NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068172

Metagenome / Metatranscriptome Family F068172

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068172
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 118 residues
Representative Sequence VTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Number of Associated Samples 104
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 96.80 %
% of genes from short scaffolds (< 2000 bps) 96.00 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.200 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.400 % of family members)
Environment Ontology (ENVO) Unclassified
(44.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.71%    β-sheet: 20.59%    Coil/Unstructured: 64.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF01575MaoC_dehydratas 12.80
PF11954DUF3471 3.20
PF03631Virul_fac_BrkB 2.40
PF12833HTH_18 0.80
PF13715CarbopepD_reg_2 0.80
PF07452CHRD 0.80
PF02311AraC_binding 0.80
PF07098DUF1360 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.40


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.20 %
UnclassifiedrootN/A0.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1149010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2486Open in IMG/M
3300000956|JGI10216J12902_103841119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2340Open in IMG/M
3300003267|soilL1_10049852All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300004157|Ga0062590_102197454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300004778|Ga0062383_10366601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium704Open in IMG/M
3300004778|Ga0062383_10425531Not Available657Open in IMG/M
3300004780|Ga0062378_10113853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium682Open in IMG/M
3300005294|Ga0065705_10846459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium583Open in IMG/M
3300005328|Ga0070676_11001874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300005333|Ga0070677_10595093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium612Open in IMG/M
3300005338|Ga0068868_101177468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium708Open in IMG/M
3300005339|Ga0070660_101822664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium518Open in IMG/M
3300005340|Ga0070689_100260044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1434Open in IMG/M
3300005340|Ga0070689_101839864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300005365|Ga0070688_100060863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2386Open in IMG/M
3300005365|Ga0070688_100270719All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300005471|Ga0070698_100211215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1875Open in IMG/M
3300005471|Ga0070698_100430966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1253Open in IMG/M
3300005544|Ga0070686_100249030All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300005546|Ga0070696_101392666All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300005617|Ga0068859_101965381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300005617|Ga0068859_102525302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300005618|Ga0068864_102297950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300005840|Ga0068870_11203499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300006163|Ga0070715_10481588All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium707Open in IMG/M
3300006194|Ga0075427_10015381All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300006358|Ga0068871_101405481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium658Open in IMG/M
3300006844|Ga0075428_100864969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium960Open in IMG/M
3300006969|Ga0075419_11299031All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300009094|Ga0111539_12290826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300009100|Ga0075418_10107235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2967Open in IMG/M
3300009156|Ga0111538_11912359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium746Open in IMG/M
3300009174|Ga0105241_12479727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300009176|Ga0105242_10062197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3072Open in IMG/M
3300009553|Ga0105249_11495074All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium748Open in IMG/M
