| Basic Information | |
|---|---|
| Family ID | F068260 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MDEWPNKSPEPTAVGAVSSAVAVHVASRRWLSFFR |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.47 % |
| % of genes near scaffold ends (potentially truncated) | 53.60 % |
| % of genes from short scaffolds (< 2000 bps) | 49.60 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.400 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (33.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.800 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13240 | zinc_ribbon_2 | 2.42 |
| PF06877 | RraB | 1.61 |
| PF07285 | DUF1444 | 1.61 |
| PF02371 | Transposase_20 | 1.61 |
| PF07963 | N_methyl | 1.61 |
| PF09951 | DUF2185 | 0.81 |
| PF13495 | Phage_int_SAM_4 | 0.81 |
| PF14112 | DUF4284 | 0.81 |
| PF07589 | PEP-CTERM | 0.81 |
| PF02517 | Rce1-like | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF13649 | Methyltransf_25 | 0.81 |
| PF04355 | SmpA_OmlA | 0.81 |
| PF14206 | Cys_rich_CPCC | 0.81 |
| PF13370 | Fer4_13 | 0.81 |
| PF10997 | Amj | 0.81 |
| PF13676 | TIR_2 | 0.81 |
| PF05157 | T2SSE_N | 0.81 |
| PF04545 | Sigma70_r4 | 0.81 |
| PF05154 | TM2 | 0.81 |
| PF01476 | LysM | 0.81 |
| PF00565 | SNase | 0.81 |
| PF02674 | Colicin_V | 0.81 |
| PF14568 | SUKH_6 | 0.81 |
| PF12831 | FAD_oxidored | 0.81 |
| PF07603 | DUF1566 | 0.81 |
| PF04862 | DUF642 | 0.81 |
| PF13783 | DUF4177 | 0.81 |
| PF13637 | Ank_4 | 0.81 |
| PF01564 | Spermine_synth | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF14354 | Lar_restr_allev | 0.81 |
| PF03143 | GTP_EFTU_D3 | 0.81 |
| PF16845 | SQAPI | 0.81 |
| PF15601 | Imm70 | 0.81 |
| PF09346 | SMI1_KNR4 | 0.81 |
| PF13302 | Acetyltransf_3 | 0.81 |
| PF00359 | PTS_EIIA_2 | 0.81 |
| PF08388 | GIIM | 0.81 |
| PF06271 | RDD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.61 |
| COG4848 | YtpQ protein involved in methylglyoxal resistance, DUF1444/UPF0354 family | General function prediction only [R] | 1.61 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1286 | Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.81 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 0.81 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.40 % |
| All Organisms | root | All Organisms | 45.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001401|JGI20189J14885_1038338 | Not Available | 618 | Open in IMG/M |
| 3300005831|Ga0074471_10172835 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomicrobium → Planctomicrobium piriforme | 667 | Open in IMG/M |
| 3300006104|Ga0007882_10019615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3150 | Open in IMG/M |
| 3300006104|Ga0007882_10070999 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300006162|Ga0075030_100014401 | All Organisms → cellular organisms → Bacteria | 6903 | Open in IMG/M |
| 3300006638|Ga0075522_10006221 | All Organisms → cellular organisms → Bacteria | 8359 | Open in IMG/M |
