| Basic Information | |
|---|---|
| Family ID | F068187 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ERYEFSFGGLSPGEHTVAVRAYDRFENVGSAKTTFTVPAAKP |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 93.60 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.800 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 59.20 |
| PF00291 | PALP | 14.40 |
| PF03648 | Glyco_hydro_67N | 1.60 |
| PF00135 | COesterase | 0.80 |
| PF07488 | Glyco_hydro_67M | 0.80 |
| PF02401 | LYTB | 0.80 |
| PF04055 | Radical_SAM | 0.80 |
| PF12681 | Glyoxalase_2 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 2.40 |
| COG0761 | 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH | Lipid transport and metabolism [I] | 1.60 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.80 % |
| Unclassified | root | N/A | 3.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105512630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1608 | Open in IMG/M |
| 3300000789|JGI1027J11758_11950173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300001593|JGI12635J15846_10144116 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300002908|JGI25382J43887_10294467 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10441284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300004091|Ga0062387_101689026 | Not Available | 514 | Open in IMG/M |
| 3300004092|Ga0062389_104244971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio oreintalis group → Vibrio orientalis | 539 | Open in IMG/M |
| 3300004633|Ga0066395_10631465 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005174|Ga0066680_10314341 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005555|Ga0066692_10091913 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300005555|Ga0066692_10296360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300005561|Ga0066699_10630439 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005569|Ga0066705_10742827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005586|Ga0066691_10015933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3636 | Open in IMG/M |
| 3300005712|Ga0070764_10661795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 641 | Open in IMG/M |
| 3300006162|Ga0075030_100737095 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006162|Ga0075030_100844382 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006163|Ga0070715_10224711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300006176|Ga0070765_100571780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1065 | Open in IMG/M |
| 3300006176|Ga0070765_100623121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300006176|Ga0070765_100786464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 899 | Open in IMG/M |
| 3300006176|Ga0070765_101508845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300006804|Ga0079221_10037429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2100 | Open in IMG/M |
| 3300006806|Ga0079220_10806216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 711 | Open in IMG/M |
| 3300006903|Ga0075426_11127594 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300007255|Ga0099791_10267596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300007258|Ga0099793_10618584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300009012|Ga0066710_104663378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009038|Ga0099829_10202124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1608 | Open in IMG/M |
