| Basic Information | |
|---|---|
| Family ID | F067948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SRDIYAAVARLYDFLAAAHAEAEPGPDNAIRTLDRVLGRG |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.80 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 93.60 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.600 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF14833 | NAD_binding_11 | 34.68 |
| PF04480 | DUF559 | 6.45 |
| PF00248 | Aldo_ket_red | 5.65 |
| PF07883 | Cupin_2 | 5.65 |
| PF14226 | DIOX_N | 2.42 |
| PF02129 | Peptidase_S15 | 2.42 |
| PF01724 | DUF29 | 1.61 |
| PF14023 | DUF4239 | 1.61 |
| PF06508 | QueC | 1.61 |
| PF02606 | LpxK | 0.81 |
| PF08448 | PAS_4 | 0.81 |
| PF12697 | Abhydrolase_6 | 0.81 |
| PF13458 | Peripla_BP_6 | 0.81 |
| PF11974 | bMG3 | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF00656 | Peptidase_C14 | 0.81 |
| PF10282 | Lactonase | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.61 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.61 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.61 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.61 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.61 |
| COG1663 | Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase) | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.60 % |
| Unclassified | root | N/A | 34.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004081|Ga0063454_100366626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 944 | Open in IMG/M |
| 3300004635|Ga0062388_101409573 | Not Available | 700 | Open in IMG/M |
| 3300005458|Ga0070681_11462043 | Not Available | 608 | Open in IMG/M |
| 3300005518|Ga0070699_100374518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1285 | Open in IMG/M |
| 3300005529|Ga0070741_10605396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300005530|Ga0070679_100502285 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005534|Ga0070735_10519165 | Not Available | 709 | Open in IMG/M |
| 3300005560|Ga0066670_10059531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2013 | Open in IMG/M |
| 3300005561|Ga0066699_10121589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300005576|Ga0066708_10441549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300005602|Ga0070762_10422662 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005617|Ga0068859_102505441 | Not Available | 568 | Open in IMG/M |
| 3300005764|Ga0066903_102618827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 978 | Open in IMG/M |
| 3300005764|Ga0066903_102901953 | Not Available | 930 | Open in IMG/M |
| 3300005764|Ga0066903_105868100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300006031|Ga0066651_10118525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
| 3300006046|Ga0066652_100329579 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300006050|Ga0075028_100778146 | Not Available | 582 | Open in IMG/M |
| 3300006176|Ga0070765_100291905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1505 | Open in IMG/M |
| 3300006638|Ga0075522_10485437 | Not Available | 574 | Open in IMG/M |
| 3300006796|Ga0066665_10480136 | Not Available | 1021 | Open in IMG/M |
| 3300007788|Ga0099795_10253862 | Not Available | 759 | Open in IMG/M |
| 3300007788|Ga0099795_10558342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Roseospira → Roseospira visakhapatnamensis | 540 | Open in IMG/M |
| 3300009012|Ga0066710_104834584 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009038|Ga0099829_10130871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
| 3300009143|Ga0099792_10777433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300009143|Ga0099792_10777433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300009792|Ga0126374_10834729 | Not Available | 707 | Open in IMG/M |
| 3300010046|Ga0126384_10283511 | Not Available | 1354 | Open in IMG/M |
| 3300010322|Ga0134084_10401250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010326|Ga0134065_10393313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300010358|Ga0126370_11184730 | Not Available | 709 | Open in IMG/M |
| 3300010358|Ga0126370_11942720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300010362|Ga0126377_12141028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300010366|Ga0126379_12376704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 630 | Open in IMG/M |
