| Basic Information | |
|---|---|
| Family ID | F068133 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MQLAIDVFTDMMTSKEIYIIIGGAIIMWIALERMDR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 76.80 % |
| % of genes near scaffold ends (potentially truncated) | 26.40 % |
| % of genes from short scaffolds (< 2000 bps) | 88.80 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (57.600 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean (34.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF07750 | GcrA | 1.60 |
| PF06067 | DUF932 | 0.80 |
| PF14216 | DUF4326 | 0.80 |
| PF00534 | Glycos_transf_1 | 0.80 |
| PF13443 | HTH_26 | 0.80 |
| PF12651 | RHH_3 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 1.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.40 % |
| Unclassified | root | N/A | 17.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10071917 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1241 | Open in IMG/M |
| 3300001450|JGI24006J15134_10223405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 558 | Open in IMG/M |
| 3300002231|KVRMV2_100349360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1728 | Open in IMG/M |
| 3300002231|KVRMV2_101960792 | All Organisms → Viruses → environmental samples → uncultured marine virus | 525 | Open in IMG/M |
| 3300002242|KVWGV2_10349177 | All Organisms → Viruses | 1736 | Open in IMG/M |
| 3300002242|KVWGV2_10751562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1300 | Open in IMG/M |
| 3300005551|Ga0066843_10055190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1186 | Open in IMG/M |
| 3300006164|Ga0075441_10140469 | All Organisms → Viruses → environmental samples → uncultured marine virus | 913 | Open in IMG/M |
| 3300006164|Ga0075441_10360480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 528 | Open in IMG/M |
| 3300006306|Ga0068469_1082810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 906 | Open in IMG/M |
| 3300006310|Ga0068471_1189457 | All Organisms → Viruses | 3478 | Open in IMG/M |
| 3300006310|Ga0068471_1199697 | Not Available | 1229 | Open in IMG/M |
| 3300006310|Ga0068471_1492514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 959 | Open in IMG/M |
| 3300006310|Ga0068471_1609504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2021 | Open in IMG/M |
| 3300006310|Ga0068471_1609505 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 856 | Open in IMG/M |
| 3300006311|Ga0068478_1250447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 774 | Open in IMG/M |
| 3300006325|Ga0068501_1288059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 703 | Open in IMG/M |
| 3300006326|Ga0068477_1144747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 702 | Open in IMG/M |
| 3300006336|Ga0068502_1186376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 904 | Open in IMG/M |
| 3300006336|Ga0068502_1240892 | All Organisms → Viruses | 2684 | Open in IMG/M |
| 3300006336|Ga0068502_1872563 | Not Available | 533 | Open in IMG/M |
| 3300006340|Ga0068503_10240872 | Not Available | 1236 | Open in IMG/M |
| 3300006340|Ga0068503_10486359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 750 | Open in IMG/M |
| 3300006340|Ga0068503_10495609 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1021 | Open in IMG/M |
| 3300006738|Ga0098035_1118565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 913 | Open in IMG/M |
| 3300006752|Ga0098048_1154933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 682 | Open in IMG/M |
| 3300006926|Ga0098057_1013310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2108 | Open in IMG/M |
| 3300006929|Ga0098036_1230374 | All Organisms → Viruses → environmental samples → uncultured marine virus | 561 | Open in IMG/M |
| 3300008216|Ga0114898_1021514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2238 | Open in IMG/M |