| 3300009038|Ga0099829_11160131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300009088|Ga0099830_10204320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1547 | Open in IMG/M |
| 3300009088|Ga0099830_10794281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300009088|Ga0099830_11381369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300009088|Ga0099830_11813228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009089|Ga0099828_11861064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009137|Ga0066709_101673994 | Not Available | 905 | Open in IMG/M |
| 3300009137|Ga0066709_103391368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300010048|Ga0126373_12305572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300010304|Ga0134088_10240954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300010335|Ga0134063_10059372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1684 | Open in IMG/M |
| 3300010358|Ga0126370_10388390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300010360|Ga0126372_10427099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300010360|Ga0126372_12497755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300010376|Ga0126381_102358947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300011269|Ga0137392_10401301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
| 3300011269|Ga0137392_10802756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300011269|Ga0137392_10870546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300011270|Ga0137391_11429576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300011271|Ga0137393_11158959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300011271|Ga0137393_11324004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012096|Ga0137389_10926156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300012096|Ga0137389_11088104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012096|Ga0137389_11741450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012096|Ga0137389_11823538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012205|Ga0137362_11103353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300012210|Ga0137378_10786275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300012361|Ga0137360_11320475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300012361|Ga0137360_11486904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012361|Ga0137360_11513682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300012582|Ga0137358_10501033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300012918|Ga0137396_11171181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012925|Ga0137419_11866572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012930|Ga0137407_11095900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012930|Ga0137407_12160758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300012944|Ga0137410_11883846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012964|Ga0153916_10564846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300012972|Ga0134077_10329808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300015053|Ga0137405_1264794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300015053|Ga0137405_1383651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1496 | Open in IMG/M |
| 3300015054|Ga0137420_1191085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1999 | Open in IMG/M |
