Metagenome Family F068095

Overview

Basic Information

• Family ID: F068095
• Family Type: Metagenome
• Number of Sequences: 125
• Average Sequence Length: 39 residues
• Representative Sequence: MRDWLFLLAPPALIFYFIAFPDQFYAFVFWARHLIG
• Number of Associated Samples: 107
• Number of Associated Scaffolds: 125

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 63.20 %
• % of genes near scaffold ends (potentially truncated): 28.80 %
• % of genes from short scaffolds (< 2000 bps): 71.20 %
• Associated GOLD sequencing projects: 103
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (64.000 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.000 % of family members)
• Environment Ontology (ENVO): Unclassified (20.800 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (50.400 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 51.56%
  β-sheet: 0.00%
  Coil/Unstructured: 48.44%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF07238	PilZ	33.60
PF00027	cNMP_binding	14.40
PF00126	HTH_1	6.40
PF13545	HTH_Crp_2	1.60
PF00528	BPD_transp_1	0.80
PF04115	Ureidogly_lyase	0.80
PF06035	Peptidase_C93	0.80
PF13439	Glyco_transf_4	0.80
PF09423	PhoD	0.80
PF02321	OEP	0.80
PF13563	2_5_RNA_ligase2	0.80
PF07690	MFS_1	0.80
PF00535	Glycos_transf_2	0.80
PF03480	DctP	0.80
PF09084	NMT1	0.80
PF13191	AAA_16	0.80
PF03401	TctC	0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.60
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.80
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.80
COG3194	Ureidoglycolate hydrolase (allantoin degradation)	Nucleotide transport and metabolism [F]	0.80
COG3672	Predicted transglutaminase-like protein	Posttranslational modification, protein turnover, chaperones [O]	0.80
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.80

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.00 %
Unclassified	root	N/A	36.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.00 %
Unclassified	root	N/A	36.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	64.00 %
Unclassified	root	N/A	36.00 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	57.60 %
Unclassified	root	N/A	36.00 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	52.80 %
Unclassified	root	N/A	36.00 %

Level 6

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	41.60 %
Unclassified	root	N/A	36.00 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.00 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	20.80 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.00 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.60 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.80 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2162886007|SwRhRL2b_contig_654925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2159
2199352025|deepsgr__Contig_1728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5480
3300000041|ARcpr5oldR_c000045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22863
3300000881|JGI10215J12807_1141152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2386
3300002906|JGI25614J43888_10192094	Not Available	552
3300005158|Ga0066816_1017868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	579
3300005165|Ga0066869_10064649	Not Available	672
3300005330|Ga0070690_100554842	Not Available	867
3300005341|Ga0070691_11040510	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	513
3300005365|Ga0070688_101465798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	555
3300005434|Ga0070709_10057196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2469
3300005439|Ga0070711_100318012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1243
3300005440|Ga0070705_101768837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	524
3300005458|Ga0070681_10310486	All Organisms → cellular organisms → Bacteria	1486
3300005543|Ga0070672_100093103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2434
3300005564|Ga0070664_100073674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2931
3300005713|Ga0066905_100606589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	927
3300005764|Ga0066903_100001926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	15730
3300005764|Ga0066903_100307111	All Organisms → cellular organisms → Bacteria	2517
3300005764|Ga0066903_101703818	Not Available	1200
3300005764|Ga0066903_106897533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	590
3300005764|Ga0066903_107359373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	569
3300006028|Ga0070717_10054055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3311
3300006050|Ga0075028_100024159	Not Available	2719
3300006172|Ga0075018_10088028	Not Available	1359