| 3300010373|Ga0134128_10366233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
| 3300010373|Ga0134128_12932104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300011120|Ga0150983_11068774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium oryzihabitans | 578 | Open in IMG/M |
| 3300012198|Ga0137364_10008538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5721 | Open in IMG/M |
| 3300012206|Ga0137380_11154170 | Not Available | 659 | Open in IMG/M |
| 3300012208|Ga0137376_10870973 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012211|Ga0137377_11793203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300012361|Ga0137360_10861332 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012362|Ga0137361_10749774 | Not Available | 890 | Open in IMG/M |
| 3300012362|Ga0137361_11787223 | Not Available | 533 | Open in IMG/M |
| 3300012469|Ga0150984_100471764 | Not Available | 1040 | Open in IMG/M |
| 3300012683|Ga0137398_10541789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
| 3300014169|Ga0181531_10144845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1435 | Open in IMG/M |
| 3300014497|Ga0182008_10237723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 936 | Open in IMG/M |
| 3300014501|Ga0182024_10774449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1173 | Open in IMG/M |
| 3300015241|Ga0137418_11297844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Roseospira → Roseospira visakhapatnamensis | 507 | Open in IMG/M |
| 3300016294|Ga0182041_10352492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1237 | Open in IMG/M |
| 3300016341|Ga0182035_10519836 | Not Available | 1019 | Open in IMG/M |
| 3300016341|Ga0182035_11619295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300016371|Ga0182034_10220952 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300016404|Ga0182037_11058597 | Not Available | 709 | Open in IMG/M |
| 3300016422|Ga0182039_10027989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3579 | Open in IMG/M |
| 3300016422|Ga0182039_11105474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300016445|Ga0182038_10304595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1304 | Open in IMG/M |
| 3300017943|Ga0187819_10837008 | Not Available | 516 | Open in IMG/M |
| 3300017995|Ga0187816_10208565 | Not Available | 850 | Open in IMG/M |
| 3300018433|Ga0066667_10488089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
| 3300018468|Ga0066662_11925283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300018482|Ga0066669_11037602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300020579|Ga0210407_10728839 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300021168|Ga0210406_10767418 | Not Available | 737 | Open in IMG/M |
| 3300021168|Ga0210406_10783744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300021178|Ga0210408_11008370 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021180|Ga0210396_10150904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2087 | Open in IMG/M |
| 3300021372|Ga0213877_10232200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300021407|Ga0210383_11682531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300021432|Ga0210384_11272278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300021474|Ga0210390_11629701 | Not Available | 507 | Open in IMG/M |
| 3300021559|Ga0210409_10349752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
| 3300022533|Ga0242662_10143003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300025929|Ga0207664_11707425 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025936|Ga0207670_10663572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300026308|Ga0209265_1178821 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026542|Ga0209805_1044449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2233 | Open in IMG/M |
| 3300027371|Ga0209418_1103028 | Not Available | 511 | Open in IMG/M |
| 3300027773|Ga0209810_1028855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3341 | Open in IMG/M |
| 3300027905|Ga0209415_11020931 | Not Available | 547 | Open in IMG/M |