| 3300008216|Ga0114898_1103379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 850 | Open in IMG/M |
| 3300008216|Ga0114898_1214318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 529 | Open in IMG/M |
| 3300008217|Ga0114899_1106681 | Not Available | 939 | Open in IMG/M |
| 3300008217|Ga0114899_1109447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 924 | Open in IMG/M |
| 3300008217|Ga0114899_1156819 | Not Available | 738 | Open in IMG/M |
| 3300008217|Ga0114899_1190793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 653 | Open in IMG/M |
| 3300008218|Ga0114904_1032761 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1436 | Open in IMG/M |
| 3300008218|Ga0114904_1033357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1419 | Open in IMG/M |
| 3300008218|Ga0114904_1147608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 553 | Open in IMG/M |
| 3300008219|Ga0114905_1061341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1361 | Open in IMG/M |
| 3300008220|Ga0114910_1037456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1605 | Open in IMG/M |
| 3300008220|Ga0114910_1111736 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 806 | Open in IMG/M |
| 3300009173|Ga0114996_10056461 | All Organisms → Viruses → Predicted Viral | 3507 | Open in IMG/M |
| 3300009173|Ga0114996_10311675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1228 | Open in IMG/M |
| 3300009412|Ga0114903_1018540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1827 | Open in IMG/M |
| 3300009413|Ga0114902_1048653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1238 | Open in IMG/M |
| 3300009413|Ga0114902_1065044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1023 | Open in IMG/M |
| 3300009414|Ga0114909_1016456 | All Organisms → Viruses → Predicted Viral | 2497 | Open in IMG/M |
| 3300009418|Ga0114908_1059882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1343 | Open in IMG/M |
| 3300009418|Ga0114908_1249448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 538 | Open in IMG/M |
| 3300009425|Ga0114997_10397141 | Not Available | 746 | Open in IMG/M |
| 3300009481|Ga0114932_10772702 | Not Available | 557 | Open in IMG/M |
| 3300009481|Ga0114932_10917278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 504 | Open in IMG/M |
| 3300009602|Ga0114900_1175687 | Not Available | 538 | Open in IMG/M |
| 3300009603|Ga0114911_1163054 | Not Available | 621 | Open in IMG/M |
| 3300009604|Ga0114901_1021072 | All Organisms → Viruses → Predicted Viral | 2532 | Open in IMG/M |
| 3300009605|Ga0114906_1060727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1418 | Open in IMG/M |
| 3300009619|Ga0105236_1041049 | All Organisms → Viruses → environmental samples → uncultured marine virus | 596 | Open in IMG/M |
| 3300009706|Ga0115002_10240627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1388 | Open in IMG/M |
| 3300009706|Ga0115002_10518501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 864 | Open in IMG/M |
| 3300009706|Ga0115002_10720917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 702 | Open in IMG/M |
| 3300009786|Ga0114999_11018024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 599 | Open in IMG/M |
| 3300010151|Ga0098061_1137953 | Not Available | 890 | Open in IMG/M |
| 3300010153|Ga0098059_1090425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1218 | Open in IMG/M |
| 3300010883|Ga0133547_11777518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1141 | Open in IMG/M |
| 3300012950|Ga0163108_10234369 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1178 | Open in IMG/M |
| 3300017713|Ga0181391_1114582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 606 | Open in IMG/M |
| 3300017742|Ga0181399_1157382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 544 | Open in IMG/M |