3300006172|Ga0075018_10431193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	676
3300006173|Ga0070716_100698618	Not Available	775
3300006175|Ga0070712_100174175	Not Available	1672
3300006755|Ga0079222_10655020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	818
3300006804|Ga0079221_10508339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	784
3300006806|Ga0079220_10069840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1727
3300006806|Ga0079220_10465294	Not Available	851
3300006954|Ga0079219_10339940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	957
3300009166|Ga0105100_10050925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2403
3300009545|Ga0105237_10233285	All Organisms → cellular organisms → Bacteria	1841
3300009792|Ga0126374_10369334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	991
3300010043|Ga0126380_10413380	All Organisms → cellular organisms → Bacteria	1007
3300010046|Ga0126384_10352097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1228
3300010046|Ga0126384_11462362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	639
3300010048|Ga0126373_10640350	All Organisms → cellular organisms → Bacteria → Proteobacteria	1118
3300010358|Ga0126370_11891561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	580
3300010361|Ga0126378_12899038	Not Available	547
3300010362|Ga0126377_10170084	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2064
3300010362|Ga0126377_10294740	All Organisms → cellular organisms → Bacteria	1597
3300010366|Ga0126379_13261109	Not Available	543
3300010371|Ga0134125_10199062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2230
3300010373|Ga0134128_10168655	Not Available	2472
3300010373|Ga0134128_13046124	Not Available	515
3300010398|Ga0126383_10233987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1790
3300010401|Ga0134121_11414566	Not Available	707
3300011269|Ga0137392_11268071	Not Available	596
3300012490|Ga0157322_1002574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1035
3300012908|Ga0157286_10018623	All Organisms → cellular organisms → Bacteria	1484
3300012957|Ga0164303_10265469	Not Available	992
3300012971|Ga0126369_10733702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1067
3300012989|Ga0164305_10058017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2303
3300013307|Ga0157372_10104140	All Organisms → cellular organisms → Bacteria → Proteobacteria	3243
3300013308|Ga0157375_10848604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1060
3300014745|Ga0157377_10576107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	799
3300015371|Ga0132258_10174807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5181
3300015371|Ga0132258_10412349	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3358
3300015371|Ga0132258_10678654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2593
3300015371|Ga0132258_11125474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1985
3300015373|Ga0132257_104591091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	502
3300015374|Ga0132255_101243743	Not Available	1122
3300017930|Ga0187825_10127764	Not Available	890
3300017936|Ga0187821_10154105	Not Available	869
3300017939|Ga0187775_10007978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2628
3300017944|Ga0187786_10002500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4164
3300017944|Ga0187786_10128344	Not Available	890
3300017944|Ga0187786_10509618	Not Available	547
3300017959|Ga0187779_10009834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5500
3300017961|Ga0187778_10046681	All Organisms → cellular organisms → Bacteria → Proteobacteria	2644
3300017973|Ga0187780_10030916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3779
3300017974|Ga0187777_10000541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	25686
3300017994|Ga0187822_10277549	Not Available	584
3300018029|Ga0187787_10000101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10916
3300018058|Ga0187766_11404453	Not Available	512
3300018060|Ga0187765_10067303	Not Available	1885
3300020004|Ga0193755_1211728	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	545
3300021560|Ga0126371_10097499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2921
3300021560|Ga0126371_10413959	All Organisms → cellular organisms → Bacteria → Proteobacteria	1491
3300021560|Ga0126371_11203922	All Organisms → cellular organisms → Bacteria	894
3300023069|Ga0247751_1024959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	946
3300025290|Ga0207673_1015061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1022
3300025898|Ga0207692_10408390	Not Available	848
3300025899|Ga0207642_10950008	Not Available	552
3300025900|Ga0207710_10042342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2022