| 3300006638|Ga0075522_10008171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 7142 | Open in IMG/M |
| 3300006642|Ga0075521_10421518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300009029|Ga0066793_10550477 | Not Available | 658 | Open in IMG/M |
| 3300009510|Ga0116230_10678667 | Not Available | 774 | Open in IMG/M |
| 3300009839|Ga0116223_10778431 | Not Available | 548 | Open in IMG/M |
| 3300010379|Ga0136449_100085116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 6632 | Open in IMG/M |
| 3300014161|Ga0181529_10665495 | Not Available | 539 | Open in IMG/M |
| 3300014167|Ga0181528_10124488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1398 | Open in IMG/M |
| 3300014168|Ga0181534_10014972 | All Organisms → cellular organisms → Bacteria | 3991 | Open in IMG/M |
| 3300014168|Ga0181534_10024030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3061 | Open in IMG/M |
| 3300014200|Ga0181526_10439303 | Not Available | 827 | Open in IMG/M |
| 3300014201|Ga0181537_10795213 | Not Available | 642 | Open in IMG/M |
| 3300014201|Ga0181537_10883895 | Not Available | 605 | Open in IMG/M |
| 3300014491|Ga0182014_10199055 | Not Available | 1084 | Open in IMG/M |
| 3300014493|Ga0182016_10207188 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1261 | Open in IMG/M |
| 3300014499|Ga0182012_10040087 | Not Available | 3883 | Open in IMG/M |
| 3300014499|Ga0182012_10399793 | Not Available | 907 | Open in IMG/M |
| 3300014501|Ga0182024_10127106 | Not Available | 3633 | Open in IMG/M |
| 3300014654|Ga0181525_10203557 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300014655|Ga0181516_10007869 | All Organisms → cellular organisms → Bacteria | 6188 | Open in IMG/M |
| 3300014655|Ga0181516_10189194 | Not Available | 1044 | Open in IMG/M |
| 3300014655|Ga0181516_10208396 | Not Available | 992 | Open in IMG/M |
| 3300014655|Ga0181516_10355934 | Not Available | 746 | Open in IMG/M |
| 3300014657|Ga0181522_10031833 | Not Available | 2916 | Open in IMG/M |
| 3300014838|Ga0182030_10096448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter fusiformis | 4124 | Open in IMG/M |
| 3300014838|Ga0182030_10096708 | All Organisms → cellular organisms → Bacteria | 4116 | Open in IMG/M |
| 3300014838|Ga0182030_10610070 | Not Available | 1050 | Open in IMG/M |
| 3300014838|Ga0182030_10855916 | Not Available | 822 | Open in IMG/M |
| 3300014839|Ga0182027_11371095 | Not Available | 701 | Open in IMG/M |
| 3300016700|Ga0181513_1189632 | Not Available | 944 | Open in IMG/M |
| 3300017988|Ga0181520_10016581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 8862 | Open in IMG/M |
| 3300017988|Ga0181520_10021007 | Not Available | 7443 | Open in IMG/M |
| 3300018025|Ga0187885_10367447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 646 | Open in IMG/M |
| 3300018046|Ga0187851_10736068 | Not Available | 555 | Open in IMG/M |
| 3300021520|Ga0194053_10335434 | Not Available | 580 | Open in IMG/M |
| 3300022524|Ga0224534_1001709 | All Organisms → cellular organisms → Bacteria | 11211 | Open in IMG/M |