| 3300017757|Ga0181420_1031053 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300017763|Ga0181410_1205569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 538 | Open in IMG/M |
| 3300017773|Ga0181386_1192283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 615 | Open in IMG/M |
| 3300017775|Ga0181432_1105638 | Not Available | 842 | Open in IMG/M |
| 3300017775|Ga0181432_1279519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 528 | Open in IMG/M |
| 3300020399|Ga0211623_10350014 | All Organisms → Viruses → environmental samples → uncultured marine virus | 527 | Open in IMG/M |
| 3300021442|Ga0206685_10023000 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1983 | Open in IMG/M |
| 3300021978|Ga0232646_1149749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 787 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10275286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 614 | Open in IMG/M |
| 3300025029|Ga0207900_104896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1222 | Open in IMG/M |
| 3300025045|Ga0207901_1013963 | Not Available | 1114 | Open in IMG/M |
| 3300025045|Ga0207901_1030674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 729 | Open in IMG/M |
| 3300025046|Ga0207902_1051764 | Not Available | 514 | Open in IMG/M |
| 3300025049|Ga0207898_1012607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1049 | Open in IMG/M |
| 3300025052|Ga0207906_1029749 | Not Available | 752 | Open in IMG/M |
| 3300025069|Ga0207887_1066734 | All Organisms → Viruses → environmental samples → uncultured marine virus | 588 | Open in IMG/M |
| 3300025078|Ga0208668_1014225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1678 | Open in IMG/M |
| 3300025114|Ga0208433_1058528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1009 | Open in IMG/M |
| 3300025133|Ga0208299_1180683 | Not Available | 639 | Open in IMG/M |
| 3300025168|Ga0209337_1083686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1536 | Open in IMG/M |
| 3300025168|Ga0209337_1247480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 685 | Open in IMG/M |
| 3300025247|Ga0207880_1058032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 561 | Open in IMG/M |
| 3300025251|Ga0208182_1015335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2004 | Open in IMG/M |
| 3300025251|Ga0208182_1045433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 932 | Open in IMG/M |
| 3300025257|Ga0207899_1042024 | All Organisms → Viruses → environmental samples → uncultured marine virus | 750 | Open in IMG/M |
| 3300025260|Ga0207895_1041934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 768 | Open in IMG/M |
| 3300025270|Ga0208813_1075654 | All Organisms → Viruses → environmental samples → uncultured marine virus | 702 | Open in IMG/M |
| 3300025274|Ga0208183_1027565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1240 | Open in IMG/M |
| 3300025274|Ga0208183_1039249 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 985 | Open in IMG/M |
| 3300025277|Ga0208180_1003826 | All Organisms → Viruses | 6069 | Open in IMG/M |
| 3300025280|Ga0208449_1054070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1065 | Open in IMG/M |
| 3300025280|Ga0208449_1093400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 721 | Open in IMG/M |
| 3300025286|Ga0208315_1019271 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 2159 | Open in IMG/M |
| 3300025286|Ga0208315_1065075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 929 | Open in IMG/M |
| 3300025286|Ga0208315_1070042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 883 | Open in IMG/M |
| 3300025296|Ga0208316_1021524 | Not Available | 1643 | Open in IMG/M |
| 3300025300|Ga0208181_1108470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 528 | Open in IMG/M |