3300025986|Ga0207658_10211005	All Organisms → cellular organisms → Bacteria	1627
3300026304|Ga0209240_1050387	Not Available	1570
3300026319|Ga0209647_1018787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4335
3300026345|Ga0257148_1015373	Not Available	606
3300026745|Ga0207576_103154	Not Available	565
3300026788|Ga0207579_101325	Not Available	532
3300026944|Ga0207570_1000516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2052
3300027011|Ga0207740_1046207	Not Available	502
3300027424|Ga0209984_1036301	Not Available	704
3300027552|Ga0209982_1083342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	528
3300027665|Ga0209983_1012717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1728
3300027765|Ga0209073_10050243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1366
3300027765|Ga0209073_10158785	Not Available	839
3300027787|Ga0209074_10572398	Not Available	500
3300027894|Ga0209068_10133659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1332
3300027915|Ga0209069_10395780	Not Available	756
3300028577|Ga0265318_10342344	Not Available	546
3300028802|Ga0307503_10229502	Not Available	896
3300031716|Ga0310813_11452112	Not Available	637
3300031719|Ga0306917_10651762	Not Available	828
3300031820|Ga0307473_10553830	Not Available	786
3300031910|Ga0306923_10405582	Not Available	1551
3300031913|Ga0310891_10000588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6675
3300031942|Ga0310916_11151069	Not Available	643
3300031947|Ga0310909_10381941	All Organisms → cellular organisms → Bacteria → Proteobacteria	1183
3300031996|Ga0308176_11174416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	813
3300032174|Ga0307470_10021361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2921
3300032205|Ga0307472_100009512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4810
3300032770|Ga0335085_11107643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	848
3300033004|Ga0335084_10673604	Not Available	1055
3300033412|Ga0310810_10121545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3080
3300033433|Ga0326726_10082196	Not Available	2857
3300033475|Ga0310811_10669679	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1015
3300033480|Ga0316620_11614145	Not Available	642
3300033513|Ga0316628_100301525	All Organisms → cellular organisms → Bacteria → Proteobacteria	1992
3300033513|Ga0316628_102012601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	767
3300033810|Ga0314872_005491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	834

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.60%
Host-Associated	Host-Associated	18.40%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.40%
Plants	Host-Associated → Plants	18.40%
Aquatic	Environmental → Aquatic	7.20%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	73.60%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.20%
Sediment	Environmental → Aquatic → Sediment	4.00%
Freshwater	Environmental → Aquatic → Freshwater	3.20%
Peat	Environmental → Terrestrial → Peat	0.80%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	45.60%
Loam	Environmental → Terrestrial → Soil → Loam	14.40%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	13.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.40%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.00%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.20%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.40%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.80%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.80%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.80%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	13.60%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	9.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.80%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.40%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.20%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.40%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.60%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.80%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.80%

Habitat

