| Basic Information | |
|---|---|
| Family ID | F068167 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ASLIAFGLGGLTLLASLFGLTVGRHPEIVHEIIDGTPVTHA |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.80 % |
| % of genes near scaffold ends (potentially truncated) | 97.60 % |
| % of genes from short scaffolds (< 2000 bps) | 79.20 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.800 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 8.70% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 31.20 |
| PF04972 | BON | 14.40 |
| PF01558 | POR | 11.20 |
| PF12900 | Pyridox_ox_2 | 8.00 |
| PF01740 | STAS | 4.00 |
| PF00037 | Fer4 | 2.40 |
| PF01855 | POR_N | 1.60 |
| PF02775 | TPP_enzyme_C | 1.60 |
| PF12838 | Fer4_7 | 0.80 |
| PF02142 | MGS | 0.80 |
| PF17147 | PFOR_II | 0.80 |
| PF13450 | NAD_binding_8 | 0.80 |
| PF16259 | DUF4913 | 0.80 |
| PF13792 | Obsolete Pfam Family | 0.80 |
| PF14691 | Fer4_20 | 0.80 |
| PF08240 | ADH_N | 0.80 |
| PF07992 | Pyr_redox_2 | 0.80 |
| PF13793 | Pribosyltran_N | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 11.20 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 1.60 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 1.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.80 % |
| Unclassified | root | N/A | 19.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10018422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5118 | Open in IMG/M |
| 3300001356|JGI12269J14319_10032779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3415 | Open in IMG/M |
| 3300003219|JGI26341J46601_10002973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5610 | Open in IMG/M |
| 3300004080|Ga0062385_10616925 | Not Available | 688 | Open in IMG/M |
| 3300004474|Ga0068968_1026702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1537 | Open in IMG/M |
| 3300004596|Ga0068949_1005429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1237 | Open in IMG/M |
| 3300004610|Ga0068927_1011149 | Not Available | 764 | Open in IMG/M |
| 3300005332|Ga0066388_100922534 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300005434|Ga0070709_10053263 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300005434|Ga0070709_11704861 | Not Available | 514 | Open in IMG/M |
| 3300005437|Ga0070710_10394126 | Not Available | 926 | Open in IMG/M |
| 3300005439|Ga0070711_100762155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300005467|Ga0070706_101426193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 634 | Open in IMG/M |
| 3300005471|Ga0070698_101078101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 751 | Open in IMG/M |
| 3300005534|Ga0070735_10030787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3729 | Open in IMG/M |
| 3300005598|Ga0066706_10577237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 893 | Open in IMG/M |
| 3300005610|Ga0070763_10573263 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005844|Ga0068862_101508219 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006163|Ga0070715_10579556 | Not Available | 654 | Open in IMG/M |
| 3300006175|Ga0070712_100240699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1441 | Open in IMG/M |
| 3300006755|Ga0079222_10325872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1021 | Open in IMG/M |
| 3300006755|Ga0079222_12609591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 508 | Open in IMG/M |
| 3300006953|Ga0074063_10113360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 665 | Open in IMG/M |
| 3300006954|Ga0079219_10703281 | Not Available | 769 | Open in IMG/M |
| 3300009012|Ga0066710_102934705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 667 | Open in IMG/M |
| 3300009672|Ga0116215_1012554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4083 | Open in IMG/M |