| 3300025301|Ga0208450_1077763 | Not Available | 758 | Open in IMG/M |
| 3300025305|Ga0208684_1019927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 2128 | Open in IMG/M |
| 3300025305|Ga0208684_1044743 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300025305|Ga0208684_1080787 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 837 | Open in IMG/M |
| 3300025508|Ga0208148_1128418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 515 | Open in IMG/M |
| 3300025873|Ga0209757_10265946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 545 | Open in IMG/M |
| 3300026103|Ga0208451_1050102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 523 | Open in IMG/M |
| 3300027779|Ga0209709_10301098 | Not Available | 682 | Open in IMG/M |
| 3300027838|Ga0209089_10058824 | Not Available | 2456 | Open in IMG/M |
| 3300027844|Ga0209501_10662997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 569 | Open in IMG/M |
| 3300027847|Ga0209402_10015804 | Not Available | 5959 | Open in IMG/M |
| 3300027847|Ga0209402_10211142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1260 | Open in IMG/M |
| 3300028489|Ga0257112_10054262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1486 | Open in IMG/M |
| 3300030729|Ga0308131_1012611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 1694 | Open in IMG/M |
| 3300031801|Ga0310121_10182424 | All Organisms → Viruses | 1288 | Open in IMG/M |
| 3300032032|Ga0315327_10635292 | Not Available | 657 | Open in IMG/M |
| 3300032127|Ga0315305_1218540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 507 | Open in IMG/M |
| 3300032278|Ga0310345_11391987 | Not Available | 686 | Open in IMG/M |
| 3300032360|Ga0315334_10576245 | All Organisms → Viruses → environmental samples → uncultured marine virus | 969 | Open in IMG/M |
| 3300032820|Ga0310342_100487008 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1371 | Open in IMG/M |
| 3300032820|Ga0310342_101437038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255 | 820 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 34.40% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 12.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.60% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.20% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.40% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.40% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.40% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.60% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.60% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.80% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.80% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.80% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.80% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006306 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006311 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006326 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0770m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021978 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmer | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300025029 | Marine viral communities from the Pacific Ocean - LP-39 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025247 | Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025257 | Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes) | Environmental | Open in IMG/M |
| 3300025260 | Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300030729 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032127 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100719173 | 3300000115 | Marine | MQLAIDVFIDMFKSKEIYVIIGSAIVVWIILEWNDV* |
| JGI24006J15134_102234053 | 3300001450 | Marine | MMQLTIDVFIDMFKSKEIYIIIGGAIIMWILLERMDV* |