| 3300015054|Ga0137420_1312213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300015193|Ga0167668_1075612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300015241|Ga0137418_10098457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2633 | Open in IMG/M |
| 3300015264|Ga0137403_10685273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300017955|Ga0187817_10755848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300018012|Ga0187810_10154254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300018088|Ga0187771_10737679 | Not Available | 835 | Open in IMG/M |
| 3300020199|Ga0179592_10258855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300020580|Ga0210403_10704142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300020582|Ga0210395_10800031 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300021046|Ga0215015_11067339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300021086|Ga0179596_10161576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300021181|Ga0210388_10165863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1924 | Open in IMG/M |
| 3300021181|Ga0210388_10249887 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300021403|Ga0210397_11392334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300021420|Ga0210394_10969821 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300021474|Ga0210390_10532952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300021477|Ga0210398_10933160 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300021478|Ga0210402_11266037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300021559|Ga0210409_10858722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300021559|Ga0210409_11043941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300021559|Ga0210409_11379171 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300022726|Ga0242654_10205268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300024290|Ga0247667_1068882 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300026318|Ga0209471_1111148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300026323|Ga0209472_1191424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 714 | Open in IMG/M |
| 3300026334|Ga0209377_1042503 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300026527|Ga0209059_1338854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300026529|Ga0209806_1263564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027674|Ga0209118_1155736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027729|Ga0209248_10051142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300027846|Ga0209180_10200827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
| 3300027911|Ga0209698_11016349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300028021|Ga0265352_1014826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 534 | Open in IMG/M |
| 3300028780|Ga0302225_10031750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2648 | Open in IMG/M |
| 3300028906|Ga0308309_10268286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300028906|Ga0308309_10637222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300028906|Ga0308309_10755636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300028906|Ga0308309_10850746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300030007|Ga0311338_10037336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6690 | Open in IMG/M |