| 3300009700|Ga0116217_10037847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3606 | Open in IMG/M |
| 3300010047|Ga0126382_12093317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 541 | Open in IMG/M |
| 3300010341|Ga0074045_10368149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 935 | Open in IMG/M |
| 3300010343|Ga0074044_10768281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300010359|Ga0126376_10908162 | Not Available | 871 | Open in IMG/M |
| 3300010360|Ga0126372_11378307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 737 | Open in IMG/M |
| 3300010361|Ga0126378_12732588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 564 | Open in IMG/M |
| 3300010376|Ga0126381_102943165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 677 | Open in IMG/M |
| 3300010400|Ga0134122_10733125 | Not Available | 934 | Open in IMG/M |
| 3300011023|Ga0138548_125163 | Not Available | 647 | Open in IMG/M |
| 3300011058|Ga0138541_1104890 | Not Available | 2337 | Open in IMG/M |
| 3300011061|Ga0138534_1043842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 504 | Open in IMG/M |
| 3300011065|Ga0138533_1104217 | Not Available | 888 | Open in IMG/M |
| 3300011079|Ga0138569_1051530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 580 | Open in IMG/M |
| 3300011086|Ga0138564_1210254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 872 | Open in IMG/M |
| 3300012199|Ga0137383_10861555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 661 | Open in IMG/M |
| 3300012201|Ga0137365_10829278 | Not Available | 675 | Open in IMG/M |
| 3300012349|Ga0137387_10389845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1010 | Open in IMG/M |
| 3300012356|Ga0137371_10616314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 833 | Open in IMG/M |
| 3300012363|Ga0137390_10396068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
| 3300013296|Ga0157374_12715830 | Not Available | 523 | Open in IMG/M |
| 3300016294|Ga0182041_11651924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 592 | Open in IMG/M |
| 3300016371|Ga0182034_11341061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 625 | Open in IMG/M |
| 3300017821|Ga0187812_1019222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2361 | Open in IMG/M |
| 3300017821|Ga0187812_1074242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300017822|Ga0187802_10311433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 615 | Open in IMG/M |
| 3300017926|Ga0187807_1052731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1262 | Open in IMG/M |
| 3300017928|Ga0187806_1105091 | Not Available | 904 | Open in IMG/M |
| 3300017928|Ga0187806_1232477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 633 | Open in IMG/M |
| 3300017932|Ga0187814_10191595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 768 | Open in IMG/M |
| 3300017939|Ga0187775_10285879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 645 | Open in IMG/M |
| 3300017943|Ga0187819_10378168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 816 | Open in IMG/M |
| 3300017972|Ga0187781_10457539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 914 | Open in IMG/M |
| 3300017972|Ga0187781_10772229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 697 | Open in IMG/M |
| 3300018046|Ga0187851_10089363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1929 | Open in IMG/M |
| 3300018060|Ga0187765_10674498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 676 | Open in IMG/M |
| 3300019265|Ga0187792_1469203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 516 | Open in IMG/M |
| 3300021171|Ga0210405_10429488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1039 | Open in IMG/M |
| 3300021178|Ga0210408_11136421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 599 | Open in IMG/M |