| KVRMV2_1003493606 | 3300002231 | Marine Sediment | MQLAIDVFIDMFKSKEIYVIMGTAIIAFIILEWNDV* |
| KVRMV2_1019607921 | 3300002231 | Marine Sediment | YMQLAIDVFIDMFKSKEIYIIIGSIIIMWIVLEYMDR* |
| KVWGV2_103491779 | 3300002242 | Marine Sediment | MEPTIIQLAIDVFIDMFKSKEIYIIIGSAIVLWIILERMDR* |
| KVWGV2_107515622 | 3300002242 | Marine Sediment | MQLAIDVFIDMFKSKEIYIIIGGAIIMWIFLERMD* |
| Ga0066843_100551905 | 3300005551 | Marine | TMQLAIDVFTDIMTSKEIYIIIGVCIIMWIALEWMDRNV* |
| Ga0075441_101404691 | 3300006164 | Marine | MQLAIDVFTDMMTSKEIYIIIGATVIMWIALERMDR* |
| Ga0075441_103604801 | 3300006164 | Marine | MQLAIDVFTDMMTNKEIYIIIGACIIMWIALERMD |
| Ga0068469_10828102 | 3300006306 | Marine | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIALEWMDKDV* |
| Ga0068471_11894574 | 3300006310 | Marine | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIFLERMDK* |
| Ga0068471_11996975 | 3300006310 | Marine | MQLAIDVFIDMMTSKEIYIIIGGAIIMWLYLEWGENK* |
| Ga0068471_14925144 | 3300006310 | Marine | MQLAIDVFTDMMTSKEIYIIIGGAVIMWIALERMDR* |
| Ga0068471_16095046 | 3300006310 | Marine | MQLAIDVFTDMMTSKEIYIIIGGCIIMWIALEWMDKNV* |
| Ga0068471_16095053 | 3300006310 | Marine | MQLAIDIFTDMMTSKEIYIIIGVCIIMWIAMEWMDR* |
| Ga0068478_12504472 | 3300006311 | Marine | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIALEWMDKSV* |
| Ga0068501_12880592 | 3300006325 | Marine | MQLAIDVFTDKMTSKEIYIIIGAAVIMWIALEWMDKDV* |
| Ga0068477_11447472 | 3300006326 | Marine | REESIMQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDKNV* |
| Ga0068502_11863765 | 3300006336 | Marine | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIALERMDR* |
| Ga0068502_12408921 | 3300006336 | Marine | MQLAIDVFTDMMTNKEIYIIIGGAVIMWITLERMDR* |
| Ga0068502_18725632 | 3300006336 | Marine | MQLAIDVFIDMMTSKEIYIIIGGAIIMWLYLEWKKNNGR* |
| Ga0068503_102408723 | 3300006340 | Marine | MQLAIDVFIDMITSKEIYIIIGGAVIMWLYLEWKETN |
| Ga0068503_104863592 | 3300006340 | Marine | MQLAIDVFTDMMTNKEIYIIIGACIIMWIALEWMDKDV* |
| Ga0068503_104956092 | 3300006340 | Marine | MQLAIDVFTDMMTSKEIYIIIGGCIILWIALERMDR* |
| Ga0098035_11185652 | 3300006738 | Marine | MQLAIDVFTDMMTSKEIYIIIGGCIIMWIALERMDR* |
| Ga0098048_11549331 | 3300006752 | Marine | NSEGYMMQLTIDVFIDMFKSKEIYIIIGGAIIMWILLERMDV* |
| Ga0098057_10133106 | 3300006926 | Marine | MQLAIDVFIDMITSKEIYIIIGACIILWVILERSENK* |
| Ga0098036_12303741 | 3300006929 | Marine | MQLAIDVFIDMFKSKEIYIIIGSIIIMWIVLEYMDR* |
| Ga0114898_10215142 | 3300008216 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALEWMDR* |
| Ga0114898_11033793 | 3300008216 | Deep Ocean | MQLAIDVFTDMITSKEIYIIIGACIIMWIALEWMDRNV* |
| Ga0114898_12143181 | 3300008216 | Deep Ocean | QLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDK* |
| Ga0114899_11066813 | 3300008217 | Deep Ocean | MKYGKRSLMQLAIDVFTDMITSKEIYIIIGAAVIMWIALEWMDR* |
| Ga0114899_11094471 | 3300008217 | Deep Ocean | IEKMQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDR* |
| Ga0114899_11568193 | 3300008217 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGGAIIMWIALERMDR* |
| Ga0114899_11907931 | 3300008217 | Deep Ocean | MQLAIDVFIDMMTSKEIYIIIGACIIMWIALERMDR |
| Ga0114904_10327614 | 3300008218 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGSCIIMWIILEWNDV* |
| Ga0114904_10333571 | 3300008218 | Deep Ocean | MQLAIDVLTDMMTSKEIYIIIGVCIIMWIALEWMDR* |
| Ga0114904_11476081 | 3300008218 | Deep Ocean | MQLAIDVFTDMMTNKEIYIIIGACIIMWIALEWMDR* |
| Ga0114905_10613415 | 3300008219 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGSCIIMWIILERMDV* |
| Ga0114910_10374562 | 3300008220 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIAMEWMDR* |
| Ga0114910_11117363 | 3300008220 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGSCIIMWIILERMDV* |
| Ga0114996_100564615 | 3300009173 | Marine | MMQLAIDVFIDMVTSKEIYIIIGVAIIMWLCLEWGENK* |
