| Basic Information | |
|---|---|
| Family ID | F068008 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSEKPSTTLPATVEKIIKPLSPRDPEKAQIAVEGADHLY |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.40 % |
| % of genes from short scaffolds (< 2000 bps) | 3.20 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.40% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF12732 | YtxH | 4.80 |
| PF13502 | AsmA_2 | 3.20 |
| PF00072 | Response_reg | 2.40 |
| PF04675 | DNA_ligase_A_N | 2.40 |
| PF13545 | HTH_Crp_2 | 2.40 |
| PF01554 | MatE | 2.40 |
| PF02881 | SRP54_N | 2.40 |
| PF01594 | AI-2E_transport | 1.60 |
| PF07136 | DUF1385 | 0.80 |
| PF00300 | His_Phos_1 | 0.80 |
| PF07043 | DUF1328 | 0.80 |
| PF01695 | IstB_IS21 | 0.80 |
| PF01261 | AP_endonuc_2 | 0.80 |
| PF07676 | PD40 | 0.80 |
| PF13424 | TPR_12 | 0.80 |
| PF04679 | DNA_ligase_A_C | 0.80 |
| PF16694 | Cytochrome_P460 | 0.80 |
| PF13442 | Cytochrome_CBB3 | 0.80 |
| PF12867 | DinB_2 | 0.80 |
| PF07366 | SnoaL | 0.80 |
| PF01464 | SLT | 0.80 |
| PF00248 | Aldo_ket_red | 0.80 |
| PF12706 | Lactamase_B_2 | 0.80 |
| PF01740 | STAS | 0.80 |
| PF11154 | DUF2934 | 0.80 |
| PF09844 | DUF2071 | 0.80 |
| PF13620 | CarboxypepD_reg | 0.80 |
| PF04542 | Sigma70_r2 | 0.80 |
| PF02348 | CTP_transf_3 | 0.80 |
| PF01042 | Ribonuc_L-PSP | 0.80 |
| PF04075 | F420H2_quin_red | 0.80 |
| PF00534 | Glycos_transf_1 | 0.80 |
| PF04851 | ResIII | 0.80 |
| PF02562 | PhoH | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 3.20 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.60 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.80 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.80 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.80 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.80 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.80 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.80 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.80 |
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 0.80 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.80 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.00 % |
| All Organisms | root | All Organisms | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005602|Ga0070762_10005076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6364 | Open in IMG/M |
| 3300018086|Ga0187769_10281881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300020199|Ga0179592_10309111 | Not Available | 701 | Open in IMG/M |
| 3300021307|Ga0179585_1180239 | Not Available | 518 | Open in IMG/M |