| 3300022524|Ga0224534_1009249 | Not Available | 3166 | Open in IMG/M |
| 3300022524|Ga0224534_1013617 | Not Available | 2384 | Open in IMG/M |
| 3300023068|Ga0224554_1002576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 9342 | Open in IMG/M |
| 3300023068|Ga0224554_1002576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 9342 | Open in IMG/M |
| 3300023088|Ga0224555_1030118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2318 | Open in IMG/M |
| 3300023091|Ga0224559_1018945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2932 | Open in IMG/M |
| 3300023091|Ga0224559_1292806 | Not Available | 541 | Open in IMG/M |
| 3300025470|Ga0208389_1035427 | Not Available | 999 | Open in IMG/M |
| 3300025496|Ga0208191_1044473 | Not Available | 979 | Open in IMG/M |
| 3300025648|Ga0208507_1009123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4217 | Open in IMG/M |
| 3300025648|Ga0208507_1056044 | Not Available | 1283 | Open in IMG/M |
| 3300025829|Ga0209484_10168062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 538 | Open in IMG/M |
| 3300025862|Ga0209483_1002250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 13660 | Open in IMG/M |
| 3300025891|Ga0209585_10008727 | All Organisms → cellular organisms → Bacteria | 3675 | Open in IMG/M |
| 3300027736|Ga0209190_1104799 | Not Available | 1297 | Open in IMG/M |
| 3300027854|Ga0209517_10186463 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium | 1293 | Open in IMG/M |
| 3300028745|Ga0302267_10207351 | Not Available | 868 | Open in IMG/M |
| 3300028779|Ga0302266_10051483 | Not Available | 1834 | Open in IMG/M |
| 3300028800|Ga0265338_10011230 | All Organisms → cellular organisms → Bacteria | 10377 | Open in IMG/M |
| 3300028800|Ga0265338_10076310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2839 | Open in IMG/M |
| 3300028800|Ga0265338_10111780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S7086C20 | 2198 | Open in IMG/M |
| 3300028800|Ga0265338_11175068 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028866|Ga0302278_10074797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1975 | Open in IMG/M |
| 3300029911|Ga0311361_10054494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6350 | Open in IMG/M |
| 3300029911|Ga0311361_10077528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4958 | Open in IMG/M |
| 3300029911|Ga0311361_10143950 | Not Available | 3155 | Open in IMG/M |
| 3300029911|Ga0311361_10401244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1440 | Open in IMG/M |
| 3300029911|Ga0311361_10969731 | Not Available | 717 | Open in IMG/M |
| 3300029913|Ga0311362_10045668 | All Organisms → cellular organisms → Bacteria | 6769 | Open in IMG/M |
| 3300029913|Ga0311362_10048632 | All Organisms → cellular organisms → Bacteria | 6479 | Open in IMG/M |
| 3300029913|Ga0311362_10070229 | All Organisms → cellular organisms → Bacteria | 4978 | Open in IMG/M |