| 3300031421|Ga0308194_10357586 | Not Available | 522 | Open in IMG/M |
| 3300031469|Ga0170819_10668159 | Not Available | 951 | Open in IMG/M |
| 3300031543|Ga0318516_10762513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300031544|Ga0318534_10780479 | Not Available | 537 | Open in IMG/M |
| 3300031545|Ga0318541_10170241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1200 | Open in IMG/M |
| 3300031545|Ga0318541_10842685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300031546|Ga0318538_10294306 | Not Available | 874 | Open in IMG/M |
| 3300031564|Ga0318573_10052502 | Not Available | 1993 | Open in IMG/M |
| 3300031573|Ga0310915_10539092 | Not Available | 828 | Open in IMG/M |
| 3300031680|Ga0318574_10108573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
| 3300031681|Ga0318572_10429563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300031681|Ga0318572_10986359 | Not Available | 500 | Open in IMG/M |
| 3300031724|Ga0318500_10520265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300031744|Ga0306918_10143932 | Not Available | 1754 | Open in IMG/M |
| 3300031747|Ga0318502_10882387 | Not Available | 543 | Open in IMG/M |
| 3300031748|Ga0318492_10422889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio | 702 | Open in IMG/M |
| 3300031751|Ga0318494_10907161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio | 517 | Open in IMG/M |
| 3300031753|Ga0307477_10030345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3699 | Open in IMG/M |
| 3300031768|Ga0318509_10154542 | Not Available | 1266 | Open in IMG/M |
| 3300031771|Ga0318546_11140497 | Not Available | 548 | Open in IMG/M |
| 3300031792|Ga0318529_10282585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio | 773 | Open in IMG/M |
| 3300031792|Ga0318529_10344609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio | 694 | Open in IMG/M |
| 3300031796|Ga0318576_10084725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
| 3300031797|Ga0318550_10346306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio | 720 | Open in IMG/M |
| 3300031798|Ga0318523_10601283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300031799|Ga0318565_10150022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1131 | Open in IMG/M |
| 3300031819|Ga0318568_10081387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1917 | Open in IMG/M |
| 3300031821|Ga0318567_10846025 | Not Available | 518 | Open in IMG/M |
| 3300031846|Ga0318512_10486087 | Not Available | 625 | Open in IMG/M |
| 3300031910|Ga0306923_11318942 | Not Available | 764 | Open in IMG/M |
| 3300031912|Ga0306921_11962149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031941|Ga0310912_11479386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031954|Ga0306926_10248357 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300031962|Ga0307479_11997486 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032010|Ga0318569_10442784 | Not Available | 606 | Open in IMG/M |
| 3300032025|Ga0318507_10054712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1579 | Open in IMG/M |
| 3300032039|Ga0318559_10570062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300032059|Ga0318533_10110224 | Not Available | 1915 | Open in IMG/M |
| 3300032059|Ga0318533_10228328 | Not Available | 1340 | Open in IMG/M |
| 3300032094|Ga0318540_10488722 | Not Available | 594 | Open in IMG/M |
| 3300032094|Ga0318540_10651041 | Not Available | 507 | Open in IMG/M |
| 3300032770|Ga0335085_11899759 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300033412|Ga0310810_10286211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1783 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.40% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.80% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0063454_1003666263 | 3300004081 | Soil | ANPPSRDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK* |
| Ga0062388_1014095731 | 3300004635 | Bog Forest Soil | SHDIYAAVARLYDHLATAYAEKEHGADNAVKTLDRVLGNTKG* |
| Ga0070681_114620431 | 3300005458 | Corn Rhizosphere | PAADIYAAIARHYEALAAAEAEASPGLDNPIKTLDRVLGR* |
| Ga0070699_1003745181 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RDIYAAVARLYDFLAAAQAEAQPGSDNAIRTLDRVLGNG* |
| Ga0070741_106053963 | 3300005529 | Surface Soil | YAAIARLYAMLAAAEAEANPGPDNAIKTLDRVLGR* |