3300010037|Ga0126304_10919176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300010044|Ga0126310_10442191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium936Open in IMG/M
3300010397|Ga0134124_12045803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300010403|Ga0134123_11949173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium644Open in IMG/M
3300011400|Ga0137312_1057017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium657Open in IMG/M
3300011423|Ga0137436_1168278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300011444|Ga0137463_1378840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300012882|Ga0157304_1022014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium818Open in IMG/M
3300012884|Ga0157300_1020544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium871Open in IMG/M
3300012885|Ga0157287_1012920All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300012885|Ga0157287_1027703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300012885|Ga0157287_1041815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300012892|Ga0157294_10068085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300012895|Ga0157309_10223076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300012896|Ga0157303_10027627All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300012896|Ga0157303_10029401All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium998Open in IMG/M
3300012898|Ga0157293_10120547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium703Open in IMG/M
3300012899|Ga0157299_10174803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300012900|Ga0157292_10103041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium853Open in IMG/M
3300012904|Ga0157282_10233422All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300012905|Ga0157296_10047444All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium996Open in IMG/M
3300012905|Ga0157296_10320026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium550Open in IMG/M
3300012908|Ga0157286_10187519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium688Open in IMG/M
3300012909|Ga0157290_10327261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium574Open in IMG/M
3300012910|Ga0157308_10388267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300012912|Ga0157306_10368709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300012913|Ga0157298_10312171All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium562Open in IMG/M
3300012914|Ga0157297_10185955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium707Open in IMG/M
3300012984|Ga0164309_11286978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium618Open in IMG/M
3300012985|Ga0164308_12278788All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300013306|Ga0163162_13471266All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300013308|Ga0157375_12268678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium647Open in IMG/M
3300014325|Ga0163163_12001496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300014326|Ga0157380_10469403All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300014326|Ga0157380_10768489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium977Open in IMG/M
3300014326|Ga0157380_13331752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300015077|Ga0173483_10222598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium882Open in IMG/M
3300015201|Ga0173478_10401280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium657Open in IMG/M
3300015373|Ga0132257_101808443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium785Open in IMG/M
3300017792|Ga0163161_11950966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300018083|Ga0184628_10296286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300018084|Ga0184629_10527148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300018469|Ga0190270_12724926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300018476|Ga0190274_10609970All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300018476|Ga0190274_12185803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300018476|Ga0190274_12603779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300019269|Ga0184644_1035971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium664Open in IMG/M
3300019362|Ga0173479_10438331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium641Open in IMG/M