| 3300029913|Ga0311362_11148601 | Not Available | 585 | Open in IMG/M |
| 3300029914|Ga0311359_11080395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 534 | Open in IMG/M |
| 3300029915|Ga0311358_10174131 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300029915|Ga0311358_10770827 | Not Available | 694 | Open in IMG/M |
| 3300029922|Ga0311363_10000087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 166671 | Open in IMG/M |
| 3300029922|Ga0311363_10765767 | Not Available | 898 | Open in IMG/M |
| 3300029952|Ga0311346_10041860 | All Organisms → cellular organisms → Bacteria | 6761 | Open in IMG/M |
| 3300029952|Ga0311346_10077053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4475 | Open in IMG/M |
| 3300029952|Ga0311346_10140230 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
| 3300029953|Ga0311343_10505837 | Not Available | 1070 | Open in IMG/M |
| 3300029954|Ga0311331_10558546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1097 | Open in IMG/M |
| 3300029954|Ga0311331_10836301 | Not Available | 824 | Open in IMG/M |
| 3300029957|Ga0265324_10018483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2519 | Open in IMG/M |
| 3300029982|Ga0302277_1115291 | Not Available | 1147 | Open in IMG/M |
| 3300029982|Ga0302277_1304238 | Not Available | 582 | Open in IMG/M |
| 3300030041|Ga0302274_10012840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 6215 | Open in IMG/M |
| 3300030506|Ga0302194_10022524 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 3421 | Open in IMG/M |
| 3300030508|Ga0302185_10194656 | Not Available | 693 | Open in IMG/M |
| 3300030508|Ga0302185_10290788 | Not Available | 550 | Open in IMG/M |
| 3300030518|Ga0302275_10173502 | Not Available | 1315 | Open in IMG/M |
| 3300030518|Ga0302275_10487697 | Not Available | 621 | Open in IMG/M |
| 3300030688|Ga0311345_10116790 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
| 3300030688|Ga0311345_10232489 | Not Available | 1824 | Open in IMG/M |
| 3300030688|Ga0311345_10520844 | Not Available | 1014 | Open in IMG/M |
| 3300030688|Ga0311345_10637840 | Not Available | 873 | Open in IMG/M |
| 3300031231|Ga0170824_108807454 | Not Available | 522 | Open in IMG/M |
| 3300031247|Ga0265340_10020598 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3386 | Open in IMG/M |
| 3300031261|Ga0302140_10163789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2078 | Open in IMG/M |
| 3300031524|Ga0302320_10093691 | All Organisms → cellular organisms → Bacteria | 4885 | Open in IMG/M |
| 3300031524|Ga0302320_11209425 | Not Available | 773 | Open in IMG/M |
| 3300031788|Ga0302319_10460240 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1386 | Open in IMG/M |
| 3300031788|Ga0302319_10611130 | Not Available | 1131 | Open in IMG/M |
| 3300031884|Ga0316220_1092325 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1157 | Open in IMG/M |
| 3300032954|Ga0335083_10420919 | Not Available | 1136 | Open in IMG/M |