| 3300021401|Ga0210393_10116978 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300021406|Ga0210386_10051524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3271 | Open in IMG/M |
| 3300027117|Ga0209732_1001573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3558 | Open in IMG/M |
| 3300027376|Ga0209004_1033654 | Not Available | 844 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.20% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.40% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.40% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.60% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.60% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 1.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028772 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01187300 | 2199352024 | Soil | MSDVEKLSTTLPGMVEKIIKPAYSGQTEKAQISVEGADHLYR |
| JGI1027J11758_125355021 | 3300000789 | Soil | MAEKPSVNLKGTVEKIIKPVVPTQPEKAQIAVDGA |
| JGIcombinedJ26739_1017565711 | 3300002245 | Forest Soil | VSETNESEKPKVTLPGTVEKIIPANSIAPEKAQIAVEGA |
| Ga0062387_1017568681 | 3300004091 | Bog Forest Soil | MSEKPSTTLPATVEKIIKPIAPGEPEKAQISIEGADHLYKEIR |
| Ga0062386_1002551102 | 3300004152 | Bog Forest Soil | VPDEEHKASTTLPGKVERVIKPHPQSGEPEKAQIAVEGADHLYREI |
| Ga0070707_1011640021 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTENSSSSLRGTVEKIITSRVSTEPEKAQISIEGADHLYKELRI |
| Ga0070697_1013991792 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEKANVTLPGTVEKIINPPDPSEPEKAQINIQQGADPLYK |
| Ga0070762_100050767 | 3300005602 | Soil | MSEKASATLPAIVEKIIKPAYPSEPEKAQIAVEGADHLYRE |
| Ga0070762_100254913 | 3300005602 | Soil | MSEKASRTLPATVEKIIKPPVPDGTEKAQISVEGADHLYR |
| Ga0070762_107803383 | 3300005602 | Soil | MTDKPSVTLPGTVEKVIHSADPRIPEKAQIAVQGADDL |
| Ga0070717_100123333 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEKPSVTLPKTVEKIIKPSEPSEPEKAQIAIEGADDLYRELRCA* |
| Ga0070717_108496091 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQNSIVPDEKPSTTLPGIVEKVIKPRDPRDPEKAQIVVEGADHLY |
| Ga0070717_117760941 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDDEKPSTTLPGTVEKIIKPWVSGEPEKAQISVEGADHLY |
| Ga0075029_1010592301 | 3300006052 | Watersheds | MPEKPNIKLPATVEKIIKSPDPRMPEKAQISIERGADPLY |
| Ga0070712_10000176311 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEKPSTILPGTVEKIIKPPLPRMPEKAQITVEGGDHL* |
| Ga0070765_1011579231 | 3300006176 | Soil | MSEISSDQNEKPSTTLAGTVEKIIKPAHPSLPEKAQIAVEGGEDLYR |
| Ga0097621_1020094952 | 3300006237 | Miscanthus Rhizosphere | MDEKPSTILPGTVEKIIKPPLPRMPEKAQITVEGG |