3300019362|Ga0173479_10598260All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300019867|Ga0193704_1054933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium773Open in IMG/M
3300019884|Ga0193741_1017675All Organisms → cellular organisms → Bacteria1836Open in IMG/M
3300019884|Ga0193741_1037040All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300020000|Ga0193692_1092083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300020000|Ga0193692_1109477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium573Open in IMG/M
3300022756|Ga0222622_10882410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes655Open in IMG/M
3300022899|Ga0247795_1015853All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300023057|Ga0247797_1038138All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300023062|Ga0247791_1050783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus655Open in IMG/M
3300023070|Ga0247755_1102124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300023071|Ga0247752_1031308All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300023077|Ga0247802_1017016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1000Open in IMG/M
3300025930|Ga0207701_11334831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus587Open in IMG/M
3300025936|Ga0207670_11380493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes598Open in IMG/M
3300025945|Ga0207679_11458956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300025961|Ga0207712_11514358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300025972|Ga0207668_10793915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300025981|Ga0207640_10756755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300026041|Ga0207639_11105419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium743Open in IMG/M
3300026041|Ga0207639_12232604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium509Open in IMG/M
3300026142|Ga0207698_11930313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus605Open in IMG/M
3300027778|Ga0209464_10177868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium754Open in IMG/M
3300027992|Ga0247750_1005564All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300027993|Ga0247749_1012167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium853Open in IMG/M
3300028381|Ga0268264_11848052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus614Open in IMG/M
3300028708|Ga0307295_10166166All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300028802|Ga0307503_10714679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300031538|Ga0310888_10575328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus681Open in IMG/M
3300031547|Ga0310887_10200042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1086Open in IMG/M
3300031847|Ga0310907_10851655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium513Open in IMG/M
3300031854|Ga0310904_10134928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1413Open in IMG/M
3300031854|Ga0310904_10360794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium940Open in IMG/M
3300031908|Ga0310900_11791108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300031944|Ga0310884_10298409All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium897Open in IMG/M
3300032012|Ga0310902_10420020All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300032012|Ga0310902_11063549All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300032075|Ga0310890_10779874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300032075|Ga0310890_11364042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium581Open in IMG/M
3300032179|Ga0310889_10083112All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300032179|Ga0310889_10328573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium744Open in IMG/M
3300032211|Ga0310896_10747292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment3.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.20%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.20%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.40%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.60%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.60%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.80%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_114901013300000881SoilTTVTWMPMTNDWWYATYKTDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRLSTGSDELYHVTVIKNGVSEVTLMNAQGVVYTDMDKGEITKTTLRQE*
JGI10216J12902_10384111953300000956SoilATTVTWMPMTSDWWYATYKNDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDLVITNAINTYGNNLYSITRRLSNGNDEVYHVTFIKNGVSEIALMNSQGVVYTDIK*