| 3300030763|Ga0265763_1013137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300030862|Ga0265753_1022495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300030991|Ga0073994_12134361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031231|Ga0170824_107179308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031233|Ga0302307_10105068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1477 | Open in IMG/M |
| 3300031753|Ga0307477_10376777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300031754|Ga0307475_10602769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300031910|Ga0306923_12149002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031947|Ga0310909_10456622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300031962|Ga0307479_10357499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1444 | Open in IMG/M |
| 3300032205|Ga0307472_100245307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300032205|Ga0307472_102516684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300033004|Ga0335084_10069779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3639 | Open in IMG/M |
| 3300033808|Ga0314867_126187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.20% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.40% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.60% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.80% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1055126304 | 3300000364 | Soil | ERYEFTLLTGLSPGEHSIAVRAYDRFENVGSAKTTFTVPKP* |
| JGI1027J11758_119501733 | 3300000789 | Soil | AALAPGEHTIAVRAYDHFQNVGSAKITFQVPPVK* |
| JGI12635J15846_101441161 | 3300001593 | Forest Soil | RYVLGLPALAAGEHTLAVRAYDRFENIGAAKITFTVAAKP* |
| JGI25382J43887_102944671 | 3300002908 | Grasslands Soil | PVEHYNFGFPALSPGEHTIAVRAYDRFENVGSAKTTFTVPAAKP* |
| JGIcombinedJ51221_104412841 | 3300003505 | Forest Soil | EFSTGELGPGEHSIAVRAYDHFDNIGSAKTLLTVPPAKP* |
| Ga0062387_1016890262 | 3300004091 | Bog Forest Soil | GNISDSLEERYEFSLSELSPGEHSIAVRAFDHFDNVGSAKTVVNVPTAKP* |
| Ga0062389_1042449711 | 3300004092 | Bog Forest Soil | GNISDSLEERYEFSLSELSPGEHSIAVRAYDHFDNVGSAKTVVNVPPAKQ* |
| Ga0066395_106314652 | 3300004633 | Tropical Forest Soil | YQSGMPRLSTGEHTIAVRAYDRFQNVGSAKITIQVPAGK* |
| Ga0066680_103143413 | 3300005174 | Soil | DTGISDDSVEHYVFGLPALTPGEHTIAVRAYDHFENVGSAKTVFTVPTPKP* |
| Ga0066692_100919131 | 3300005555 | Soil | VEHYNFGLPPLPPGEHSLAARAYDQFENVGSAKITFVAAASKP* |
| Ga0066692_102963601 | 3300005555 | Soil | ISDDSVEHYVFGLPALTPGEHTIAVRAYDHFENVGSAKTVFTVPTPKP* |
| Ga0066699_106304391 | 3300005561 | Soil | GIAAVSPGEHTLAVRVYDQFENVGSAKLTFTIPKP* |
| Ga0066705_107428271 | 3300005569 | Soil | RLTVGLSPGEHTIAVRAYDRFENVGSGKTTFTVPAAKP* |
| Ga0066691_100159331 | 3300005586 | Soil | ERYEFSFGGLSPGEHTVAVRAYDRFENVGSAKTTFTVPAAKP* |
| Ga0070764_106617951 | 3300005712 | Soil | QSENYEFTLGNIAPGEHTIAVRVYDRFENVGSAKTTMNAPAAKP* |
| Ga0075030_1007370951 | 3300006162 | Watersheds | HYEFGVADLRPGEHTIAVRAYDRFENVGSAKTIAVVPGVR* |
| Ga0075030_1008443821 | 3300006162 | Watersheds | APEEHYQILLERLSAGEHTIAVRVYDKFENVGSAKTTVTVPAAKM* |
| Ga0070715_102247111 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EEHYQITLHNLPLASGEHTIAVRAYDRFENVGSAKTTTNVPTTKP* |
| Ga0070765_1005717801 | 3300006176 | Soil | GAVSDSLEERYEFTLPEALSPGEHSIAVRAYDHFENVGSAKTIVNVPGK* |
| Ga0070765_1006231211 | 3300006176 | Soil | DSLEERYEFSLGELSPGEHTIAVRAYDHFDNVGSAKTVVNVPPAKP* |
| Ga0070765_1007864643 | 3300006176 | Soil | VSDALSENYEFPLANLASGEHTIAVRAYDRFENVGSAKTTFNVAESKP* |