| Ga0075436_1005705981 | 3300006914 | Populus Rhizosphere | MTGNPRTTLAGKVEKIIESRAPTEPEKAQIVIEGADQL |
| Ga0066710_1014669031 | 3300009012 | Grasslands Soil | MSENPSATLPGTVEKIIKSPHPGVPEKAQISVEAAD |
| Ga0099829_106654792 | 3300009038 | Vadose Zone Soil | MSEKTSTTLPGTVEKIIKPLSPDDTEKAQIAVEGA |
| Ga0099830_113261181 | 3300009088 | Vadose Zone Soil | MMEKPSVTLPGTVEKIIKPVHPSEPEKAQIAVEGA |
| Ga0099792_105191941 | 3300009143 | Vadose Zone Soil | MADRPSVTLPGTVEKVIESPHRGAPEKAEIAVEGADDLY |
| Ga0116138_11718622 | 3300009552 | Peatland | MTENPSVRLPGTVEKIIKPSGPSEAEKAQIAIEGADELY |
| Ga0116105_10070971 | 3300009624 | Peatland | MSANANTTLPATVEKIIKSPHPAIPEKAQIAIEGADH |
| Ga0126384_110262231 | 3300010046 | Tropical Forest Soil | MDEKASVVLPGTVEKIIKPVHPKEPERAEISIEGADHLYKEIRIE |
| Ga0126373_125544581 | 3300010048 | Tropical Forest Soil | MAEKPSTTRPGIVEKIIRPIVPDEPEKAQIAVEGADHLYR |
| Ga0099796_102852803 | 3300010159 | Vadose Zone Soil | MTEKIAEKPSVTLSGTVEKIIEPVHPSMPEKAQIAVEGADDLYQ |
| Ga0126370_120750562 | 3300010358 | Tropical Forest Soil | MPEKTENPSVTLPGKVEKIIKPLDRTDTEKAQINIEEGADPLYKEIRIENML |
| Ga0126372_129309502 | 3300010360 | Tropical Forest Soil | MPEKPSVTLPGTVDKIIHPPDPREPEKAQINIEDGADPLYKE |
| Ga0134125_102354734 | 3300010371 | Terrestrial Soil | MNEKPSAILPGTVEKIIKSPIPNESEKAQIAVEGADHLY |
| Ga0126351_12707881 | 3300010860 | Boreal Forest Soil | MSENPSTTLPGTVERIIKPLSADEPEKAQIAIEGADHLYREI |
| Ga0150983_160198731 | 3300011120 | Forest Soil | MPDEQNSDKPSTTLPGIVEKVIKSPDPTEPEKAQIAVERADPL |
| Ga0137393_101775411 | 3300011271 | Vadose Zone Soil | MKENSIVPDEKPSTTLPGIVEKVIKPRDPRDPEKAQIAVEGADHL |
| Ga0137393_104831671 | 3300011271 | Vadose Zone Soil | MSEKPSTTLPGTVEKIIKPLSPDDTEKAQIAVEGADHL |
| Ga0137389_118462912 | 3300012096 | Vadose Zone Soil | MTEKPSVTLPGTVEKIIKPIHPSEREKAQISVDGADE |
| Ga0150985_1199612053 | 3300012212 | Avena Fatua Rhizosphere | MSTPVATVTLPGVVENIIKSPHPSLPDKAQITVEGADELY |
| Ga0137360_107161452 | 3300012361 | Vadose Zone Soil | MADKTSVTLPGTVEKVIESPHRGMPEKAEIAVEGADDL |
| Ga0150984_1170822862 | 3300012469 | Avena Fatua Rhizosphere | MTEKPSTARPGIVERIIKSPDPREPEKAQISIEGAD |
| Ga0137358_107008462 | 3300012582 | Vadose Zone Soil | MSEKPSVTLPGTVEKIIPSPDPREPEKAHINIEEGATPLYKEIRIENTLTNEDG |
| Ga0137358_108749141 | 3300012582 | Vadose Zone Soil | MADKPSVTLPGTVEKVIESPHRGMPEKAEIAVEGADDLYREI |
| Ga0137397_108463861 | 3300012685 | Vadose Zone Soil | MTEKIVEKPSVTLPGTVEKIIEPIHPSMTEKAQIAVEGADDLYQE |
| Ga0137419_116958081 | 3300012925 | Vadose Zone Soil | MADKPSVTLPGTVEKVIESPHRGMPEKAEIAVEGADDLY |
| Ga0137416_109886011 | 3300012927 | Vadose Zone Soil | MTEKPSVSLPGTVDKIITPPDPRDPEKAQINIEEGADPLYKE |