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.00%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	8.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.40%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.40%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.60%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.00%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.00%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.20%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.40%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.40%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.40%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.60%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.80%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.80%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.80%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.80%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.80%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.80%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Host-Associated
3300000881	Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil	Environmental
3300002906	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm	Environmental
3300005158	Soil and rhizosphere microbial communities from Laval, Canada - mgHAA	Environmental
3300005165	Soil and rhizosphere microbial communities from Laval, Canada - mgHMC	Environmental
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Host-Associated
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300023069	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5	Environmental
3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Host-Associated
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026345	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A	Environmental
3300026745	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes)	Environmental
3300026788	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07.2A5-10 (SPAdes)	Environmental
3300026944	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes)	Environmental
3300027011	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes)	Environmental
3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)	Host-Associated
3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)	Host-Associated
3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)	Host-Associated
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Host-Associated
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental
3300033810	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
SwRhRL2b_0813.00008160	2162886007	Switchgrass Rhizosphere	MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
deepsgr_02965530	2199352025	Soil	MRFRLQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG
ARcpr5oldR_0000459	3300000041	Arabidopsis Rhizosphere	MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
JGI10215J12807_11411521	3300000881	Soil	PMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
JGI25614J43888_101920941	3300002906	Grasslands Soil	MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI*
Ga0066816_10178682	3300005158	Soil	TQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0066869_100646491	3300005165	Soil	MGSLIQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI
Ga0070690_1005548422	3300005330	Switchgrass Rhizosphere	MCATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070691_110405102	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	QEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070688_1014657981	3300005365	Switchgrass Rhizosphere	TQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070709_100571964	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG*
Ga0070711_1003180121	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MGFCSQEPPMREWLFLLAPPALIFYFIAYPAQFYAFVAWARVMMG*
Ga0070705_1017688372	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	ATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070681_103104864	3300005458	Corn Rhizosphere	RCATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070672_1000931036	3300005543	Miscanthus Rhizosphere	PPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0070664_1000736745	3300005564	Corn Rhizosphere	MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG*
Ga0066905_1006065891	3300005713	Tropical Forest Soil	CAAMQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0066903_10000192615	3300005764	Tropical Forest Soil	MRDWLFLLAPPAVIFYFIAFPDRFYSLVTWARTLLG*
Ga0066903_1003071113	3300005764	Tropical Forest Soil	MRDWLFLLAPPALIFFFLVFPETFYALVSWARTVIG*
Ga0066903_1017038183	3300005764	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG*
Ga0066903_1068975332	3300005764	Tropical Forest Soil	MRSCSQEPPMRDWLFLLAPPALIFYFIAYPEQFYAFVNWARHVIG*
Ga0066903_1073593731	3300005764	Tropical Forest Soil	PPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLMG*
Ga0070717_100540555	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG*
Ga0075028_1000241591	3300006050	Watersheds	MCFCSQEPPMREWLFLLAPPALIFYFIAYPAQFYAFVAWARTMMG*
Ga0075018_100880281	3300006172	Watersheds	MREWLFLLAPPALIFYFIAYPAQFYAFVAWARTMMG*
Ga0075018_104311932	3300006172	Watersheds	MRFRLQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG*