| Ga0070765_1015088451 | 3300006176 | Soil | GSVSDSLEERYEFTPAGEFSHGEHSIAVRAYDHFENVGSAKTVVNIPGGKQ* |
| Ga0079221_100374291 | 3300006804 | Agricultural Soil | EERYEFSVSNSSPGEHTVVVRAYDRFENVGSAKTTVNVPAKP* |
| Ga0079220_108062161 | 3300006806 | Agricultural Soil | IPAVSPGEHTLAFRVYDRFENVGTAKITFNVPASKP* |
| Ga0075426_111275942 | 3300006903 | Populus Rhizosphere | PPLASGEHTIAVRVYDRFQNVGSGKITIQVPAAK* |
| Ga0099791_102675961 | 3300007255 | Vadose Zone Soil | LPSLPPGEHIIAVRAYDRFENVGSAKTTFTVPAAKP* |
| Ga0099793_106185841 | 3300007258 | Vadose Zone Soil | AISDALVEHYNIGLPSLPPGEHTIAVRAYDRFENVGSAKRTFTVPAAKP* |
| Ga0066710_1046633781 | 3300009012 | Grasslands Soil | SLEEHYEFRLTVGLSPGEHTIAVRAYDRFENVGSAKTTFTVPAAKP |
| Ga0099829_102021241 | 3300009038 | Vadose Zone Soil | LPALTPGEHTIAVRAYDRLENVGSAKTIFTVPLAKP* |
| Ga0099829_111601311 | 3300009038 | Vadose Zone Soil | RALSPGEHTVAVRAYDRFDNVGSAKITMTVPAAKP* |
| Ga0099830_102043201 | 3300009088 | Vadose Zone Soil | SGGISDAPEERYEFSLNGLSPGEHTIAVRAYDKFENVGSAKTTVAVPAPKM* |
| Ga0099830_107942812 | 3300009088 | Vadose Zone Soil | GSALGSEHTVAVRAYDRFENVGSAKTTVTVPAAKP* |
| Ga0099830_113813692 | 3300009088 | Vadose Zone Soil | YEISLSGLASGEHTIAVRAYDRFENVGSAKTTFTVPTAKP* |
| Ga0099830_118132282 | 3300009088 | Vadose Zone Soil | YVFGLPALPPGEHTIAVRAYDHFENVGSTKTVFTVPTPKP* |
| Ga0099828_118610641 | 3300009089 | Vadose Zone Soil | ALVEHYDFGLPALTPGEHTIAVRAYDRFENVGSAKTIFTVRPAKL* |
| Ga0066709_1016739942 | 3300009137 | Grasslands Soil | RPLAPGEHTLAVRAYDRFENVGSAKFTFVVAGKP* |
| Ga0066709_1033913682 | 3300009137 | Grasslands Soil | FRLTVGLSPGEHTIAVRAYDRFENVGSGKTTFTVPAAKP* |
| Ga0126373_123055722 | 3300010048 | Tropical Forest Soil | SAISPGEHTLAVRVYDRFENVGTAKITFTVPASKP* |
| Ga0134088_102409542 | 3300010304 | Grasslands Soil | FGFPALAPGEHTIAVRAYDHFENVGSAKTTFTVPAPKP* |
| Ga0134063_100593724 | 3300010335 | Grasslands Soil | GVPALTPGEHTLAVRVYDHFENVGSAKITFTVPASKP* |
| Ga0126370_103883903 | 3300010358 | Tropical Forest Soil | GDGPVEQYHFGLPALSPGEHTLSVRVYDHFENVGAAKITFTVPAPKP* |
| Ga0126372_104270991 | 3300010360 | Tropical Forest Soil | PQLAPGEHTLAVRAYDRFENVGTAKITFVVAGKP* |
| Ga0126372_124977551 | 3300010360 | Tropical Forest Soil | FGIPALSPGEHTLAVRVYDRFENVGSAKVTFVVPRAGGK* |
| Ga0126381_1023589471 | 3300010376 | Tropical Forest Soil | TVEPAPGEHTIVVRVYDRFENVGSGKTTIAVGTSKP* |
| Ga0137392_104013011 | 3300011269 | Vadose Zone Soil | ALVEHYDFGLPALTPGEHTIAGRAYDRFENVGSAKITFTVSATKP* |
| Ga0137392_108027562 | 3300011269 | Vadose Zone Soil | DLAGLSSREHTIAVRAYDHFENVGSAKTTFTVASAKP* |
| Ga0137392_108705462 | 3300011269 | Vadose Zone Soil | FSLPVLGPGEHIIAVRAYDRFENVGSAKTTFTVPLAKP* |
| Ga0137391_114295761 | 3300011270 | Vadose Zone Soil | YEFTLGDLAGLSSREHTIAVRAYDHFENVGSAKTTFTVPSAKP* |
| Ga0137393_111589592 | 3300011271 | Vadose Zone Soil | APEERYEFSLNGLSPGEHTIAVRAYDKFENVGSAKTTVAVPAPKM* |
| Ga0137393_113240041 | 3300011271 | Vadose Zone Soil | GGDWIIVAPTGAISDAPEERYEFSVSLPEGSAPGSEHTIAVRAYDHFENVGSAKTTVKVP |
| Ga0137389_109261561 | 3300012096 | Vadose Zone Soil | HYDFGLPALTPGEHTIAVRAYDRLENVGSAKTIFTVPPAKL* |
| Ga0137389_110881042 | 3300012096 | Vadose Zone Soil | APTGAISDAPEERYEFSVSLPEGSAPGSEHTIAVRAYDHFENVGSAKTTVKVP* |
| Ga0137389_117414501 | 3300012096 | Vadose Zone Soil | ISDAPEERYEFSLSNLGPGEHTIAVRAYDKFENVGSAKTTVSLPAPKT* |
| Ga0137389_118235381 | 3300012096 | Vadose Zone Soil | APEEHYEFTPGVLLPGEHTIAVRAFDRFDNVGSAKTTVAVRESKP* |
| Ga0137362_111033532 | 3300012205 | Vadose Zone Soil | MGLPSLPPGEHIIAVRAYDRFENVGSAKITFTVPAGKP* |