| Ga0181535_102699402 | 3300014199 | Bog | MNPKPSATLPGTVEKIIKPPHPSEPEKAQIAVEGA |
| Ga0167658_10372683 | 3300015195 | Glacier Forefield Soil | MEESMPEKPSISLPGTVDKIIRPPDPREPEKAQINIEEGADPLYKEIR |
| Ga0137409_111849423 | 3300015245 | Vadose Zone Soil | MPEKPSVTLPATVEKIITTPDPIEPEKAQISLEDGDP |
| Ga0187821_105031051 | 3300017936 | Freshwater Sediment | MTENSSTSLCGTVEKIITSRVSTEPEKAQISIEGAD |
| Ga0187882_12346322 | 3300018021 | Peatland | MSEKPSTTLPATVEKIIKPLSPRDPEKAQIAVEGADHLY |
| Ga0187769_102818811 | 3300018086 | Tropical Peatland | MTEKPSVTLPGTVEKIIESPHPGEPEKAQISIEGADDLY |
| Ga0066662_109738071 | 3300018468 | Grasslands Soil | MPDTENPSTILPGTVEKIIKPWFPGDTEKAQISIQGADHMYREIRI |
| Ga0066669_121424791 | 3300018482 | Grasslands Soil | MSAKPSVTMPGTVEKIIPSHDPKEPDKAHISIEKGAIPLY |
| Ga0193721_11382742 | 3300020018 | Soil | MTEGSSDQSEKPSATLSGTVEKIIKSPDPNVPEKAQITVEGA |
| Ga0179592_103091113 | 3300020199 | Vadose Zone Soil | MAEKPSVTLPGTVEKIIKPSQPGQPEKAQIEIEGADDM |
| Ga0179592_104005871 | 3300020199 | Vadose Zone Soil | MFSRRGTLMTEKPSVTLPGTVEKIIKPIHPSEPEKAQISVEGADELY |
| Ga0210401_101230661 | 3300020583 | Soil | MSEKPSTTLPGTVEKIIKPLSPDDTEKAQIAVEGADH |
| Ga0210400_104067242 | 3300021170 | Soil | MTLRPSATLPGTVEKIIKPSDPSEPEKAQIAEDGADHL |
| Ga0210405_110782892 | 3300021171 | Soil | MSENSIVPDEKPGTTLSGIVEKVIKPRGPRDPEKAQIVAQGADHLYGEIRI |
| Ga0210388_100911591 | 3300021181 | Soil | MSEKASATLPAIVEKIIKPAYPSEPEKAQITVEGADHLYREI |
| Ga0210388_101439344 | 3300021181 | Soil | MTENPSVTLPGTVEKIIKPSAPSDAEKAQIAIEGADELYR |
| Ga0179585_11802391 | 3300021307 | Vadose Zone Soil | MTAKPSVTLPGTVEKIIQPSEPNQAEKAQIAIEGADDLYR |
| Ga0210393_101169781 | 3300021401 | Soil | MPEKPATVTLPGKVEAIIESFHPSEPEKAQIAVEGGDELY |
| Ga0210389_106733803 | 3300021404 | Soil | MTDKPRTADRPNVTLPGRVEKVIESPLPSEPEKAQISVEGA |
| Ga0210389_108049732 | 3300021404 | Soil | MTEKPSATLSGTVEMTIESIIPSEPEKAQITFGGADHPHKIRIENK |
| Ga0210387_116119141 | 3300021405 | Soil | MSEKPSTILPATVENIIKPLFPSEPEKAQITIEGADHLYRELR |
| Ga0210386_100515248 | 3300021406 | Soil | MTEKPSVTLPGTVEKIIKPAQPDQPEKAQIAIEGADDLY |
| Ga0210384_109654372 | 3300021432 | Soil | MSSEKAKDTMSSDEKPAITLPGTVEKIVPPVYPEPEKVQIHVEGADHLYK |
| Ga0210391_101146351 | 3300021433 | Soil | MASEQTHDKPAATLPGVVEKVIKPPSPAEPEKAQITVEGADH |
| Ga0210398_109510872 | 3300021477 | Soil | MSEKASATLPAIVEKIIKPAYPSEPEKAQIAVEGAD |
| Ga0212123_103877712 | 3300022557 | Iron-Sulfur Acid Spring | VTETNESEKPKVTLPGTVEKIIPANSIAPEKAQIAVEGADHLY |
| Ga0224562_10242941 | 3300022733 | Soil | MPEATESKKPAVTLPGTVEKIIPANTIAPERAQIAVEGADHL |