Ga0070716_1006986181	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	TMGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG*
Ga0070712_1001741754	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MREWLFLLAPPALIFYFIAYPAQFYAFVAWARVMMG*
Ga0079222_106550203	3300006755	Agricultural Soil	MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKTLVG*
Ga0079221_105083392	3300006804	Agricultural Soil	MGFYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWAKNLI*
Ga0079220_100698403	3300006806	Agricultural Soil	MRDWLFLLAPPALIFYFVVFPDQFYAFMIWARNMM*
Ga0079220_104652942	3300006806	Agricultural Soil	MRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI*
Ga0079219_103399401	3300006954	Agricultural Soil	MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKALVG*
Ga0105100_100509253	3300009166	Freshwater Sediment	MRDWLFLLAPPALIFYFIAFPHQFYAFVAWARTMIG*
Ga0105237_102332851	3300009545	Corn Rhizosphere	RRCATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0126374_103693343	3300009792	Tropical Forest Soil	QEPPMRDWLFLLAPPALIFYFIAFPEGFYALVSWARTLIG*
Ga0126380_104133802	3300010043	Tropical Forest Soil	MRDWLFLLAPPALIFFFLVFPDAFYALVSWARTVIG*
Ga0126384_103520971	3300010046	Tropical Forest Soil	MRDWLFLLAPPELIFYFIAFPEGFHALVGWARMLIG*
Ga0126384_114623622	3300010046	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAFPESFYALVSWARTLIG*
Ga0126373_106403501	3300010048	Tropical Forest Soil	MMSACLQEPPMRDWLFLLAPPALIFYFIAFPDRFYALVTWARTMIG*
Ga0126370_118915612	3300010358	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAFPEGFYALVSWARTLIG*
Ga0126378_128990381	3300010361	Tropical Forest Soil	CLQEPPMRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG*
Ga0126377_101700843	3300010362	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKKLIG*
Ga0126377_102947405	3300010362	Tropical Forest Soil	MQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0126379_132611092	3300010366	Tropical Forest Soil	MRDWLFLLAPPGLIFYFIAYPEQFYAFVNWARHVIG*
Ga0134125_101990621	3300010371	Terrestrial Soil	MCASVQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0134128_101686553	3300010373	Terrestrial Soil	MGSYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI*
Ga0134128_130461242	3300010373	Terrestrial Soil	MREWLFLLAPPALIFYFIAYPSQFYAFVAWARVMMG*
Ga0126383_102339872	3300010398	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAYPEQFYAFVNWARHVIG*
Ga0134121_114145662	3300010401	Terrestrial Soil	MGFYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI*
Ga0137392_112680711	3300011269	Vadose Zone Soil	MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARY
Ga0157322_10025741	3300012490	Arabidopsis Rhizosphere	MWLCSQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0157286_100186235	3300012908	Soil	RDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0164303_102654692	3300012957	Soil	QEPPMRDWLFLLAPPALIFYFIAYPNSFYAFVGWARTLVG*
Ga0126369_107337021	3300012971	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAFPEGFYALVGWARMLIG*
Ga0164305_100580173	3300012989	Soil	MRDWLFLLAPPALIFYFIAYPNSFYAFVGWARTLVG*
Ga0157372_101041404	3300013307	Corn Rhizosphere	MRDWLFLLAPPALIFYFIVFPDMFYAFVSWARTLIG*
Ga0157375_108486044	3300013308	Miscanthus Rhizosphere	DWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0157377_105761073	3300014745	Miscanthus Rhizosphere	ATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG*
Ga0132258_101748076	3300015371	Arabidopsis Rhizosphere	MRDWLFLLAPPALIFYFIVFPDRFYAFISWARTLIG*
Ga0132258_104123494	3300015371	Arabidopsis Rhizosphere	MRDWLFLLAPPGLIFYFVAFPDQFHAFVIWARNIMM*
Ga0132258_106786545	3300015371	Arabidopsis Rhizosphere	MLLRLQEPPMRDWLFLLAPPALIFYFVAFPDQFHTFVMWARNMM*
Ga0132258_111254742	3300015371	Arabidopsis Rhizosphere	MRDWLFLLAPPALIFYFIVFPESFYALVSWARTVIG*
Ga0132257_1045910912	3300015373	Arabidopsis Rhizosphere	LQEPPMRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG*
Ga0132255_1012437433	3300015374	Arabidopsis Rhizosphere	MRDWLFLLAPPALIFYFIVFPETFYALVTWARTMMG*
Ga0187825_101277641	3300017930	Freshwater Sediment	MGLYLQEPPMRDWLFLLTPPAMIFYFIAFPDQFYAFVAWAKNLI
Ga0187821_101541052	3300017936	Freshwater Sediment	MREWLFLLGPPALIFYFIAYPTQFYAFVAWARVMMG
Ga0187775_100079784	3300017939	Tropical Peatland	MRDWLFLLAPPALIFYFVAFPDQFYAFVTWARNMM
Ga0187786_100025004	3300017944	Tropical Peatland	MREWLFMLAPPALIFYFIAYPAQFYAFVAWARTVMG
Ga0187786_101283442	3300017944	Tropical Peatland	MREWLFLLAPPALIFYFIAYPTQFYAFVAWARVMMG
Ga0187786_105096182	3300017944	Tropical Peatland	MREWLFLLAPPALIFYFIAYPNQFYAFVAWARIMMG
Ga0187779_100098347	3300017959	Tropical Peatland	MRDWLFLLAPPALIFYFVAFPDQFHAFMIWARNMM
Ga0187778_100466814	3300017961	Tropical Peatland	MPFCSQEPPMRDWLFLLAPPALIFYFVIYPNQFHAFVIWAKYIIG