| 3300033405|Ga0326727_10043908 | All Organisms → cellular organisms → Bacteria | 7304 | Open in IMG/M |
| 3300034282|Ga0370492_0078375 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 33.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 13.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 7.20% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 6.40% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 6.40% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.40% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.40% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.60% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.80% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.80% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.80% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20189J14885_10383381 | 3300001401 | Arctic Peat Soil | MRLLPQPNQSPEPTAVGACSSAIAVHVASRRWLSF |
| Ga0074471_101728353 | 3300005831 | Sediment (Intertidal) | MRDQSPNQSPEPTAVGACRSAIAVHVAGRRWLSFFVS |
| Ga0007882_100196157 | 3300006104 | Freshwater | MKVLANKSPEPTAVGAVSSAVAVHVAGRRWLSFFR* |
| Ga0007882_100709993 | 3300006104 | Freshwater | MTLMPNKSPEPTAVGAVRSAIAVHTAGRRWLSIFR* |
| Ga0075030_1000144012 | 3300006162 | Watersheds | MTMWPNKSPEPTPVGAVSSAVAVRVAGRRWLSFFR* |
| Ga0075522_100062212 | 3300006638 | Arctic Peat Soil | MKHLDYSRMPNKSPEPTAVGAGSSAIAVHVASRRWLSFLR* |
| Ga0075522_100081714 | 3300006638 | Arctic Peat Soil | MAKDYPMMPNKSPEPTAVDAVSSAVAVHAASRRWLSFFR* |
| Ga0075521_104215182 | 3300006642 | Arctic Peat Soil | MMVLVEAMTPNKSPEPTAVGAVSSAVAVHAASRRWLSFLR* |
| Ga0066793_105504771 | 3300009029 | Prmafrost Soil | GSNLENHQMLPNKSPEPTAVSAFRSAIAVHVADAAWLSFLR* |
| Ga0116230_106786672 | 3300009510 | Host-Associated | FADKWNIEAMMPNQSPEPTAVAAAVASHAASRRWLSFFR* |
| Ga0116223_107784311 | 3300009839 | Peatlands Soil | EDDMMPNKSPEPTAVGAVRSAVAVRVASRRWLSLFR* |
| Ga0136449_1000851168 | 3300010379 | Peatlands Soil | MIEAPNKSPEPTAVGACSSAVAVHVMSRRWFNFLRSL* |
| Ga0181517_100064578 | 3300014160 | Bog | MIVNRYTPNKSPEPTAVGAISSAVAVPVASRRWLSFFR* |
| Ga0181529_100295712 | 3300014161 | Bog | MESEVNRKPPNKSPEPTAVGACSSAIAVHVASRRWLSFFR* |
| Ga0181529_106654951 | 3300014161 | Bog | AIEFVPMLPNKSPEPTAVGAVSSAIAVHVTSRRWLSFFR* |
| Ga0181528_101244881 | 3300014167 | Bog | MSQPPNKSPEPTAVGAVSSAIAVHVASRRWLSSPL |
| Ga0181534_100149724 | 3300014168 | Bog | MTVWPNKSPEPTAVGVGSSAVAVRVTSRRWLSFFR* |
| Ga0181534_100240301 | 3300014168 | Bog | MTVMPNKSPEPTAVGAVSSAIAVHVTSRRWLSFFR |
| Ga0181526_104393031 | 3300014200 | Bog | MTMWPNKSPEPTAVGAGRSAVAVHAASRRWLSFFR |
| Ga0181537_107952133 | 3300014201 | Bog | DMDVRPNTSPEPIAVGAGSSAVAVHVASRRWLSFFR* |
| Ga0181537_108838951 | 3300014201 | Bog | MDEWPNKSPEPTAVGAVRSAVAVHVASRRWLSFFR |
| Ga0182014_101990553 | 3300014491 | Bog | DGGGEAMTPNQSPEPTAVGAGSSAIAVHVASRRWLSFFR* |
| Ga0182016_102071881 | 3300014493 | Bog | MTMWPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0182017_109046031 | 3300014494 | Fen | MLMSCDTHTPNKSPEPTAVGACSSAIAVHAASRRWL |