| Ga0224561_10181312 | 3300023030 | Soil | MSEKPSTTLPATVEKIIESPHPSVPEKVQLSVEGA |
| Ga0228600_10180681 | 3300024123 | Roots | VTEKHTVTLPATVEKIIKPSDPREPEKAQISIAGADDLYREIRI |
| Ga0228598_10073262 | 3300024227 | Rhizosphere | MSEKSSTTLPATVEKIIKSPHPSVPEKVQIAVEGADHLF |
| Ga0137417_149446812 | 3300024330 | Vadose Zone Soil | MLPGTVQKIIKPIDPHAPDTAEIAIEGAEDLYREIRVENT |
| Ga0209171_104861271 | 3300025320 | Iron-Sulfur Acid Spring | MSEKPSTTLPAVVEKIIKPIYPSEPEKAQIAVEGADHL |
| Ga0208935_10062722 | 3300025414 | Peatland | MSANANTTLPATVEKIIKSPHPAIPEKAQIAIEGADHL |
| Ga0207652_113827422 | 3300025921 | Corn Rhizosphere | VTLPGTVEKIIPSPHPSEPEKAQIGIDGADDLYREL |
| Ga0207664_100839011 | 3300025929 | Agricultural Soil | MTEKIDSKPSVTLPGTVEKIIKPLHPSMPEKAEIAVEGADELYQ |
| Ga0207664_115587921 | 3300025929 | Agricultural Soil | MPENPSTSIPAVVEKIIKVPGAPEKAQLIVEAGDDLYR |
| Ga0207702_100658891 | 3300026078 | Corn Rhizosphere | VSRTKKATVTLPGTVEKIIPPPSRFSDEPEKAEIAVE |
| Ga0209240_10445481 | 3300026304 | Grasslands Soil | MPEKPSVTLPGVVEQIIESPHPDMPEKAQIAVEGA |
| Ga0209471_12367971 | 3300026318 | Soil | MAEKPSVTLPGTVEKIIKPSEPGQLEKAQIEVEGADDMYREL |
| Ga0257163_10382001 | 3300026359 | Soil | MPEKTAEKPSVTLPGTIEKIIEPIHPSMPQKAEIAVHGA |
| Ga0209732_10015736 | 3300027117 | Forest Soil | MTEKPSVTLPGTVEKIIKPADPRDPEKAQINVHGAEPLYQEIRID |
| Ga0209004_10336541 | 3300027376 | Forest Soil | MTENASTTLVGTVEKIIKPRFPSEPERAQIVVEGADHLYK |
| Ga0209525_11114191 | 3300027575 | Forest Soil | MSEKASATLPAIVEKIIKPAYPSEPEKAQIAVEGADHLYR |
| Ga0209625_10425631 | 3300027635 | Forest Soil | MIEKSSTVLPGTVEKIIKSPYSAEPEKAQISVEGA |
| Ga0209118_11181481 | 3300027674 | Forest Soil | MTEKSSAILPGTVEKIISSLVPTQPEKAQIRVEVAD |
| Ga0209580_100274071 | 3300027842 | Surface Soil | MDEKTSTILPGTVEKIIKPPFPSMPEKAQITVEGGDH |
| Ga0209579_106950102 | 3300027869 | Surface Soil | MTEKPSVTLPGTVERVIRPIDPNQPDKAQITVQGAD |
| Ga0209275_102226991 | 3300027884 | Soil | MSEKASRTLPATVEKIIKPPVPDGTEKAQISVEGADHLYRELR |
| Ga0209275_108283871 | 3300027884 | Soil | MTDKPSVTLPGTVEKVIHSADPRIPEKSQIAVQGADDL |
| Ga0209006_104001912 | 3300027908 | Forest Soil | MSEKPNVTLPATVEKIIKSPDPRMPEKAQINIERGAEPLYQEIRI |
| Ga0209069_106953741 | 3300027915 | Watersheds | MTEKPSATLPGTVEKTIKSPFPSEPEKAQIAVEGAYHLY |
| Ga0137415_110284383 | 3300028536 | Vadose Zone Soil | MTEKPSVSLPGTVDKIITPPDPRDPEKAQINIEEGADPLYKEIRI |
| Ga0302209_101570991 | 3300028772 | Fen | MSEKPNATLPGTVEKIIKSPDPEVPDKAQITVECAD |
| Ga0302225_101983282 | 3300028780 | Palsa | MSEKPSTTLPGTVEKIIKPISPDEPEKAQIAIHGADDLYREI |