| Ga0137378_107862752 | 3300012210 | Vadose Zone Soil | APDGAISDALVEHYNFGLPPLPPGEHSLAVRAYDQFENVGSAKITFVAAPSKP* |
| Ga0137360_113204752 | 3300012361 | Vadose Zone Soil | EERYDFSLNLGLDPGEHTVAVRAYDHFDNVGSAKTSINVPTAKP* |
| Ga0137360_114869042 | 3300012361 | Vadose Zone Soil | GPPSLPPGDHILAVRAYDRFENVGSAKITFTVPAGRP* |
| Ga0137360_115136821 | 3300012361 | Vadose Zone Soil | ALVEHYNTSLPSRPPGEHTIAVRAYDRFENVGSAKTTFTVPVAKP* |
| Ga0137358_105010331 | 3300012582 | Vadose Zone Soil | IGLPSVPPGEHTIAVRAYDRFENVGSAKTTFTVPAAKP* |
| Ga0137396_111711812 | 3300012918 | Vadose Zone Soil | ALVEHYDFGLPSLTPGEHTIAVRVYDRFENVGSGKTTFTVPAAKP* |
| Ga0137419_118665721 | 3300012925 | Vadose Zone Soil | HYDFGFPALPPGEHTLAVRAYDRFENVGTAKTTFTAPAAKP* |
| Ga0137407_110959002 | 3300012930 | Vadose Zone Soil | ILAAPVGGISDALEEHYEFRLTMELSPGEHTIAARAYDRFENVGSAKTTFIVPKAKP* |
| Ga0137407_121607582 | 3300012930 | Vadose Zone Soil | IAPALTEREHTIAVRAYDRFENVGSAKTSFVVPTGKL* |
| Ga0137410_118838461 | 3300012944 | Vadose Zone Soil | LVEHYNLSLPSLPPGEHTIAVRAYDRFENVGSAKTTFTVPAAKP* |
| Ga0153916_105648461 | 3300012964 | Freshwater Wetlands | HYEFSLSGLGAGEHTIAVRAYDRFENVGSAKITFTVPTTKT* |
| Ga0134077_103298082 | 3300012972 | Grasslands Soil | TVGLSPGEHTIAVRAYDRFENVGSGKTTFTVPAAKP* |
| Ga0137405_12647941 | 3300015053 | Vadose Zone Soil | DWILVAPAGNISDALEERYAFSLAGIAPPGEHTVAVRAYDHFDNVGSAKTTINISGTKP* |
| Ga0137405_13836513 | 3300015053 | Vadose Zone Soil | DALVEHYDIGLPTLPPGEHTIAVRAYDRFENVGSEKTTFTVPASKP* |
| Ga0137420_11910854 | 3300015054 | Vadose Zone Soil | LGLPALAPGEHTIAVRAYDRFENVGSAKITFTVPAAKL* |
| Ga0137420_13122131 | 3300015054 | Vadose Zone Soil | ALVEHYDFGLPSLPSLTPGEHTIAVRVYDRFENVGSGKTTFTVPAAKP* |
| Ga0167668_10756121 | 3300015193 | Glacier Forefield Soil | SISDAPEEKYEFTINDLSAGEHTIAVRAYDHFENVGSAKTTVTVPKSNHH* |
| Ga0137418_100984575 | 3300015241 | Vadose Zone Soil | ERYEIPLSGLGPGEHAISVRAYDRFENVGSAKTIVIVPAAKP* |
| Ga0137403_106852731 | 3300015264 | Vadose Zone Soil | FALPPGEHLIAVRAYDRFENVGSAKVTFTVQAVKP* |
| Ga0187817_107558481 | 3300017955 | Freshwater Sediment | EERYEFTLGTGVAPGEHTISVRAFDRFENVGSAKTTFTVPGAKP |
| Ga0187810_101542543 | 3300018012 | Freshwater Sediment | RYEFLLSNLGPGEHTIAVRAYDKFENVGSAKATVSLPAPKV |
| Ga0187771_107376792 | 3300018088 | Tropical Peatland | EFTLRNLSAGEHTVAVRAYDQFENLTAAEVTFTVPAAKK |
| Ga0179592_102588553 | 3300020199 | Vadose Zone Soil | GLTALPPGEHTIAVRAYDRFENVGSAKITFIVPATKP |
| Ga0210403_107041421 | 3300020580 | Soil | MLSSLALREHTIAVRAFDRFENVGSAKLTFTIPNAKP |
| Ga0210395_108000311 | 3300020582 | Soil | VSDAHEERYQMTLHDLPLASGEHTIAVRAYDRFENVGSAKTTTTIPTSNP |
| Ga0215015_110673393 | 3300021046 | Soil | LVSPTGGISAAPDEHYELSLSNLGPGEHTIAVRAYDKFENVGSAKTTVSLPAPKT |
| Ga0179596_101615763 | 3300021086 | Vadose Zone Soil | PIEKYSFGLPVLTAGEHTIAVRAYDHFENVGSAKTTFSVPAAKP |
| Ga0210388_101658634 | 3300021181 | Soil | SLEERYEFTLPEALSPGEHSIAVRAYDHFENVGSAKTIVNIPGK |
| Ga0210388_102498874 | 3300021181 | Soil | QPLTKLVEHTIAVRAYDRFENVGSAKTVTTIPTTKP |
| Ga0210397_113923341 | 3300021403 | Soil | PAGNISDSLEERYEFSLGELSPGEHTIAVRAYDHFDNVGSAKTVVNVSIAKP |
| Ga0210394_109698211 | 3300021420 | Soil | FEKLTAGEHTIAVRAYDRFENVGSAKITTTVSNSKP |
| Ga0210390_105329522 | 3300021474 | Soil | EDYEFSVTDLRPGEHTIAVRAYDRFENVGSAKTVVTIPSAKP |
| Ga0210398_109331602 | 3300021477 | Soil | ISDAPDEHYEFTLSSLSSGEHTIAVRAYDRFENAGSSKTTINIPARKP |
| Ga0210402_112660372 | 3300021478 | Soil | FSITAGIAPGEHTIAVRAYDHFDNVGSAKTTINIPAAKP |