| 3300021403|Ga0210397_10061707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2432 | Open in IMG/M |
| 3300021404|Ga0210389_10711644 | Not Available | 786 | Open in IMG/M |
| 3300021559|Ga0210409_11323932 | Not Available | 596 | Open in IMG/M |
| 3300022708|Ga0242670_1003005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1396 | Open in IMG/M |
| 3300025898|Ga0207692_10326070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300025898|Ga0207692_10393206 | Not Available | 863 | Open in IMG/M |
| 3300025905|Ga0207685_10062139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300025905|Ga0207685_10496363 | Not Available | 642 | Open in IMG/M |
| 3300025906|Ga0207699_10626326 | Not Available | 785 | Open in IMG/M |
| 3300025915|Ga0207693_10005946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 10126 | Open in IMG/M |
| 3300025916|Ga0207663_10079949 | Not Available | 2136 | Open in IMG/M |
| 3300025916|Ga0207663_10187615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1482 | Open in IMG/M |
| 3300025928|Ga0207700_10912480 | Not Available | 786 | Open in IMG/M |
| 3300025944|Ga0207661_10750381 | Not Available | 898 | Open in IMG/M |
| 3300027497|Ga0208199_1003700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4174 | Open in IMG/M |
| 3300027568|Ga0208042_1004031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4231 | Open in IMG/M |
| 3300027570|Ga0208043_1038655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1440 | Open in IMG/M |
| 3300027604|Ga0208324_1000356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21615 | Open in IMG/M |
| 3300027812|Ga0209656_10001387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15826 | Open in IMG/M |
| 3300027824|Ga0209040_10466607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 570 | Open in IMG/M |
| 3300027905|Ga0209415_10174751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2090 | Open in IMG/M |
| 3300028379|Ga0268266_11326769 | Not Available | 695 | Open in IMG/M |
| 3300030707|Ga0310038_10095651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1562 | Open in IMG/M |
| 3300031469|Ga0170819_14529009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300031544|Ga0318534_10081449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1840 | Open in IMG/M |
| 3300031546|Ga0318538_10052231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2000 | Open in IMG/M |
| 3300031681|Ga0318572_10962172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 507 | Open in IMG/M |
| 3300031682|Ga0318560_10654975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
| 3300031723|Ga0318493_10154617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1189 | Open in IMG/M |
| 3300031747|Ga0318502_10159805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1289 | Open in IMG/M |
| 3300031769|Ga0318526_10169392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 890 | Open in IMG/M |
| 3300031792|Ga0318529_10366580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 671 | Open in IMG/M |
| 3300031793|Ga0318548_10359555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 714 | Open in IMG/M |
| 3300031833|Ga0310917_10181967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1400 | Open in IMG/M |
| 3300031860|Ga0318495_10001814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 7731 | Open in IMG/M |
| 3300031860|Ga0318495_10494787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 534 | Open in IMG/M |
| 3300031897|Ga0318520_10129526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1445 | Open in IMG/M |
| 3300031912|Ga0306921_11581395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 713 | Open in IMG/M |
| 3300031939|Ga0308174_11705378 | Not Available | 541 | Open in IMG/M |
| 3300031954|Ga0306926_12313700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 595 | Open in IMG/M |
