA |
| Ga0207707_102256971 | 3300025912 | Corn Rhizosphere | MHTRVLRPKHGPTLLVRPLRHGDVRTVLAVFEQLGDESRRARFNGAKPCLSRTD |
| Ga0207671_100729841 | 3300025914 | Corn Rhizosphere | MHTRVVKPTCGPELLIRPLKHGDTSTVEAMFGRLGDASRLARFNGLKHRL |
| Ga0207657_106913642 | 3300025919 | Corn Rhizosphere | MQTRYLRLGRGPGLIVRPLRHGDAETVAAVFERLGESSRRN |
| Ga0207659_103176982 | 3300025926 | Miscanthus Rhizosphere | MQTRHLRLGRGPGLIVRLLRHGDAETVAAVFERLGESSRRNRFNGPKP |
| Ga0207687_101010014 | 3300025927 | Miscanthus Rhizosphere | MHTRVLKPKNGPTLLVRPLRRGDVGTVCAMFARLGERSRRA |
| Ga0207700_102453261 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VYTRILTPEHCPTLIVRPLRNGDRATVLGVFERLGEQSRRAR |
| Ga0207690_109489782 | 3300025932 | Corn Rhizosphere | MHTRILTPKHGPSLVVRPLRDGDATTVAAVFARLSAESRRLRFNGPKPCLPEAEL |
| Ga0207686_102531883 | 3300025934 | Miscanthus Rhizosphere | MHTRVVKAKHGPELLVRPLRHGDTATVQAVFERLGDASRRAR |
| Ga0207669_112346043 | 3300025937 | Miscanthus Rhizosphere | MHTRIVKPKRGLTLLVRPLRPGDTATVSAMFERLGEKSRRTRFNGPKPRLSAGDLE |
| Ga0207665_101038961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTRVVKPRCGPELLIRPLKHGDTSTVEAMFGRLGDASRLARFN |
| Ga0207665_111893122 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSRLIKPPHGPSLIVRPLRDGDTRTVAAVFGRLSTESRRLRFNGPKPCLPDEELRL |
| Ga0207661_111022581 | 3300025944 | Corn Rhizosphere | MHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRT |
| Ga0207661_111105281 | 3300025944 | Corn Rhizosphere | MQTRYLRLGRGPGLIVRPLRHGDAETVAAVFERLGESSRRNRFNGPKPRL |
| Ga0207702_106357073 | 3300026078 | Corn Rhizosphere | MHTRVLKPRNGPTLIVRPLRHGDVATVSAVFGRLGERSRRTRFN |
| Ga0209152_101062183 | 3300026325 | Soil | MHTRVLKPRNGPTLVVRPLRNGDVATVLSVFDRLGPQSRRTRFNGTKPC |
| Ga0209178_10931191 | 3300027725 | Agricultural Soil | MHTRILTPKHGPSLVVRPLRDGDTATVVAVFARLSAESRRLRFNGPKPCLPEA |
| Ga0209579_103093383 | 3300027869 | Surface Soil | MHTRSLHLRDGRSLVVRPLRDGDLATVAAVFARVGPESRRARFNGPKPCTDA |
| Ga0209579_103439803 | 3300027869 | Surface Soil | MHTRALKPRHGPTILVRPLAHGDVRTVLAVFEQLSDASR |
| Ga0209814_103836211 | 3300027873 | Populus Rhizosphere | MHTRILKPRHGPTILVRPLRHGDVRTVMAVFERLGDESRRARFN |
| Ga0209465_105746921 | 3300027874 | Tropical Forest Soil | MHTRIVKPKHGPEIVVRPLRRGDTATVQAVFDRLGEASRVAR |
| Ga0307284_104945311 | 3300028799 | Soil | MYTRVLKPKRGPTLFVRPLRHGDLRTVVGLFERLGEQSRRARFNGPKPCLSRS |
| Ga0307310_101058441 | 3300028824 | Soil | VNTRVLKPRHGPTILVRPLRNGDVDAVLAVFHRLGEQSRRNRFNGPKTRL |
| Ga0307312_104863551 | 3300028828 | Soil | MHTRILKPKHGPALVVRPLRHGAARTVMDLFERLGEESRRTRFNGPKPCLSRSE |
| Ga0307314_102904142 | 3300028872 | Soil | VHTRIVKPKRGPALVVRPLRRGDTATVCAMFQRLGERS |
| Ga0170824_1163734081 | 3300031231 | Forest Soil | MHTRVVKPKHGPERLVRPLRDGDTGTVQAVFERLGEASRLAR |
| Ga0318515_101543381 | 3300031572 | Soil | MMHTRAIKPKSGPPLLVRPLRNRDVETVLALFARLGDESRRLR |
| Ga0310907_108749702 | 3300031847 | Soil | MHARSIKARRGPELTVRLLRDGDVDTVLAVFERLGERSRRAR |
| Ga0318530_103706451 | 3300031959 | Soil | MHTRVVKPKRGPEMLVRPLRHGDVDTVWAVFSRLSEESRRTRFLGPKLELGD |
| Ga0308176_125667452 | 3300031996 | Soil | VHTRVITPKHGPSLVVRPLRDGDTATVLAVFERLGEASRRARFN |
| Ga0306922_119317961 | 3300032001 | Soil | MMHTRTIKPKSGPPLLVRPLRNRDVETVLALFARLGDESRRLRFNGP |
| Ga0318558_100874591 | 3300032044 | Soil | MHTRVVKPKRGPEMLVRPLRHGDVDTVWAVFSRLSEESRRTRFLGPK |
| Ga0308173_103944353 | 3300032074 | Soil | VHTRLISSRNGPTLLVRPLRDGDAATVLAVFERLGEASRRARFNGPKPCLS |
| Ga0308173_122743951 | 3300032074 | Soil | MQTRLITLKRGPRLIVRPLRNGDTATVLAVFGRLGADSRRLRFNGP |
| Ga0318525_103134612 | 3300032089 | Soil | MHTRIVKPKHGPEFLVRPLRHGDTATVQAVFERLGADSRRARFNGS |
| Ga0335082_101784535 | 3300032782 | Soil | MHTRIVRPRHGPELLVRPLRPGDTATVAAVFARLGDASRRARFNGLKHRLGEQE |
| Ga0335079_113334931 | 3300032783 | Soil | MHTRVLKPMRGATLLVRPLRHGDVRTVIAVFERLGEQSRRARFNGPKPCLTVS |
| Ga0335070_110662951 | 3300032829 | Soil | MHTRVLAPRHGPLLLVRPLRRGDERTVLDVFERLGEESRRARFNGP |
| Ga0335084_113688742 | 3300033004 | Soil | MQTRILKPKHGPTLLVRPLRNGDADTVLSVFERLGDRSRRSR |
| Ga0310810_106209631 | 3300033412 | Soil | MHTRILTPKQGPSLVVRPLRDGDTATVAAVFGRLSGESRRLRFNGPKPCLPDVELRHL |
| ⦗Top⦘ |