soilL1_1004985213300003267Sugarcane Root And Bulk SoilNTTVTWMPNGEDWWYATYKTDNNRITRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEVTLMNGQGVVYTDNKMSSMQH*
Ga0062590_10219745413300004157SoilRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTRNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN*
Ga0062383_1036660123300004778Wetland SedimentTTVTWMPETSDWWYATYKTDNNRIVRVYYNTQPWYMMRGESFSASLPVLNTFVPDEVITNAVNIYGNNLYSITKRLSTGNEESYHVTVIRNGVSEVILMNGHAVVTTNL*
Ga0062383_1042553113300004778Wetland SedimentNDWWYATYKDNNRIVRVYYNTQPWYIMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITQKSSTGNEESFHVTVIKNGISEVILMNRQGVVIVFTDLNKREVSKAKLQLIVNK*
Ga0062378_1011385313300004780Wetland SedimentTVTWMPVTNDWWYATYKDNNRIVRVYYNTQPWYIMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITQKSSTGNEESFHVTVIKNGISEVILMNRQGVVIVFTDLNKREVSKAKLQLIVNK*
Ga0065705_1084645923300005294Switchgrass RhizosphereIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITKRLSTVNEELYHVTVIKNGVSEVILMNRQGVVVYTDLNKGDFAKTSLHLIVN*
Ga0070676_1100187423300005328Miscanthus RhizosphereSYPTVTTATWMPATNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTRNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN*
Ga0070677_1059509313300005333Miscanthus RhizosphereETSYPTATTVTWMPMTSDWWYATYKNDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEIALMNNQGVVYTDIK*
Ga0068868_10117746813300005338Miscanthus RhizosphereNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKPRFQLIVN*
Ga0070660_10182266413300005339Corn RhizosphereSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0070689_10026004413300005340Switchgrass RhizosphereATNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKPRFQLIVN*
Ga0070689_10183986413300005340Switchgrass RhizosphereIKANFQSAYPTTATVTWMPMGQDWWYATYKTDNNRIHRVYYNTEPWHLMRNNGFQASLPVLNTFVPDVVITNAINTYGNNLYSITRRLSNGNEEMYHVTVIKNGVSEITLMNSSGVVYTETQASSMQR*
Ga0070688_10006086313300005365Switchgrass RhizosphereVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITQRLSIGNEEVYHVTVIKNGISEVISMNRQGVVVVYTDLNKGEVTKTKL*
Ga0070688_10027071913300005365Switchgrass RhizosphereQVPVTIKTNFEASYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0070698_10021121543300005471Corn, Switchgrass And Miscanthus RhizosphereIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINSYGNNLYSITQRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVAYRDLNKGEVTKTTLHLIVNK*
Ga0070698_10043096613300005471Corn, Switchgrass And Miscanthus RhizosphereIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGISEVILMNRQGVVVVYTDPNKGEVTKTTLQLIVN*
Ga0070686_10024903013300005544Switchgrass RhizosphereSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0070696_10139266613300005546Corn, Switchgrass And Miscanthus RhizosphereVPTTIRANFQASYPTVTTVTWMPMTNDWWYATYKTDNNRIVRVYYNTQPWYMMRGENFKASLPVLNTYVPDVVITNAINTYGDNLYSITRRVSNGTEDVYHVTIIRNGKSEISLMNSQGVVYTDVNKIQSTQH*
Ga0068859_10196538123300005617Switchgrass RhizosphereIRTNFQASYPTATTVTWMPMTDDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK*
Ga0068859_10252530213300005617Switchgrass RhizosphereVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0068864_10229795013300005618Switchgrass RhizosphereTEFNSSQVPVTIKTNFEASYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0068870_1120349923300005840Miscanthus RhizosphereYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN*
Ga0070715_1048158823300006163Corn, Switchgrass And Miscanthus RhizosphereTTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNDLYSITRRVSNGNDEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0075427_1001538133300006194Populus RhizosphereAITNVVWLPMGTDWWYATYRTDNNRIMKAYYNTEPWHLMRNNGFKASLPVFNTYVPDAVVINAINTFGNNLYSITRRLPNGNEEMYHVTVIKNGVSEIVMMNSQGVVYNDPNKATVTLVSVQQ*
Ga0068871_10140548133300006358Miscanthus RhizospherePVTIKTNFEASYPTATTVTWVPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTNLK*
Ga0075428_10086496923300006844Populus RhizosphereNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITKRLSTVNEELYHVTVIKNGISEVILMNRQGVVVYTDLNKGEFTNTALHLIVN*
Ga0075419_1129903123300006969Populus RhizospherePATNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYGITKRLSTVNEEFYHVTVIKNGVSEVILMNRQGVVVYTDLNKGDFAKTSLHLIVN*
Ga0111539_1229082623300009094Populus RhizosphereWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVVTNAINTYGNNLYSITRRVSNGNDEVYHVTVIKNGVSEIALMNNQGVVYTDVKQQH*
Ga0075418_1010723513300009100Populus RhizosphereNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITKRLSTVNEELYHVTVIKNGISEVILMNRQGVVVYTDLNKGEFTNTALHLIVN*