| 3300032001|Ga0306922_12357257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 509 | Open in IMG/M |
| 3300032008|Ga0318562_10096677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1672 | Open in IMG/M |
| 3300032010|Ga0318569_10031576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2209 | Open in IMG/M |
| 3300032043|Ga0318556_10334552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 792 | Open in IMG/M |
| 3300032063|Ga0318504_10407679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 648 | Open in IMG/M |
| 3300032089|Ga0318525_10090504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1553 | Open in IMG/M |
| 3300032160|Ga0311301_11078810 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300032261|Ga0306920_100797775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1386 | Open in IMG/M |
| 3300032261|Ga0306920_101424505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 992 | Open in IMG/M |
| 3300032782|Ga0335082_10368818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1301 | Open in IMG/M |
| 3300032828|Ga0335080_10062417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4126 | Open in IMG/M |
| 3300032892|Ga0335081_10178049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2984 | Open in IMG/M |
| 3300032892|Ga0335081_10614857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1337 | Open in IMG/M |
| 3300032893|Ga0335069_10222465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2285 | Open in IMG/M |
| 3300032893|Ga0335069_12196438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300032897|Ga0335071_10117631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2604 | Open in IMG/M |
| 3300032954|Ga0335083_10522147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300033134|Ga0335073_10077590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4349 | Open in IMG/M |
| 3300033134|Ga0335073_10266037 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300033158|Ga0335077_10997307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 835 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.20% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 16.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004596 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 37 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004610 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011023 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011061 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011065 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100184221 | 3300001356 | Peatlands Soil | LITFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS* |
| JGI12269J14319_100327795 | 3300001356 | Peatlands Soil | IAAITAFALGGLALLASLFGLTIGRHPEIVHEIIEGTPVTHA* |
| JGI26341J46601_100029736 | 3300003219 | Bog Forest Soil | AAIVAFALGGLALLASLFALTLGRRPEIVHEIIDGTPVTHV* |
| Ga0062385_106169251 | 3300004080 | Bog Forest Soil | IAAIVSFALGGLALLASLFGLTIGRHPEILHEIIDGTPVTHA* |
| Ga0068968_10267023 | 3300004474 | Peatlands Soil | TYIASLVAFGLAGLAFLVTLGGLTVGEHPEIVHEVIDGTPVTHI* |
| Ga0068949_10054292 | 3300004596 | Peatlands Soil | SLVAFGLAGLAFLVTLGGLTVGEHPEIVHEVIDGTPVTHI* |
| Ga0068927_10111492 | 3300004610 | Peatlands Soil | IAAITAFALGGLALLASLFGLTIGRHPEIVHEIIDGTPVTHA* |
| Ga0066388_1009225343 | 3300005332 | Tropical Forest Soil | LIAFGLGGLTLLASLFGLTLRRHPDIIHEVIDGTPVTHS* |
| Ga0070709_100532631 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SQITYIASLIAFGLGGLTLLASLFGLTIGRHPEILHEVIDGTPVTHE* |
| Ga0070709_117048612 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QITYIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV* |
| Ga0070710_103941261 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TYIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV* |