Ga0187780_100309163	3300017973	Tropical Peatland	MREWLFMLAPPALIFYFIAYPVQFYAFVAWARTVMG
Ga0187777_1000054117	3300017974	Tropical Peatland	MRDWLFLLAPPALIFYFVIYPNQFHAFVIWAKYIIG
Ga0187822_102775492	3300017994	Freshwater Sediment	LQEPPMRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI
Ga0187787_100001014	3300018029	Tropical Peatland	MRDWLFLLAPPALIFYFIAFPDQFYAFVFWARHLIG
Ga0187766_114044531	3300018058	Tropical Peatland	RDWLFLLAPPAQIFYFIAFPETFYALVTWARTMIG
Ga0187765_100673033	3300018060	Tropical Peatland	MRRYLQEPPMRDWLFLLAPPALIFYFIAFPETFYALVTWARTMIG
Ga0193755_12117282	3300020004	Soil	MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIG
Ga0126371_100974991	3300021560	Tropical Forest Soil	MRFCSQEPPMRNWLFLLAPPALIFYFVAFPGQFDAFVFWMKNIMG
Ga0126371_104139591	3300021560	Tropical Forest Soil	MMSACLQEPPMRDWLFLFAPPALIFYFIAFPDQFYALVTWARTMIG
Ga0126371_112039221	3300021560	Tropical Forest Soil	MRDWLFLLAPPALIFYFIAFPEGFYALVGWARMLIG
Ga0247751_10249591	3300023069	Soil	CATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0207673_10150613	3300025290	Corn, Switchgrass And Miscanthus Rhizosphere	TTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0207692_104083903	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MGFCSQEPPMREWLFLLAPPALIFYFIAFPAQFYAFVAWARVMIG
Ga0207642_109500082	3300025899	Miscanthus Rhizosphere	MRDWLFLLAPPALIFYFIVFPDRFYAFVSWARTLIGE
Ga0207710_100423425	3300025900	Switchgrass Rhizosphere	MCATQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0207658_102110055	3300025986	Switchgrass Rhizosphere	TQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0209240_10503872	3300026304	Grasslands Soil	MASLLQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI
Ga0209647_10187873	3300026319	Grasslands Soil	MRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI
Ga0257148_10153732	3300026345	Soil	MRDWLFLLAPPALIFYFIANPEQFYAFVAWAKTMVG
Ga0207576_1031542	3300026745	Soil	MRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLI
Ga0207579_1013251	3300026788	Soil	TTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0207570_10005161	3300026944	Soil	ATTQGPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0207740_10462072	3300027011	Tropical Forest Soil	REWLFLLAPPALIFYFIAYPAQFYAFVAWARTVMG
Ga0209984_10363013	3300027424	Arabidopsis Thaliana Rhizosphere	RCATTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0209982_10833422	3300027552	Arabidopsis Thaliana Rhizosphere	CGATQGPPMRDWLFLLAPPALIFYFIAYPNKFYEFVFWAKRLIG
Ga0209983_10127172	3300027665	Arabidopsis Thaliana Rhizosphere	MRDWLFLLAPPALIFYFIAYPNKFYEFVFWAKRLIG
Ga0209073_100502433	3300027765	Agricultural Soil	MRRCLQEPSMRDWLFLLAPPALIFYFVVFPDQFYAFMIWARNMM
Ga0209073_101587852	3300027765	Agricultural Soil	MRDWLFLLTPPAMIFYFIAFPDRFDAFVAWARTLI
Ga0209074_105723982	3300027787	Agricultural Soil	MRDWLFLLAPPALIFYFIANPNSFYAFVGWAKTLVG
Ga0209068_101336592	3300027894	Watersheds	MREWLFLLAPPALIFYFVAYPAKFYAFVAWARTMMG
Ga0209069_103957801	3300027915	Watersheds	MREWLFLLAPPALIFYFVAYPAKFYAFVAWARVMMG
Ga0265318_103423441	3300028577	Rhizosphere	MREWLFLLAPPALIFYFIAYPSQFYAFVAWARVMMG
Ga0307503_102295021	3300028802	Soil	KALRKWSIRIMGSLIQEPPMRDWLFLLAPPAVIFYFIAFPEQFYAFVAWARYLI
Ga0310813_114521121	3300031716	Soil	MRDWLFLLAPPALIFYFIAYPDKFHEFVFWAKRLIG
Ga0306917_106517622	3300031719	Soil	MMSACLQEPPMRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG
Ga0307473_105538301	3300031820	Hardwood Forest Soil	MRDWLFLLAPPALIFYFIVFPDMFYAFLNWARTLIG
Ga0306923_104055822	3300031910	Soil	MRDWLFLLAPPAVIFYFIAFPDRFYSLVTWARTLLG
Ga0310891_100005884	3300031913	Soil	MRDWLFLLAPPALIFYFSAYPDKFYEFVFWAKRLIG
Ga0310916_111510691	3300031942	Soil	MMSACLQEPPMRDWLFLLAPPALIFYFIASPDQFYALVTWARTMIG
Ga0310909_103819412	3300031947	Soil	MRDWLFLLAPPALIFYFIAFPDQFYALVTWARTMIG
Ga0308176_111744162	3300031996	Soil	MREWLFLLAPPALIFYFVAYPAQFYAFVAWARVMMG
Ga0307470_100213612	3300032174	Hardwood Forest Soil	MRDWLFLLAPPALIFYFIAYPHKFYEFVFWAKRLIG
Ga0307472_1000095126	3300032205	Hardwood Forest Soil	MRDWLFLLAPPALILYFVTFPDQFHSFMIWARTMM
Ga0335085_111076432	3300032770	Soil	MREWLFLLAPPALIFYFIAYPAQFYAFVAWARTVMG
Ga0335084_106736042	3300033004	Soil	MGLCLQEPPMRDWLFLLGPPALIFYFVAFPDQFHTFVTWARNVM
Ga0310810_101215455	3300033412	Soil	MRDWLFLLTPPAMIFYFIAFPDQFYAFVAWARNLI
Ga0326726_100821967	3300033433	Peat Soil	MREWLFLLGPPALIFYFIAYPAQFYAFVAWARVMMG
Ga0310811_106696794	3300033475	Soil	ATTQEPPMRDWLFLLAPPALIFYFIAYPDKFYEFVFWAKRLIG
Ga0316620_116141452	3300033480	Soil	PMREWLFLLAPPALIFYFIAFPAQFYAFVAWARILIG
Ga0316628_1003015252	3300033513	Soil	MRDWLFLLAPPALIFYFIAYPDKFIEFVDWAKRLIG
Ga0316628_1020126012	3300033513	Soil	MRDWLFLLAPPALIFYFIAYPTQFYAFVAWARTLIG
Ga0314872_005491_352_459	3300033810	Peatland	MRDWLFLLAPPALIFYFVAFPDQFHAFVMWARNML