Ga0111538_1191235923300009156Populus RhizosphereVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNDEVYHVTVIKNGVSEITLMNNQGVVYTDVNQH*
Ga0105241_1247972713300009174Corn RhizosphereQVPTTIRANFQASYPTTTTVTWFPMTHDWWYASYKTDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITKRLSTGNEESYHVTIIRNGVSEVILLNGQGVVVKATLL*
Ga0105242_1006219713300009176Miscanthus RhizosphereMPMTSDWWYATYKTDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEVYHVTVIKNGVSEVVLMNGQGVVTKI*
Ga0105249_1149507423300009553Switchgrass RhizosphereYPSVTTATWMPVTNDWWYATFKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITQRLSTGNEEVYHVTVIKNGISEVILMNRQGVVVVYTDLNKGEVTKPKLQLIVN*
Ga0126304_1091917613300010037Serpentine SoilTTIRENFQASYPTATAVTWMPMNSDWWYATYKTDNNRIVRVYYNTEPWHMMRGGGFKASLPVLNTYVPDLIVTNAINTYGNNLYSITRRMSTGTDELYHVTVIKNGLSEITLMNSQGVVYTDTNKGEITKTPLQ*
Ga0126310_1044219113300010044Serpentine SoilMSNDWWYATYKGDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINSYGNNLYSITRRMSNGNDEVYHVTVIKNGVSEISLMNGQGVVYTDVHKMQ*
Ga0134124_1204580313300010397Terrestrial SoilNYPTVTTATWMPMTNDWWYATYKTDNNRIVRIYYSTQPWYMMRGESFKASLPVLNTYVPDVVISNAINTYGNNLYSITQRLSTGNEEVYHVTVIKNGVSEVVLMNGQGVVTKI*
Ga0134123_1194917313300010403Terrestrial SoilPTVIRANFQASYPTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFNASLPVLNTFVPDQVILNAINSYGNNLYSITQRLSAGNEESYHVTVIKNGLSEVILMNRLGVVVVYTDLNKGEVSKTNLQLIVN*
Ga0137312_105701723300011400SoilMPMTSDWWYATYKSDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVPNGNEEVYHVTVIKNGVSEIALMNSQGVVYTDLK*
Ga0137436_116827813300011423SoilMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDLVITNAINTYGNNLYSITRRVPNGNEEVYHVTLIKNGLSEIALMNAQGVVYTNLK*
Ga0137463_137884013300011444SoilTATVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRMSKGSDEVYHVTVIKNGVSEIALMNSQGVVFTDVNRSSQH*
Ga0157304_102201413300012882SoilKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLIKGEASKINLQLMVN*
Ga0157300_102054433300012884SoilMPVTNDWWYATYKENNRIARVYYNTQPWYMMRGESFKASLPVLNSFVPDQVILNAINTYGNNLYSITQRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVAYTDLNKGEVSKIKLQLIVN
Ga0157287_101292033300012885SoilWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0157287_102770323300012885SoilQVPAVIRANFQANYPTVTTATWMPATNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFLASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKPRFQLIVN*
Ga0157287_104181513300012885SoilATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0157294_1006808513300012892SoilETNYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNCVSEITLMNAQGVVYTDLK*
Ga0157309_1022307613300012895SoilEFDYSSQVPVTIKTNFTASYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEITLMNNQGVVYTDVK*
Ga0157303_1002762713300012896SoilVTWMPMTSDWWYATYKGDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDAVVTNAINTYGNNLYSITRRLSNGNEEVYHVTVIKNGVSEITLMNAQGVVYTNVK*
Ga0157303_1002940113300012896SoilTIKTNFTASYPTASTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVVTNAINAYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEITLMNNQGVVYTDIK*
Ga0157293_1012054723300012898SoilANFQASYPTVTTATWMPATNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNSFVPDQVILNAINTYGNNLYSITQRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLNKGEVSKIKLQLIVN*
Ga0157299_1017480313300012899SoilVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSAGNEESYHVTVIKNGVSEVILMNKQGVVVVYTDLNKNEDTKATLHLIVN*
Ga0157292_1010304123300012900SoilAASYPTATTVTWMPMTSDWWYATYKGDNNRIVRVYYNTQPWYMMRGESFKASLPVFNTYLPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK*
Ga0157282_1023342213300012904SoilQVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0157296_1004744423300012905SoilTYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSAGNEESYHVTVIKNGVSEVILMNKQGVVVVYTDLNKNEDTKATLHLIVN*
Ga0157296_1032002613300012905SoilNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLIKGEASKINLQLMVN*
Ga0157286_1018751913300012908SoilTVTTATWMPVTNDWWYATYKENNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPDQVILNAINSYGNNLYSITQRLSAGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLNKVEVSKINLQLIVN*
Ga0157290_1032726113300012909SoilNFQASYPTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVAYTDLNKGEVSKIKLQLIVN*
Ga0157308_1038826713300012910SoilNYPTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK*