| Ga0210409_108587221 | 3300021559 | Soil | EEHYEFTISDPSAGEHTIAVRAYDRFENVGSAKTTVTVTSSTRR |
| Ga0210409_110439412 | 3300021559 | Soil | EHYDFGLPALPPGEHTFAVRAYDRFENVGSAKITFTVPNAKP |
| Ga0210409_113791712 | 3300021559 | Soil | IGNVSDALDEKYEFTLSDLAPGEHTIAVRAYDRFENVGSAKIATTTRAARP |
| Ga0242654_102052681 | 3300022726 | Soil | INLPASAPHETEHTIAVRVYDRFENVGSAKTTVKVP |
| Ga0247667_10688821 | 3300024290 | Soil | TSGISDAPDEHYEFTLSNLASGEHTIAVRAYDRFENIGSAKTTVVVPASKP |
| Ga0209471_11111481 | 3300026318 | Soil | TSRISDSPEERYEISLSGLGPGEHTISVRAYDRFENGGSAKTIVTVPAAKP |
| Ga0209472_11914242 | 3300026323 | Soil | EISLSSLGPGEHVISVRAYDRFENVGSAKTIVTVPAAKP |
| Ga0209377_10425031 | 3300026334 | Soil | YNFGLPPLPPGEHSLAARAYDQFENVGSAKITFVAAASKP |
| Ga0209059_13388542 | 3300026527 | Soil | EEHYEFRLTVGLSPGEHTIAVRAYDRFENVGSGKTTFTVPAAKP |
| Ga0209806_12635642 | 3300026529 | Soil | DSLEEHYEFRLTVGLSPGEHTIAVRAYDRFENVGSGKTTFTVPAAKP |
| Ga0209331_10666401 | 3300027603 | Forest Soil | ISDAPTEKYDFTLPDFGPGEHTISVRVFDRFENVGSAKATVRR |
| Ga0209118_11557362 | 3300027674 | Forest Soil | DFSLASLSPGEHTVAVRAYDRFDNVGSGKATITVPAAKP |
| Ga0209248_100511423 | 3300027729 | Bog Forest Soil | RYEFTITEPQPGEHTVAVRAYDRFENVGSAKTTFTVPAGKK |
| Ga0209180_102008271 | 3300027846 | Vadose Zone Soil | EHYDFGLPALTPGEHTIAVRAYDRLENVGSAKTIFTVPPAKL |
| Ga0209698_110163492 | 3300027911 | Watersheds | HYEFGVADLRPGEHTIAVRAYDRFENVGSAKTIAVVPGVR |
| Ga0265352_10148261 | 3300028021 | Soil | DAPSENYEFTLGSLTPGEHTIAVRAYDRFENVGSAKTTFNVVESKP |
| Ga0302225_100317501 | 3300028780 | Palsa | TVEVPRGEHTIAVRAYDHFENLGNAKTTIVVPTAKP |
| Ga0308309_102682863 | 3300028906 | Soil | SDSLEERYEFSLSELSPGEHTIAIRAYDHFDNVGSAKTVVNAPPAKP |
| Ga0308309_106372221 | 3300028906 | Soil | ISDSLEERYEFSLGELSPGEHTIAVRAYDHFDNVGSAKTVVNVPPAKP |
| Ga0308309_107556361 | 3300028906 | Soil | LEERYEFSTGELSPGEHSIAVRAYDHFDNIGSAKTLLTVPPAKP |
| Ga0308309_108507461 | 3300028906 | Soil | LEERYEFTLPEALSPGEHSIAVRAYDHFENVGSAKTIVNVPGK |
| Ga0311338_100373365 | 3300030007 | Palsa | AEHYDFTTAPVTGAREHTIAVRAYDRFDNVGSAKTVLTLPAKP |
| Ga0265763_10131371 | 3300030763 | Soil | PEEYYEFGVTDLRPGEHTIAVRAYDRFENVGGAKTVVTIPSAKP |
| Ga0265753_10224953 | 3300030862 | Soil | YEFTLGSLAPGEHTIAVRAYDRFENVGSAKNTFNVTEAKP |
| Ga0073994_121343612 | 3300030991 | Soil | GISDALVERYEFSLPSLTPGEHTLAVRVYDRFENVGSGKTTFTMPAAKP |
| Ga0170824_1071793082 | 3300031231 | Forest Soil | AGNISDAPEEHYEFTISDQSAGEHTIAARAYDRFENVGSAKTTVTVTSSNHR |
| Ga0302307_101050683 | 3300031233 | Palsa | SHISDAPEERYDFTVSDLRPGEHTIAVRAYDQFDNVGSAKTIAVVPAAKP |
| Ga0307477_103767771 | 3300031753 | Hardwood Forest Soil | YDFGLPALPPGEHTLAVRAYDRFENVGSAKITFTVPNAKP |
| Ga0307475_106027692 | 3300031754 | Hardwood Forest Soil | DALEERYDFSITAGIAPGEHTIAVRAYDHFDNVGSAKTTINISAAKP |
| Ga0306923_121490022 | 3300031910 | Soil | ENYGQILRGLTPGEHTISVRAYDRFENVGAEKTTIHIPTKS |
| Ga0310909_104566223 | 3300031947 | Soil | HGLMPGEHTVAVRAYDRFENVGSGKTTFTVAGTKN |
| Ga0307479_103574991 | 3300031962 | Hardwood Forest Soil | PTGGISDAPEERYEFSLSNLGPGEHTIAVRAYDKFENVGSAKTSVAVPAPKM |
| Ga0307472_1002453071 | 3300032205 | Hardwood Forest Soil | YEFRLTMGLSAGEHTIAVRAFDRFENVGSAKTTFTIPSTKP |
| Ga0307472_1025166842 | 3300032205 | Hardwood Forest Soil | MGLPSLPPGEHIISVRAYDRFENVGSAKITFTVPAGKP |
| Ga0335084_100697794 | 3300033004 | Soil | LPLAAPGEHTIAVRVYDRFQNIGSAKTTIQVATQK |
| Ga0314867_126187_443_589 | 3300033808 | Peatland | LNDALEEKYEITLTNVAPGEHTLAVRAFDRFENAGSAKKVFSVAAAKP |
| ⦗Top⦘ |