| Ga0308309_103057761 | 3300028906 | Soil | MTEKPSVTLPGTVEKIIKPTQPDQPEKAQIAVEGADDLYR |
| Ga0308309_103489512 | 3300028906 | Soil | MSEKPSTTLPATVEKIIKPVFPSEPERAQIAIHGA |
| Ga0311339_100269758 | 3300029999 | Palsa | MGDKPSTTLPATVEKIIKSPFPSTPEKAQLAVEGAD |
| Ga0302274_102582411 | 3300030041 | Bog | MSEKASATLPATVEKIIKSPAPSIPEKAQIAVEGADHL |
| Ga0302306_103426841 | 3300030043 | Palsa | MSEKPSTTLPATVDKIIRPPSPRDPEKAQITVEGADHLY |
| Ga0302282_11195482 | 3300030045 | Fen | MTEKPSATLPATVEKIIKPIAPGEPEKAQISIEGADYLYQEI |
| Ga0311360_100929971 | 3300030339 | Bog | MPENPSVTLPAVVDKIIEPSNPSEPEKAQINIQEGAEPLYQEIRIENNLTDENGQ |
| Ga0311353_113064372 | 3300030399 | Palsa | MTEGPSATLPGTVEKIVKSPVPSEPDIAQIAVEGA |
| Ga0311345_103696403 | 3300030688 | Bog | MTEKPSVTLPGVVEEVIPPAHPSQPEKAQIAVANADD |
| Ga0310039_102891311 | 3300030706 | Peatlands Soil | MTEKPSATLPGTVEKIIKSPHPSEPEKVQIAVEGADELYK |
| Ga0265750_10247102 | 3300030813 | Soil | MSEKPSTTLPAIVEKVIKSPHPNEPEKAQITVEGAD |
| Ga0308152_1093431 | 3300030831 | Soil | MNEKPSAILPGTVEKIIKSPIPNEPEKAQIAVEGADH |
| Ga0073994_123999791 | 3300030991 | Soil | MFNGKVQRKGSPMTEKPSVTLPGTVEKIIKPIHPSEPEKAQISVDGAD |
| Ga0170834_1056352361 | 3300031057 | Forest Soil | MTEKPSVTLPGVVQKIIKPFDPKAPDRAQIAVEGADELYRE |
| Ga0302324_1017131811 | 3300031236 | Palsa | MSREPEKESSEKPAITLLGTVEKIIPAIQPVEPEKAQISLEGADHLYREI |
| Ga0170820_160732392 | 3300031446 | Forest Soil | VTEKPSATMPGAVEKIIKSPWGETEKAQIAIETADHLYRESGLK |
| Ga0302326_127111872 | 3300031525 | Palsa | MSEKASATLPATVEKIIKSPAPSIPEKAQIAVEGADH |
| Ga0310686_1016467512 | 3300031708 | Soil | MTIMSEKPSTTLAATVEKVIKPVSPGEPEKAQIAVEGADHLYREL |
| Ga0307474_105600521 | 3300031718 | Hardwood Forest Soil | MSEKPNITLPATVEKIIKSPDPKMPEKAQINIERGAEPLYQ |
| Ga0307469_122358041 | 3300031720 | Hardwood Forest Soil | MPENEKPSTTLPGTVEKIIKPLIPGEPEKAQISVEGADHL |
| Ga0307477_102316632 | 3300031753 | Hardwood Forest Soil | TISENSIVPDEKPSTTLPGIVEKLIKPRHPRDPEKAQIVVQEQTT |
| Ga0307475_103101273 | 3300031754 | Hardwood Forest Soil | MSEKPSVTLPGTVEKIIESPHRDVPEKAEIAVHGADD |
| Ga0302315_102819913 | 3300031837 | Palsa | VSDKPAVTLPGTVEKIIPPVAGEPEKAQIAVDGADDLYRE |
| Ga0316049_1133272 | 3300031866 | Soil | VTEKHTVTLPATVEKIIKPSDPREPEKAQISIAGAD |
| Ga0307479_121154781 | 3300031962 | Hardwood Forest Soil | MAENPSATLPAIVEKIIKFPGAPEKAQVAVEGADHLYREI |
| Ga0307471_1036527142 | 3300032180 | Hardwood Forest Soil | MSEKPSTTLPGTVERIIKPLSADDPEKAQIAIEGADDLY |
| Ga0316212_10493232 | 3300033547 | Roots | MAEKPSTTLPATVEKIIKSRSPNEPEKAQIAVEGADPLYRE |
| Ga0334804_026801_1_108 | 3300033818 | Soil | MSEKSSTTLSATVEKVIKPLSPREPEKAQIAVEGAD |
| ⦗Top⦘ |