Ga0157306_1036870913300012912SoilPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0157298_1031217113300012913SoilYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0157297_1018595513300012914SoilVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0164309_1128697813300012984SoilEASYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDTK*
Ga0164308_1227878813300012985SoilWYATYKDNNRIVRIYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSIGNEEVYHVTVIKNGISEVISMNRQGVVVYTDLNKREVTKTTLQFIVN*
Ga0163162_1347126623300013306Switchgrass RhizosphereATVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRASNGNDEVYHVTVIRNGVSEIALMNNQGVVFTEVNQSSQH*
Ga0157375_1226867813300013308Miscanthus RhizosphereNPDYSMQVPVTIKTNFQSSYPMATTVTWMPNGQDWWYATYKNDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINAYGNNLYSITRRLSNGKDEVYHVTIIKNGVSEVTLMNSQGVVLR*
Ga0163163_1200149623300014325Switchgrass RhizosphereIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN*
Ga0157380_1046940313300014326Switchgrass RhizosphereTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK*
Ga0157380_1076848913300014326Switchgrass RhizosphereTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLSTFVPDQVILNAINTYGNNLYSITQRLATGNEESYHVTVIKNGISEVILMNRQGVVVYTDLNKGEVSEKKLQLIVN*
Ga0157380_1333175213300014326Switchgrass RhizosphereTNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKTSLPVLNTFVPDQVILNAINAYGNNLYSITQRLSAGNEESYHVTVIKNGLSEVILMNRLGVVVVYTDLNKGEVSKTNLQLIVN*
Ga0173483_1022259823300015077SoilANFQASYPTVTTATWMPATNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK*
Ga0173478_1040128013300015201SoilTTVTWMPMTDDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLIKGEASKINLQLMVN*
Ga0132257_10180844313300015373Arabidopsis RhizosphereTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGKSFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSAGNEESYHVTVIKNGVSEVILMNRLGVVVVYTDLNKGDVNNTKLQLIVN*
Ga0163161_1195096613300017792Switchgrass RhizosphereNPNPDYSMQVPVTIKTNFQTSYPMQTTVAWMPNGQDWWYATYKNDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINAYGNNLYSITRRLSNGNDEVYHVTIIKNGVSEVTLMNSQGVVLR
Ga0184628_1029628613300018083Groundwater SedimentDHSSQVPTVIRTNFQASYPTAITATWMPMTDDWWYATYKTDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK
Ga0184629_1052714813300018084Groundwater SedimentTVIRENFKTNYPTVTTATWMPVTNDWWYATYKDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITKRLSAGNEESYHVTVIKNGVSEVILMNRQGVVVYTDLNKGEVSKTKLQLIVN
Ga0190270_1272492613300018469SoilTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDVVITNAINTYGNNLYSITRRLSNGSDEVYHVTVIKNGVSEIALMNSQGVVYTDVKQH
Ga0190274_1060997013300018476SoilPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0190274_1218580323300018476SoilVPASIRANFTANNPTTATVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINSYGNNLYSITRRVPNGNEEVYHVTVIKNGVSEIALMNSQGVVYTGLK
Ga0190274_1260377923300018476SoilYATYKENNRIVRVYYNTQPWYMMRGESFLASLPVLNTFVPDVVITNAINTYGNDLYSITKKLSTGNEESYHVTVIKNGISEVILMNRLGVVVYTNLNKGEVSETKLQLIVN
Ga0184644_103597123300019269Groundwater SedimentATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0173479_1043833123300019362SoilIKTNFETNYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0173479_1059826013300019362SoilTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLIKGEASKINLQLMVN
Ga0193704_105493323300019867SoilVIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGCQK
Ga0193741_101767553300019884SoilMNSDWWYATYKTDNNRIVRVYYNTEPWHMMRGNGYKTSLPVFNTFVPDLVVTNAINSYGNNLYSITRRNSTNGEESYHVTVIKNGVSEIALMNAQGVVYTDVNKTLPQQ
Ga0193741_103704013300019884SoilWMPMTSDWWYATYKTDNNRIVRVYYNTQPWHMMRGESFKASLPVLNTFVPDLIITNAINTYGNNLYSITKRLSTGTDELYHVTIIKNGVSEITMMNGQGVVYNTTDKSEITKTTLQR
Ga0193692_109208323300020000SoilVPATIRTNFQASYPTATTVTWMPMTDDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPDLVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDMNK
Ga0193692_110947723300020000SoilDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN
Ga0222622_1088241013300022756Groundwater SedimentIRTNFQTSYPTATTVTWMPMTNDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK
Ga0247795_101585333300022899SoilKTNFTASYPTATTVTWMPMSSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVVTNAINTYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEITLMNNQGVVYTDI
Ga0247797_103813813300023057SoilFDYSSQVPVIIKTNFTASYPTASTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVVTNAINTYGNNLYSITRRVSNGNDEVYHVTVIKNGVSEIALMNNQGVVYTDVKQQH