| Ga0070711_1007621552 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TYIASLIAFALGGLTLLASLFGLTVGRRPAIVHEIIDDTPVTHV* |
| Ga0070706_1014261932 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ASLIAFGLGGLTLLASLFGLTVGRHPEIVHEIIDGTPVTHA* |
| Ga0070698_1010781012 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SLIAFGLGGLTLLASLFGLTVGRHPEIVHEIIDGTPVTHA* |
| Ga0070735_100307871 | 3300005534 | Surface Soil | ITYIASLIAFGLAGLTVLASLAGLTLGKHPEILHEIIDGTPVTHA* |
| Ga0066706_105772372 | 3300005598 | Soil | LGGLTLLASLFGLTVGRHPEIMHEIIDGTPVTHA* |
| Ga0070763_105732631 | 3300005610 | Soil | AFGLAGLAFLAALAGLTLGKNPEIIHEVIDGTPVTHA* |
| Ga0068862_1015082191 | 3300005844 | Switchgrass Rhizosphere | IASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIVDGTPVTHA* |
| Ga0070715_105795561 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAFGLGGLTLLASLFGLTIGRHPEILHEVIDGTPVTHE* |
| Ga0070712_1002406994 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AFGLGGLTLLASLFGLTIGRHPEILHEVIDGTPVTHE* |
| Ga0079222_103258721 | 3300006755 | Agricultural Soil | SLVAFGLGGLTLLASLFSLTIGRHPEILHEVIDGTPVTHE* |
| Ga0079222_126095911 | 3300006755 | Agricultural Soil | AFGLGGLTLIASLFGLTVGRHPEIVHEIIDGTPVTHA* |
| Ga0074063_101133601 | 3300006953 | Soil | YIAALAAFGLGGLTLIASLFGLTVGRRPEIIHEIIDGTPVTHA* |
| Ga0079219_107032811 | 3300006954 | Agricultural Soil | LVAFGLGGLTLLASLFSLTIGRHPEILHEVIDGTPVTHE* |
| Ga0066710_1029347051 | 3300009012 | Grasslands Soil | AAFGLGGLTLLASLFGLTVGRHPDIVHEIIDGTPVTHA |
| Ga0116215_10125541 | 3300009672 | Peatlands Soil | AFALGGLALLASLFGLTIGRHPEIVHEIIEGTPVTHA* |
| Ga0116217_100378471 | 3300009700 | Peatlands Soil | GLAGLAFLVTLGGLTVGEHPEIVHEVIDGTPVTHI* |
| Ga0126382_120933171 | 3300010047 | Tropical Forest Soil | TFIASLIAFGLGGLTLLASLFGLTVGRRPEIIHEIIDGSPVTHT* |
| Ga0074045_103681492 | 3300010341 | Bog Forest Soil | VAFALGGLVLLASLFGLTIGRHPEIVHEIIDGTPVTHA* |
| Ga0074044_107682812 | 3300010343 | Bog Forest Soil | VAFALGGLVLLASLFGLTIGRHPEIVHEIIDGTPVT |
| Ga0126376_109081621 | 3300010359 | Tropical Forest Soil | TYIASLIAFGLGGLTLIASLFGLTVGRRPEIIHEIIDGSPVTHT* |
| Ga0126372_113783072 | 3300010360 | Tropical Forest Soil | AFGLGGLTLLASLFGLTLRRHPDIIHEVIDGTPVTHS* |
| Ga0126378_127325881 | 3300010361 | Tropical Forest Soil | IVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA* |
| Ga0126381_1029431651 | 3300010376 | Tropical Forest Soil | LIAFGLAGLAFLASLASLTLGRNPEIIHEVIDGTPVTHT* |
| Ga0134122_107331251 | 3300010400 | Terrestrial Soil | SLIAFALGGLTLLGSLFGLTVGRRPEIVHEIVYGTPVTHA* |
| Ga0138548_1251632 | 3300011023 | Peatlands Soil | YIAAIVAFALGGLTLLASLFGLTIGRHPEIVHEIIDGTPVTHA* |
| Ga0138541_11048904 | 3300011058 | Peatlands Soil | SQITYIAAITAFALGGLALLASLFGLTIGRHPEIVHEIIEGTPVTHA* |
| Ga0138534_10438422 | 3300011061 | Peatlands Soil | TFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS* |
| Ga0138533_11042173 | 3300011065 | Peatlands Soil | AAITAFALGGLALLASLFGLTIGRHPEIVHEIIDGTPVTHA* |
| Ga0138569_10515301 | 3300011079 | Peatlands Soil | SQIAFIASLITFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS* |
| Ga0138564_12102541 | 3300011086 | Peatlands Soil | IAALIAFGLGGLVLLASLAGLTVGEHPEILHEVIDGTPVTHE* |
| Ga0137383_108615552 | 3300012199 | Vadose Zone Soil | SLIAFGLGGLALLASLFGLTVGRHPEIVHEIIDGTPVTHA* |
| Ga0137365_108292782 | 3300012201 | Vadose Zone Soil | SQITYIASLIAFGLGGLALLASLFGLTVGRHPEIVHEIIDGTPVTHA* |
| Ga0137387_103898452 | 3300012349 | Vadose Zone Soil | FGLGGLTLLASVFGLTIGRRPEIVHEIIDGTPVTHA* |
| Ga0137371_106163142 | 3300012356 | Vadose Zone Soil | SLIAFGLGGLALLASLFGLTIGRHPEIVHEIIDGTPVTHA* |
| Ga0137390_103960683 | 3300012363 | Vadose Zone Soil | LIAFGLGGLTALASLFGLTLRRHPEIVHEIIEGTPVTKA* |
| Ga0157374_127158301 | 3300013296 | Miscanthus Rhizosphere | LGGLTLLGSLFGLTVGRRPEIVHEIVDGTPVTHA* |