| Ga0182012_100400877 | 3300014499 | Bog | MIRPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR* |
| Ga0182012_103997931 | 3300014499 | Bog | ELDMSLMPNKSPEPTAVGAGSSAIAVHVAGRRWLSFFR* |
| Ga0182024_101271063 | 3300014501 | Permafrost | MTTMSNKSPEPTAVGAVSSAVAVHVTSRRWLSFFR* |
| Ga0181525_102035571 | 3300014654 | Bog | SLSALMFSNKSPEPTAVGAVSSAIAVHVASRRWLSFFR* |
| Ga0181516_1000786911 | 3300014655 | Bog | MMRPNQSPEPTAVGAGRSAVAVHVASRRWLSFFR* |
| Ga0181516_101891941 | 3300014655 | Bog | NQLQKDQMPNKSPEPTAVGAGRSAVAVHVASRRWLSFFR* |
| Ga0181516_102083963 | 3300014655 | Bog | LFMIQVAMPNKALEPTAVGAGRSAIAVHVASRRWLSFFR* |
| Ga0181516_103559341 | 3300014655 | Bog | MIVTRDQQPNKSPEPTAVGAVRSAVAVHVASRRWLS |
| Ga0181522_100318332 | 3300014657 | Bog | MDEWPNKSPEPTAVGAVSSAVAVHVASRRWLSFFR* |
| Ga0182030_100964488 | 3300014838 | Bog | VIMTMLPNKSPEPTAVGAVSSAVAVHVTSRRWLSFFR* |
| Ga0182030_100967083 | 3300014838 | Bog | MIYDQQPNKSPEPTAVIAVSSAIAVHVASRRWLSFFR* |
| Ga0182030_106100701 | 3300014838 | Bog | IMDFTSLMPNKSPEPTAVGAGSSAIAVQAASRRWLSFFR* |
| Ga0182030_108559163 | 3300014838 | Bog | IMDFTSLMPNKSPEPTAVGAVRSAIAVHVASRRWLSFFR* |
| Ga0182027_113710952 | 3300014839 | Fen | SLDLEVLMLMPNKSPEPTAVGAVSSAIAVHVVSRRWLSFFR* |
| Ga0182027_122503081 | 3300014839 | Fen | MDSLPTAATPNKSPEPTAVGAVSSAVAVHVTSRRWLS |
| Ga0181513_11896321 | 3300016700 | Peatland | GKDTQQPNKSPEPTAVGAGRSAVAVHVTSRRWLSFFR |
| Ga0181520_1001658115 | 3300017988 | Bog | MIVNRYTPNKSPEPTAVGAISSAVAVPVASRRWLSFFR |
| Ga0181520_100210078 | 3300017988 | Bog | MFISEAMLPNKTPEPTADGAVSSAIAVHAVSRRWLSFFR |
| Ga0187885_103674471 | 3300018025 | Peatland | MFIHVKTPNKSPEPTAVGAVRSAVAVHVASRRWLSFFR |
| Ga0187851_107360681 | 3300018046 | Peatland | MSQPPNKSPEPTAVGAGRSAVAVHVASRRWLSFFR |
| Ga0194053_103354341 | 3300021520 | Anoxic Zone Freshwater | MTPPKSPELTADDAFSSTVAVHATSRRWLSFLRSA |
| Ga0224534_10017094 | 3300022524 | Soil | MIMKSGPNKSPEPTAVGAGSSAVAVHAASRRWLSFFR |
| Ga0224534_10092496 | 3300022524 | Soil | MIVTFSLPNKSPEPTAVGAVSSAIAVHIASRRWLSFFR |
| Ga0224534_10136175 | 3300022524 | Soil | MSITMPQPNKSPEPTAVGAVSSAVAVHVASRRWLSFFR |
| Ga0224554_100257615 | 3300023068 | Soil | MSSTATPNKSPEPTAVGARRSAVAVHAASRRWLSFFR |
| Ga0224554_10025767 | 3300023068 | Soil | MVLFDEQPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0224555_10301185 | 3300023088 | Soil | MSMTRLAAKSPEPTAVGAVSSAIAVHVASRRWLSCYEMS |
| Ga0224559_10189453 | 3300023091 | Soil | MELDTPNKTLEPTADGAVSSAIAVHATSRRWLSFFR |
| Ga0224559_12928061 | 3300023091 | Soil | MSEILTMWPNKTPEPTADDAVSSAIAVHAASRRWLSFFR |
| Ga0208387_10282783 | 3300025400 | Freshwater | MIVMPRNVEPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0208389_10354273 | 3300025470 | Freshwater | PSDTIMYSTVMPNQSPEPTAVGAVSSAVAVHVVSRRWLSFFR |
| Ga0208191_10444731 | 3300025496 | Peatland | MKKVDQNMPPNKSPEPTAVGACSSAIAVHVTSRRWL |
| Ga0208507_10091236 | 3300025648 | Freshwater | MKVLANKSPEPTAVGAVSSAVAVHVAGRRWLSFFR |
| Ga0208507_10560444 | 3300025648 | Freshwater | RPKLMEHGLVMTKPPNKSPEPTAVGAVSSAIAVHVAGRRWLSFFR |