| Ga0114996_103116755 | 3300009173 | Marine | MQLAIDVFIDMFKSKEIYVIIGGAIIMWIALERMDR*LKKQV |
| Ga0114903_10185401 | 3300009412 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDK* |
| Ga0114902_10486534 | 3300009413 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDR* |
| Ga0114902_10650444 | 3300009413 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGVCIIMWIALEWMDR* |
| Ga0114909_10164563 | 3300009414 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGSCIIMWIILERMDK* |
| Ga0114908_10598823 | 3300009418 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGGAIIMWIAMEWMDR* |
| Ga0114908_12494481 | 3300009418 | Deep Ocean | GDTMQLAIDVLTDMMTSKEIYIIIGVCIIMWIALERMDR* |
| Ga0114997_103971414 | 3300009425 | Marine | MMQLAIDVFIDMVTSKEIYIIIGVAIIMWLCLEWGENNGK* |
| Ga0114932_107727022 | 3300009481 | Deep Subsurface | MQLAIDVFIDMMTSKEIYIIIGGAIIMWLCLEWGENK* |
| Ga0114932_109172781 | 3300009481 | Deep Subsurface | MGGKIMEPTIIQLAIDVFIDMFKSKEIYIIIGSAIVLWIILERMDR* |
| Ga0114900_11756872 | 3300009602 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGGAIIMWIALERMDK* |
| Ga0114911_11630543 | 3300009603 | Deep Ocean | MKYGKRSLMQLAIDVFTDMMTSKEIYIIIGGAIIMWIAL |
| Ga0114901_10210723 | 3300009604 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGACIIMWIVLERMDK* |
| Ga0114906_10607271 | 3300009605 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGVCIIMWIALEWMD |
| Ga0105236_10410491 | 3300009619 | Marine Oceanic | KMQLAIDVFTDMMTSKEIYIIIGGCIIMWIALEWMDR* |
| Ga0115002_102406273 | 3300009706 | Marine | MQLAIDVFIDMFKSKEIYVIIGGAIIMWIALERMDR* |
| Ga0115002_105185012 | 3300009706 | Marine | MQLAIDVFIDMFKNKEIYIIIGGAIIMWIFLERMDR* |
| Ga0115002_107209171 | 3300009706 | Marine | MQLAIDVFIDMFKSKEIYIIIGGAIIMWIFLEWNDV* |
| Ga0114999_110180243 | 3300009786 | Marine | MQLAIDVFIDMFKSKEIYIIIGAAVIMWIFLERMDK* |
| Ga0098061_11379532 | 3300010151 | Marine | MQLAIDVFIDMMTSKEIYIIIGGAIIMWLYLEWSKNK* |
| Ga0098059_10904253 | 3300010153 | Marine | MQLAIDVFTDMMTSKEIYIIIGGCIIMWIELERMDK* |
| Ga0133547_117775184 | 3300010883 | Marine | MQLAIDVFTDMMTNKKIYIIIGACIIMWIALERMDR* |
| Ga0163108_102343692 | 3300012950 | Seawater | MKMQLAIDVFTDMMTSKEIYIIIGAAVIMWIAMEWMDKDV* |
| Ga0181391_11145823 | 3300017713 | Seawater | MMQLTIDVFIDMFKSKEIYIIIGGCIIMWIALEYMDR |
| Ga0181399_11573821 | 3300017742 | Seawater | KLTIDVFIDMFKSKEIYIIIGGAIIMWILLERMDV |
| Ga0181420_10310536 | 3300017757 | Seawater | MQLAIDVFIDIFKSKEIYIIIGGAIIMWILLERMDV |
| Ga0181410_12055692 | 3300017763 | Seawater | MMQLAIDVFIDMFKSKEIYIIIGSAIVVWIILEWNDV |
| Ga0181386_11922832 | 3300017773 | Seawater | MMQLAIDVFIDIFKSKEIYIIIGGAIIMWIALEKMDR |
| Ga0181432_11056383 | 3300017775 | Seawater | MMQLAIDVFINMMTSKEIYIIIGGAIIMWLYLEWSENK |
| Ga0181432_12795192 | 3300017775 | Seawater | MQLAIDIFTDMMTSKEIYIIIGVCIIMWIAMEWMDR |
| Ga0211623_103500141 | 3300020399 | Marine | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIALEWMDKDV |
| Ga0206685_100230002 | 3300021442 | Seawater | MQLAIDVFTDMMTSKEIYIIIGGCIIMWIALEWMDKNV |
| Ga0232646_11497493 | 3300021978 | Hydrothermal Vent Fluids | RKMRRKMQLATEVFIDMMKSKEIYIILGGAIMLWIVLERIDK |
| (restricted) Ga0255051_102752862 | 3300024057 | Seawater | KMQLAIDVFIDMFKSKEIYIIIGSAIVVWIILEWNDV |
| Ga0207900_1048963 | 3300025029 | Marine | MQLAIDVFTDMMTNKEIYIIIGACIIMWIALERMDR |
| Ga0207901_10139634 | 3300025045 | Marine | MMQLAIDVFIDMVTSKEIYIIIGVAIIMWLCLEWSENK |
| Ga0207901_10306742 | 3300025045 | Marine | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDR |
| Ga0207902_10517642 | 3300025046 | Marine | MMELATEVFIDMMKSKEIYIILGGAIMLWIVLERMDR |
| Ga0207898_10126073 | 3300025049 | Marine | MQLAIDVFTDMMTNKEVYIIIGACIIMWIALERMDR |
| Ga0207906_10297493 | 3300025052 | Marine | MQLAIDVFIDMMTSKEIYIIIGVAIIMWLCLEWSENK |
| Ga0207887_10667342 | 3300025069 | Marine | MQLAIDVFTDMMKSKEIYIIIGACIIMWIALEWMDRNV |