Ga0247791_105078313300023062SoilNTSQVPLTIKTNFETNYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0247755_110212413300023070Plant LitterTTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0247752_103130823300023071SoilYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPAVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0247802_101701613300023077SoilTVTWVPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVITNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0207701_1133483113300025930Corn, Switchgrass And Miscanthus RhizosphereIKTNFQTNYPMATTVTWMPNGQDWWYATYKNDKNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINAYGNNLYSITRRLSNGNDEVYHVTIIKNGVSEVTLMNSQGVVLR
Ga0207670_1138049313300025936Switchgrass RhizosphereIKANFQSAYPTTATVTWMPMGQDWWYATYKTDNNRIHRVYYNTEPWHLMRNNGFQASLPVLNTFVPDVVITNAINTYGNNLYSITRRLSNGNEEMYHVTVIKNGVSEITLMNSSGVVYTETQASSMQR
Ga0207679_1145895623300025945Corn RhizosphereVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSTGNEEAYHVTIIKNGVSEVILMNRQGVVVVYTDLNKGEDNKTRFQLIVN
Ga0207712_1151435813300025961Switchgrass RhizosphereFDYSSQVPASIRANFAANNPTTATVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSKGSEEVYHVTVIKNGMSEIALMNNQGVVFTDVNQSSQH
Ga0207668_1079391523300025972Switchgrass RhizospherePNGQDWWYATYKNDNNRIVRVYYNTQPWYLMRGESFKASLPVLNTYVPDVVITNAINAYGNNLYSITRRLSNGNDEVYHVTIIKNGVSEVTLMNSQGVVLR
Ga0207640_1075675513300025981Corn RhizosphereDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0207639_1110541913300026041Corn RhizospherePTVIRANFQASYPSVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNDLYSITQRLSIGNEEVYHVTVIKNGISEVISMNRQGVVVVYTDLNKGEVTKTKL
Ga0207639_1223260423300026041Corn RhizosphereKTNFETSYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDL
Ga0207698_1193031313300026142Corn RhizosphereNTEFNSSQVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0209464_1017786813300027778Wetland SedimentWWYATYKENNRIVRVYYNTQPWYMMRGENFKASLPVLNTFVPDQVIINAINIYGNDLYSITQRLSTVNEEMYHVTVIKNGISEVKLMNRQGVVIAYTDQNKGEITRTKLQLIVNK
Ga0247750_100556433300027992SoilNYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0247749_101216723300027993SoilIKTNFTTSYPAATTVTWMPMTSDWWYATYKGDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDAVVANAVNTYGNNLYSITRRLPNGNDEMYHVTVIKNGVSEITLMNAQGVVYTSIK
Ga0268264_1184805213300028381Switchgrass RhizosphereVTIKTNFETSYPTATTVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0307295_1016616623300028708SoilVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0307503_1071467913300028802SoilWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0310888_1057532813300031538SoilSIRANFTANYPTSATVTWMPMTSDWWYATYKSDNNRIVRVYYNTQPWYMMRGESFKASLPVLNTYVPDVVITNAINTYGNNLYSITRRLSNGNDEVYHVTVIKNGVSEITLMNNQGVVFTDVK
Ga0310887_1020004233300031547SoilMTDDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLIKGEASKINLQLMVN
Ga0310907_1085165513300031847SoilSQVPTVIRANFQASYPTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVILNAINTYGNNLYSITQRLSAGNEESYHVTVIKNGVSEVILMNRQGVVVVYTDLNKNEDTKAKLHLIVN
Ga0310904_1013492833300031854SoilNSSQVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0310904_1036079413300031854SoilVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0310900_1179110813300031908SoilYNTQPWYMMRGESFKASLPVLNTFVPDQVIINAINIYGNDLYSITKKLSAANEESYHVTVIKNGISEVILMNRQGVVVAYRDLNKGEVKKTTFQLIVNK
Ga0310884_1029840923300031944SoilDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVANAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0310902_1042002023300032012SoilSAQVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDAVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0310902_1106354923300032012SoilNAEFNSSQVPVTIKTNFETSYPTATTVTWMPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVTNAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEIALMNAQGVVYTNLK
Ga0310890_1077987413300032075SoilQVPTVIRENFQASYPTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVIINAINIYGNDLYSITKKLSAANEESYHVTVIKNGISEVILMNRQGVVVAYRDLNKGEVKKTTFQLIVNK
Ga0310890_1136404223300032075SoilENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDKVIINAINTYGNDLYSITKKLSSGNEESYHVTVIKNGISEVILMNRQGVVVAYGNLNKEEVKRTTFQLIVNK
Ga0310889_1008311213300032179SoilPMTSDWWYATYKNENNRIVRVYYNTQPWYMMRGESFKASLPVFNTYVPDVVVANAINTYGNDLYSITRRVSNGNEEVYHVTLIKNGVSEITLMNAQGVVYTDLK
Ga0310889_1032857313300032179SoilTVTTATWMPVTNDWWYATYKENNRIVRVYYNTQPWYMMRGESFKASLPVLNTFVPDQVIINAINIYGNDLYSITKKLSAANEESYHVTVIKNGISEVILMNRQGVVVAYRDLNKGEVKKTTFQLIVNK
Ga0310896_1074729213300032211SoilNDPDHSSQVPTVIRTNFQTSYPTAPTVTWMPMTDDWWYATYKTDNNRIVRVYYSTQPWYMMRGESFKASLPVLNTFVPELVITNAINTYGNNLYSITKRLSTGNEESYHVTVIKNGVSEVIVMNGQAVVVYTDINK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.