| Ga0209484_101680621 | 3300025829 | Arctic Peat Soil | LIDMTVLPNKSPEPTAVGAGRSAIAVHAASRRWLSFLR |
| Ga0209483_100225017 | 3300025862 | Arctic Peat Soil | MTMLPNKSPEPTAVGAVSSAIAVHVASRRWLSFLR |
| Ga0209585_1000872710 | 3300025891 | Arctic Peat Soil | KMEDAMTMPNKSPEPTAVGAVRSAIAVNVASRRWLSFFR |
| Ga0209190_11047991 | 3300027736 | Freshwater Lake | KQSQYYYEEQPNQSPEPTAVGAVSSAIAVHVASRRWLSFFR |
| Ga0209517_101864633 | 3300027854 | Peatlands Soil | MMKNQPPNKSPEPTAVGAVNSAVAVHVASRRWLGFL |
| Ga0302267_102073513 | 3300028745 | Bog | IEIYNLMPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0302202_104108322 | 3300028762 | Bog | MVVFEMKPAPNKSPEPTAVGACSSAIAVHVASRRWLSFFR |
| Ga0302266_100514833 | 3300028779 | Bog | MSIEIYNLMPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0265338_1001123013 | 3300028800 | Rhizosphere | MSIEIYNLMPNKSPEPTAVGACSSAIAVHVASRRWLSFFR |
| Ga0265338_100763106 | 3300028800 | Rhizosphere | MIDQPPNQSPEPTAVGAVSSAVAVHVASRRWLSFFR |
| Ga0265338_101117803 | 3300028800 | Rhizosphere | VEIGIDRSNQSPEPTAVGAVSSAVAVHAAGRRWLSFLR |
| Ga0265338_102854423 | 3300028800 | Rhizosphere | FIMDFTSLMPNKSPEPTAVGAVSSAIAVRVASRRWLSFFR |
| Ga0265338_105622392 | 3300028800 | Rhizosphere | MRFYDEHPNTSQEPSAVGAVSSAVAVHLANRGWLGFL |
| Ga0265338_111750683 | 3300028800 | Rhizosphere | AQHFLFGFFMVMFDEQPNKSPEPTGVGAVSSANAVHVAGRRWLSFFR |
| Ga0302278_100747971 | 3300028866 | Bog | MYSQQPNKSPEPTAVGACSSAIAVHVASRRWLSFFR |
| Ga0302200_100037222 | 3300028909 | Bog | MIYQSPNKSPEPTAVGACSSAIAVHAASRRWLSFLR |
| Ga0311361_100544943 | 3300029911 | Bog | MITPRNHEPNQSPEPTAVGACLSAVAVHAASRRRLSFFR |
| Ga0311361_100775287 | 3300029911 | Bog | MILSGRELQPNKSPEPTAVGAVRSAVAVHVASRRWLSFFR |
| Ga0311361_101439501 | 3300029911 | Bog | MNPPPNKSPEPTAVGAVSSAVAVHVASRRWLSFFR |
| Ga0311361_104012443 | 3300029911 | Bog | MIDLWPNKTLEPTADGAVSSAVAVHAASRRWLSFFR |
| Ga0311361_109697311 | 3300029911 | Bog | FIMNFTISWPNKTLEPTADDAVSSAIAVHAASRRWLSFFR |
| Ga0311362_100456688 | 3300029913 | Bog | MRQPPNKTPEPTADGVVSSTIAAHAASRRWLSFFR |
| Ga0311362_100486329 | 3300029913 | Bog | MTMWPNKSPEPTAVGAVSSAIAVRVAGRRWLSFFR |
| Ga0311362_100702297 | 3300029913 | Bog | MSESRVQQPNKSPEPTAVGAVSSAIAAHVASRRWLSFLR |
| Ga0311362_101171802 | 3300029913 | Bog | MSDLLTMQANKSPEPTAVGAVSSAVAVHVARRRWLSFFR |
| Ga0311362_111486011 | 3300029913 | Bog | AMILLPNKTLEPTADGAVSSAVAVHAASRRWLSFCR |
| Ga0311359_110803951 | 3300029914 | Bog | MRLDDQPPNQSPEPTAVGAVSSAVAVHVASRRWLSF |
| Ga0311358_101741314 | 3300029915 | Bog | RHAFATSMIKDRAVLPNKSPEPTGVGAGSSAIAVHAASRRWLSFFR |
| Ga0311358_107708271 | 3300029915 | Bog | MNFTISWPNKTLEPTADGVVSSAIAVHAASRRWLS |
| Ga0311363_100000871 | 3300029922 | Fen | IHFVSQAMTPNKSPEPTPVGAVRSASRFTVFGPAWLSFFR |
| Ga0311363_107657673 | 3300029922 | Fen | MFLIEKMQPNQSPEPTAVGAVRSAVAVHVASRRWLSFF |
| Ga0311346_1004186012 | 3300029952 | Bog | MTLMPNKSPEPTAVGAFCSAVAVRVASRRWLSFFR |
| Ga0311346_100770538 | 3300029952 | Bog | MFLIEKMQPNQSPEPTAVGAVRSAVAVHVASRRWLSFFR |