| Ga0182041_116519241 | 3300016294 | Soil | GLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0182034_113410611 | 3300016371 | Soil | AFAAGGLGLLASLFGLTLRRNPEILHEVIDGTPVTHA |
| Ga0187812_10192223 | 3300017821 | Freshwater Sediment | AFGLAGLAFLVTLGGLTVGERPEILHEVIDGTPVTHI |
| Ga0187812_10742423 | 3300017821 | Freshwater Sediment | ITFIASLIAFGLAGLAFIATLAGLTLGQHPEIIHEVIDGTPVTHT |
| Ga0187802_103114332 | 3300017822 | Freshwater Sediment | IASLITFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS |
| Ga0187807_10527313 | 3300017926 | Freshwater Sediment | QITFIASLIAFGLAGLTFLASLAGLTLGKNPEIIHEVIDGTPVTHA |
| Ga0187806_11050911 | 3300017928 | Freshwater Sediment | QITFIASLIAFGLAGLAFIATLAGLTLGQHPEIIHEVIDGTPVTHT |
| Ga0187806_12324772 | 3300017928 | Freshwater Sediment | TYIASLVAFGLAGLAFLSSLAALTLGRKPEITHEVIEGTPVTHT |
| Ga0187814_101915952 | 3300017932 | Freshwater Sediment | YIASLIAFGLAGLAFLASLAGLTLGHRPEIIHEVIEGTPVTHT |
| Ga0187775_102858791 | 3300017939 | Tropical Peatland | LIAFGLAGLTFLASLAGLTLGQRPQLMHEIIDGTPVTHT |
| Ga0187819_103781681 | 3300017943 | Freshwater Sediment | SLITFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS |
| Ga0187781_104575392 | 3300017972 | Tropical Peatland | AALIAFGLGGLAFLGSLAGLTLAERPQIIHEIIDGTPVTHS |
| Ga0187781_107722291 | 3300017972 | Tropical Peatland | VSQITFIASIIAFALGGLTLLASLFGLTVSRHPDILHEVIEGTPVTHA |
| Ga0187851_100893633 | 3300018046 | Peatland | SQITYIASLAAFGLGGLTLLASLFGLTVGRRPEIIHEIIDGTPVTHV |
| Ga0187765_106744981 | 3300018060 | Tropical Peatland | LVAFGLGGLTLIASLFGLTVGRRPEILHEIIDGTPVTHA |
| Ga0187792_14692032 | 3300019265 | Peatland | AFGLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0210405_104294881 | 3300021171 | Soil | FGLAGLTFLASLAGLTLGKNPEIIHEVIDVTPVTHT |
| Ga0210408_111364212 | 3300021178 | Soil | IASLIAFGLGGLTLLASLFGLTVGRHPEIVHEIIDGTPVTHT |
| Ga0210397_100617071 | 3300021403 | Soil | FALGGLTLLASLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0210389_107116441 | 3300021404 | Soil | IAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0210409_113239322 | 3300021559 | Soil | VSQITYIASLIAFALGGLTLLAALFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0242670_10030053 | 3300022708 | Soil | SQITYIASLIAFALGGLILLGSLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0207692_103260703 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | YIAALIAFGLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0207692_103932061 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TYIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0207685_100621391 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0207685_104963632 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0207699_106263261 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QITYIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIIDGTPVTHV |
| Ga0207693_100059461 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SLIAFGLGGLTLLASLFGLTIGRHPEILHEVIDGTPVTHE |
| Ga0207663_100799491 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FGLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0207663_101876151 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ITYIASLIAFGLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0207700_109124801 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IASLIAFGLGGLTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0207661_107503811 | 3300025944 | Corn Rhizosphere | QITYIASLIAFALGGLTLLGSLFGLTVGRRPEIVHEIVDGTPVTHA |
| Ga0208199_10037001 | 3300027497 | Peatlands Soil | VAITAFALGGLALLASLFGLTIGRHPEIVHEIIEGTPVTHA |
| Ga0208042_10040311 | 3300027568 | Peatlands Soil | YIAAITAFALGGLALLASLFGLTIGRHPEIVHEIIEGTPVTHA |
| Ga0208043_10386551 | 3300027570 | Peatlands Soil | IASLVAFGLAGLAFLVTLGGLTVGEHPEIVHEVIDGTPVTHI |
| Ga0208324_10003561 | 3300027604 | Peatlands Soil | FGLAGLAVLSSLAALTLGHRPEIIHEVINGTPVTHA |
| Ga0209656_100013877 | 3300027812 | Bog Forest Soil | VAFALGGLVLLASLFGLTIGRHPEIVHEIIDGTPVTHA |