| Ga0208668_10142256 | 3300025078 | Marine | MQLAIDVFIDMITSKEIYIIIGACIILWVILERSENK |
| Ga0208433_10585282 | 3300025114 | Marine | MQLAIDVFTDMMTSKEIYIIIGGCIIMWIALERMDR |
| Ga0208299_11806833 | 3300025133 | Marine | TNKGIIMQLAIDVFIDMMTSKEIYIIIGGAIIMWLYLEWSKNK |
| Ga0209337_10836864 | 3300025168 | Marine | MMQLAIDVFIDMFKSKEIYIIIGACIIMWIALERMDK |
| Ga0209337_12474801 | 3300025168 | Marine | MMQLTIDVFIDMFKSKEIYIIIGGAIIMWILLERMDV |
| Ga0207880_10580323 | 3300025247 | Deep Ocean | MELATEVFIDMMKSKEIYIILGGAIMLWIVLERMDK |
| Ga0208182_10153357 | 3300025251 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIAMEWMDR |
| Ga0208182_10454334 | 3300025251 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALEWMDRN |
| Ga0207899_10420241 | 3300025257 | Deep Ocean | MQLATEVFIDMMKSKEIYIIIGACIIMWIALERMDK |
| Ga0207895_10419342 | 3300025260 | Deep Ocean | MELATEVFIDMMKSKEIYIIIGGAIMLWIVLERMDK |
| Ga0208813_10756543 | 3300025270 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALEWMDR |
| Ga0208183_10275651 | 3300025274 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMD |
| Ga0208183_10392493 | 3300025274 | Deep Ocean | MQLAIDVLTDMMTSKEIYIIIGVCIIMWIALEWMDR |
| Ga0208180_100382612 | 3300025277 | Deep Ocean | MQLAIDVLTDMMTSKEIYIIIGVCIIMWIALERMDR |
| Ga0208449_10540704 | 3300025280 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGVCIIMWIALEWMDRN |
| Ga0208449_10934001 | 3300025280 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGGAIIMWIALERMDR |
| Ga0208315_10192714 | 3300025286 | Deep Ocean | MQLAIDVFTDMITSKEIYIIIGAAVIMWIALEWMDR |
| Ga0208315_10650751 | 3300025286 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALEWMDRNV |
| Ga0208315_10700422 | 3300025286 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGSCIIMWIILEWNDV |
| Ga0208316_10215244 | 3300025296 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGAAVIMWIALEWMDR |
| Ga0208181_11084703 | 3300025300 | Deep Ocean | SKMQLAIDVFTDMMTSKEIYIIIGACIIMWIALERMDR |
| Ga0208450_10777633 | 3300025301 | Deep Ocean | ERSLMQLAIDVFTDMMTSKEIYIIIGGAIIMWIALERMDR |
| Ga0208684_10199272 | 3300025305 | Deep Ocean | MQLAIDVFTDMMTSKEIYIIIGVCIIMWIALERMDR |
| Ga0208684_10447431 | 3300025305 | Deep Ocean | MQLAIDVFIDMFKSKEIYIIIGSCIIMWIILERMD |
| Ga0208684_10807873 | 3300025305 | Deep Ocean | SRKKGVIMQLAIDVFIDMFKSKEIYIIIGSCIIMWIILERMDV |
| Ga0208148_11284183 | 3300025508 | Aqueous | MQLAIDVFIDMFKSKEIYVIIGSAIVVWIILEWNDV |
| Ga0209757_102659462 | 3300025873 | Marine | MQLAIDVFTDMMTNKEIYIIIGACIIMWIALEWMDKDV |
| Ga0208451_10501022 | 3300026103 | Marine Oceanic | MQLATEVFINMMKSKEIYIIIGACIIMWIALEWMDKDV |
| Ga0209709_103010983 | 3300027779 | Marine | MMQLAIDVFIDMVTSKEIYIIIGVAIIMWLCLEWGENNGK |
| Ga0209089_100588244 | 3300027838 | Marine | MMQLAIDVFIDMVTSKEIYIIIGVAIIMWLCLEWGENK |
| Ga0209501_106629971 | 3300027844 | Marine | NKSNPEGYMMQLAIDVFIDMFKSKEIYVIIGGAIIMWIALERMDR |
| Ga0209402_1001580418 | 3300027847 | Marine | LKKFNERIESMQLTIDIFIDIFKNKEIYIIIGACIIMWIALKRMDR |
| Ga0209402_102111423 | 3300027847 | Marine | MQLAIDVFIDMFKSKEIYVIIGGAIIMWIALERMDR |
| Ga0257112_100542622 | 3300028489 | Marine | MQLAIDVFTDMMTSKEIYIIIGACIIMWIALEWMDKDV |
| Ga0308131_10126114 | 3300030729 | Marine | MQLAIDVFIDMFKSKEIYVIIGGAIIMWIFLEWNDV |
| Ga0310121_101824241 | 3300031801 | Marine | KKFNERIESMQLAIDVFIDMFKSKEIYIIIGSAIVLWIILEWNDV |
| Ga0315327_106352922 | 3300032032 | Seawater | MQLAIDVFTDIMTSKEIYIIIGGAIIMWIALERMDR |
| Ga0315305_12185401 | 3300032127 | Marine | MQLAIDVFTDMMTSKEIYIIIGGAVIMWIALERMDR |
| Ga0310345_113919872 | 3300032278 | Seawater | MQLAIDVFIDMMTSKEIYIIIGGAIIMWLYLEWGENK |
| Ga0315334_105762453 | 3300032360 | Seawater | MQLAIDVFIDMMKSKEIYIIIGGAVIMWIALERMDR |
| Ga0310342_1004870083 | 3300032820 | Seawater | MQLAIDVFTDMMTNKEIYIIIGGCIILWIALERMDR |
| Ga0310342_1014370382 | 3300032820 | Seawater | MQLAIDVFTDMMTSKEIYIIIGVCIIMWIALERMDK |
| ⦗Top⦘ |