| Ga0311346_101402303 | 3300029952 | Bog | MKIQANQSPEPTAVGAGRSAVAVHVASRRWLSFFR |
| Ga0311343_105058371 | 3300029953 | Bog | MTTMPNKSPEPTAVGACSSAVAVHAASRRWLSFFR |
| Ga0311331_105585462 | 3300029954 | Bog | NKGMSRLVMPNKSPEPTAVGAVSSAIAVHVAGRRWLSFFR |
| Ga0311331_108363013 | 3300029954 | Bog | MKPQPNQSPEPTAVGAGRSAVAVHVASRRWLSFFR |
| Ga0311331_112868661 | 3300029954 | Bog | LVVTMLPNKSPEPTAVGAGRSAVAAHAVSRRWLSFFR |
| Ga0265324_100184836 | 3300029957 | Rhizosphere | DAETLTGMTIVWPNKSPEPTAVGAVSSAVAVHVTSRLRLSFFR |
| Ga0265324_101462562 | 3300029957 | Rhizosphere | RSRAPSRFMKIAMLPNKSPEPTAVDAGSSAVAVPVKRRRWLSFFR |
| Ga0302277_11152911 | 3300029982 | Bog | MRHEWPNQSPEPTAVGACSSAIAVHVASRRWLSFF |
| Ga0302277_13042382 | 3300029982 | Bog | SGDREMSMTPNKTLEPTADGVVSSAIAVHAASRRWLSYFR |
| Ga0302274_100128409 | 3300030041 | Bog | MSRLVMPNKSPEPTAVGAVSSAIAVHVAGRRWLSFFR |
| Ga0302194_100225246 | 3300030506 | Bog | MTMQPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0302185_101946562 | 3300030508 | Bog | MTVSPNKSPEPTAVGAVSSAVAVHAASRRWLSFFR |
| Ga0302185_102907882 | 3300030508 | Bog | MSLLPNQSPEPTAVGAVSSAIAVHVTSRRWLSFLR |
| Ga0302275_101735021 | 3300030518 | Bog | MILSGRELQPNKSPEPTAVGAVRSAVAVHVASRRWLS |
| Ga0302275_104876972 | 3300030518 | Bog | SLMIDLWPNKTLEPTADGAVSSAVAVHAASRRWLSFFR |
| Ga0311345_101167907 | 3300030688 | Bog | VIMTMLPNKSPEPTAVGACRSAIAVHAASRRWLSF |
| Ga0311345_102324895 | 3300030688 | Bog | FYIIDEWPNKSPEPTAVGAGSSAIAVHAASRRWLSFFR |
| Ga0311345_105208441 | 3300030688 | Bog | FVLLQEVNMMPNKSPEPTAVGAGRSAVAVHIASRRWLSFFR |
| Ga0311345_106378403 | 3300030688 | Bog | MFLIEKMQPNQSPEPTAVGAVRSAVAVHVASRRWLSF |
| Ga0170834_1097422121 | 3300031057 | Forest Soil | MTKQANKSPEPTAVGAVSSAVAVYIASRRWLSFLKNE |
| Ga0170824_1088074541 | 3300031231 | Forest Soil | VMTLLWPNKSPEPTRVGVLGSAFAGNVTGPGWLSFFR |
| Ga0265340_100205989 | 3300031247 | Rhizosphere | MRRFIFVTDDVLPNQSPEPTAVGAVRSAIAVHVGSRRWLSFFR |
| Ga0302140_101637894 | 3300031261 | Bog | SEDNKGMSRLVMPNKSPEPTAVGAVSSAIAVHVAGRRWLSFFR |
| Ga0302320_1009369111 | 3300031524 | Bog | VTMMSNKSPEPTAVGAGSSAVAVRVESRRWLSFFR |
| Ga0302320_112094252 | 3300031524 | Bog | MKMPPNKSPEPTAVGAGSSAVAVHVASRRWLSFFR |
| Ga0302319_104602401 | 3300031788 | Bog | VDMTDPMPNKSPEPTAVGAVSSAIAVHVTSRRWLSFFR |
| Ga0302319_106111303 | 3300031788 | Bog | MDLNFIKWPNQSPEPTAVGACSSAVAVHAASRRWLSFFR |
| Ga0316220_10923251 | 3300031884 | Freshwater | QIVMTMTPNKSPEPTAVGAVRSAVAVHAVSRRWLSFFR |
| Ga0316222_10193404 | 3300032561 | Freshwater | MILDLHTMLPNKSPEPTADSAGSSASRATRFVRLWLSFFR |
| Ga0335083_104209192 | 3300032954 | Soil | GTVTFDICISMTPPNKSPEPTAVGAVSPLSRAAVSGRRWLSFFR |
| Ga0326728_100171137 | 3300033402 | Peat Soil | MKMTPNKSPESTAVGAFRSAIAVQVAVQRGLSFLR |
| Ga0326727_1004390815 | 3300033405 | Peat Soil | MSCIDVLPNKSPEPTAVGAVSSAIAVHVASRRWLSFLR |
| Ga0326727_100749939 | 3300033405 | Peat Soil | MDMTMLPNKSPEPTAVGAVSSAVAVRVTGRRWLSFLR |
| Ga0370492_0078375_1249_1353 | 3300034282 | Untreated Peat Soil | MTVWPNKSPESTAVGAGSSAIAVHVASRRWLSFFR |
| ⦗Top⦘ |