| Ga0209040_104666071 | 3300027824 | Bog Forest Soil | AIVAFALGGLALLASLFALTLGRRPEIVHEIIDGTPVTHV |
| Ga0209415_101747511 | 3300027905 | Peatlands Soil | ITFGLAGLAFLSSLAALTLGRRPEIIHEIIEGTPVTHS |
| Ga0268266_113267691 | 3300028379 | Switchgrass Rhizosphere | PSPTLTTYIASLIAFALGGLTLLASLFGLTAGRRPEIVHEIIDDTPVTHV |
| Ga0310038_100956511 | 3300030707 | Peatlands Soil | GLAGLAFLVTLGGLTVGEHPEIVHEVIDGTPVTHI |
| Ga0170819_145290091 | 3300031469 | Forest Soil | SQITYIASIVSFALGGLVLLASLFGLTIGHRPEILHEIIDGTPVTKV |
| Ga0318534_100814491 | 3300031544 | Soil | SIVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0318538_100522314 | 3300031546 | Soil | GLGGLTLIASLFGLTVGRYPEIVHEIIDGTPVTHA |
| Ga0318572_109621721 | 3300031681 | Soil | QITYIASLAAFGLGGLTLIASLFGLTVGRRPEILHEIIDGTPVTHA |
| Ga0318560_106549751 | 3300031682 | Soil | GLAGLAFLASLAGLTLGQRPEIVHEIIDGTPVTHT |
| Ga0318493_101546171 | 3300031723 | Soil | YIASLVAFGLGGLTLIASLFGLTVERRPEIVHEIIDGTPVTHA |
| Ga0318502_101598051 | 3300031747 | Soil | IVFGLAGLAFLASLAGLTLGQRPEILHEIIDGTPVTHT |
| Ga0318526_101693921 | 3300031769 | Soil | SLIAFGLAGLAFLASLASLTLGRNPEIVHEVIDGTPVTHT |
| Ga0318529_103665802 | 3300031792 | Soil | IVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0318548_103595552 | 3300031793 | Soil | FGLAGLAFLASLASLTLGRNPEIVHEVIDGTPVTHT |
| Ga0310917_101819671 | 3300031833 | Soil | ITFIGSLIAFGLAGLAFLASLASLTLGRNPEIVHEVIDGTPVTHT |
| Ga0318495_1000181411 | 3300031860 | Soil | AQITFIASIVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0318495_104947871 | 3300031860 | Soil | AFGLGGLTLIASLFGLTLGRHPEILHEVIEGTPVTHA |
| Ga0318520_101295263 | 3300031897 | Soil | SLAAFGLGGLTLIASLFGLTVGRRPEILHEIIDGTPVTHA |
| Ga0306921_115813952 | 3300031912 | Soil | TFIASIVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0308174_117053781 | 3300031939 | Soil | IASLAAFGLGALTLLASLFGLTIGRHPEILHEVIEGTPVTHE |
| Ga0306926_123137001 | 3300031954 | Soil | IAFGLAGLAFLASLAGLTLGQRPEIVHEIIDGTPVTHT |
| Ga0306922_123572572 | 3300032001 | Soil | IVAFAAGGLGLLGTLFGLTLARRPEILHEVIEGTPVTHA |
| Ga0318562_100966771 | 3300032008 | Soil | VAQITFIASIVAFGLGGLTLIASLFGLTLGRHPEILHEVIEGTPVTHA |
| Ga0318569_100315761 | 3300032010 | Soil | VSQITYIAALIAFGLGGLTLIASLFGLTVGRYPEIVHEIIDGTPVTHA |
| Ga0318556_103345521 | 3300032043 | Soil | QITFIASIVAFGLGGLTLIASLFGLTLGRHPEILHEVIEGTPVTHA |
| Ga0318504_104076791 | 3300032063 | Soil | IAALIAFGLGGLTLIASLFGLTVGRYPEIVHEIIDGTPVTHA |
| Ga0318525_100905044 | 3300032089 | Soil | FIASIVAFGLGGLTLIATLFGLTLGRNPEIVHEIIDGTPVTHA |
| Ga0311301_110788101 | 3300032160 | Peatlands Soil | ALGGLALLASLFGLTIGRHPEIVHEIIDGTPVTHA |
| Ga0306920_1007977753 | 3300032261 | Soil | ITFIASIVAFGLGGLTLIASLFGLTLGRHPEILHEVIEGTPVTHA |
| Ga0306920_1014245051 | 3300032261 | Soil | ITFISSLAAFGLGGLTLIASLFGLTVGRRPEILHEIIDGTPVTHA |
| Ga0335082_103688181 | 3300032782 | Soil | QITFIASLIAFGLGGLTLIASLFGLTLGRHPEIVHEIIDGTPVTHA |
| Ga0335080_100624171 | 3300032828 | Soil | VAFAAGGLGLLASLFGLTLSRHPEILHEIIEGTPVTHS |
| Ga0335081_101780493 | 3300032892 | Soil | SQITFIASLIAFGLAGLTFLATLAGLTLGRNPEIIHEVIEGTPVTHS |
| Ga0335081_106148573 | 3300032892 | Soil | FGLGGLTLIASLFGLTVGRHPEILHEIIDGTPVTHA |
| Ga0335069_102224654 | 3300032893 | Soil | TYIAALIAFGLGGLTLIASLFGLTVERRPEIVHEIIEGTPVTHV |
| Ga0335069_121964381 | 3300032893 | Soil | IAFIAAIAAFAAGGLGLLGSLFGLTLGRHPEFLHEVIEGTPVTHA |
| Ga0335071_101176314 | 3300032897 | Soil | SQITFIAAIVAFAAGGLGLLGSLFGLTLGRHPEFLHEVIEGTPVTHA |
| Ga0335083_105221473 | 3300032954 | Soil | TFIASIVAFAAGGLGLLGTLFGLTLGRHPEFLHEVIEGTPVTHA |
| Ga0335073_100775901 | 3300033134 | Soil | ITYIASLVAFGLGGLTLLASLFGLTIGRHPEIVHEVIDGTPVTHL |
| Ga0335073_102660371 | 3300033134 | Soil | LIAFGLGGLTLIASLFGLTVGRRPEIVHEIIDGTPVTHA |
| Ga0335077_109973071 | 3300033158 | Soil | TYIAALAAFGLGGLTLIASLFGLTVGRRPEILHEIIDGTPVTHA |
| ⦗Top⦘ |