| Ga0070679_1005022852 | 3300005530 | Corn Rhizosphere | YKPAADIYAAIARHYEALAAAEAEPSPAPDNPIKTLDRVLGR* |
| Ga0070735_105191652 | 3300005534 | Surface Soil | LGASPPAAEMYAAIARLYAMLAAAEAEANPGPDNAIKTLDRVLGR* |
| Ga0066670_100595314 | 3300005560 | Soil | DIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK* |
| Ga0066699_101215893 | 3300005561 | Soil | AAIARLYAYIAEAESEKEPGPDNAVRTLDRVLGKK* |
| Ga0066708_104415491 | 3300005576 | Soil | DMYAAIARLYELLAAGEAEANPGPDNPIKTLDRVLGR* |
| Ga0070762_104226622 | 3300005602 | Soil | ANAPSSDMYAAIARLYEHLAAAEAEAAPADDNAIKTLDRVLGR* |
| Ga0068859_1025054412 | 3300005617 | Switchgrass Rhizosphere | SYKPAADIYAAIARHYEALAAAEAETAPGPDNPIKTLDRVLGR* |
| Ga0066903_1026188272 | 3300005764 | Tropical Forest Soil | AVARLYAYFADAEDEREPSPDNAVRTLDRVLGKN* |
| Ga0066903_1029019531 | 3300005764 | Tropical Forest Soil | AIARLYDYLAAAHAEAQPGRDNAIRTLDRVLGRG* |
| Ga0066903_1058681002 | 3300005764 | Tropical Forest Soil | DMYAAIARLYDYLAAAHAEAQPGRDNAIRTLDRVLGRS* |
| Ga0066651_101185251 | 3300006031 | Soil | IARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK* |
| Ga0066652_1003295791 | 3300006046 | Soil | NPPSRDIYAAVARLYGFLATAHAEVQPGPDNAIRTLDRILGKS* |
| Ga0075028_1007781462 | 3300006050 | Watersheds | LDANAPSSDMYAAIAKLYDYLAAADAEAAPADDNAIKTLDRVLGRAG* |
| Ga0070765_1002919053 | 3300006176 | Soil | PSRDIYAAVARLYTYLAEAEAEKEPGPDNAVRTLDRVLGKK* |
| Ga0075522_104854372 | 3300006638 | Arctic Peat Soil | IYAAIARLYQDLANAEADPAPDADNAIKALDSLLGR* |
| Ga0066665_104801361 | 3300006796 | Soil | PSRDIYAAIARLYDFLAAADAEEQPGPDNAVKTLDRVLGR* |
| Ga0099795_102538623 | 3300007788 | Vadose Zone Soil | SRDIYAAVAGLYDFLAAAQAEAQPGSDNAIRTLDRVLGNG* |
| Ga0099795_105583422 | 3300007788 | Vadose Zone Soil | DIYAAIARLYGYLAAAEAEKEPGPDNAVRTLDRVLEKG* |
| Ga0066710_1048345842 | 3300009012 | Grasslands Soil | DMYAAIARLYELLAAAEAEQAPGPDNAIKTLDRVLGR |
| Ga0099829_101308713 | 3300009038 | Vadose Zone Soil | AAIARLYDYLAAADAETGPGPENAVRTLDRVLGR* |
| Ga0099792_107774331 | 3300009143 | Vadose Zone Soil | IAQLYEFLAAAEAEPSPGPGNAIKTLDQMLGRNA* |
| Ga0099792_107774333 | 3300009143 | Vadose Zone Soil | VQRLSAAIARLYEQLAAAEADPAPGPDNAIKTIDRVLK* |
| Ga0126374_108347292 | 3300009792 | Tropical Forest Soil | PSRDIYAAVARLYAYLAEAEAEQAPGPDNAVRTLDRVLDER* |
| Ga0126384_102835111 | 3300010046 | Tropical Forest Soil | RDIYAAVARLYAYLAEAEAEQAPGPDNAVRTLDRVLDKR* |
| Ga0134084_104012501 | 3300010322 | Grasslands Soil | PPSRDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK* |
| Ga0134065_103933131 | 3300010326 | Grasslands Soil | RDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK* |
| Ga0126370_111847301 | 3300010358 | Tropical Forest Soil | ENPPSHDMYAAVARLYDYLAAAHAEAQPSRDNAIRTLDRVLGRG* |
| Ga0126370_119427202 | 3300010358 | Tropical Forest Soil | PSRDIYAAIARLYDFLAAAEAEEKPAADNAVKTLDRVLGR* |
| Ga0126377_121410282 | 3300010362 | Tropical Forest Soil | SRDIYAAVARLYGYLADAEAEKEPGPDNAVRTLDRVLGKG* |
| Ga0126379_123767042 | 3300010366 | Tropical Forest Soil | YAAVARLYAYLADAEDEREPSPDNAVRTLDRVLGKN* |
| Ga0134128_103662331 | 3300010373 | Terrestrial Soil | GANPPSRDIYAAIARLYDFLAAAEAEEKPATDNAVKMLDGVLGR* |
| Ga0134128_129321042 | 3300010373 | Terrestrial Soil | YKPAADIYAAIARHYEALAAAEAETAPGPDNPIKTLDRVLGR* |
| Ga0150983_110687741 | 3300011120 | Forest Soil | PPSRDIYAAVARLYTYLAEAEAEKEPGPDNAVRTLDRVLGKK* |
| Ga0137364_100085381 | 3300012198 | Vadose Zone Soil | LGANPPSRDIYAAIARLYDFLAAAEAEETPGPDNAVKTLDGVLGRSAK* |
| Ga0137380_111541702 | 3300012206 | Vadose Zone Soil | GPNKPAADMYAAIARLYELLAAAEAEAAPSPDNAIKTLDQVLGR* |
| Ga0137376_108709731 | 3300012208 | Vadose Zone Soil | AAVARLYEFLAAAHAEAEPGPDNAIRTLDRVLAR* |
| Ga0137377_117932032 | 3300012211 | Vadose Zone Soil | SRDIYAAVARLYDFLAAAHAEAEPGPDNAIRTLDRVLGRG* |
| Ga0137360_108613323 | 3300012361 | Vadose Zone Soil | RDMYAAIAQLYEFLAAAEAEAAPGPGNAIKTLDQVLGR* |
| Ga0137361_107497742 | 3300012362 | Vadose Zone Soil | AAVARLYDFLAAAEAEERPGLDNAIKTLDRVLGR* |
| Ga0137361_117872231 | 3300012362 | Vadose Zone Soil | DMYAAIAQLYEFLAAAEAEPAPGPDNAIKTLDQVLGR* |
| Ga0150984_1004717641 | 3300012469 | Avena Fatua Rhizosphere | IYAAIARHYEALAAAEAETAPGPENAIRILNRVLGR* |
| Ga0137398_105417893 | 3300012683 | Vadose Zone Soil | SHDMYAAIARLYEFLAAAEAEESPGPGNAIKTLDQVLGRNT* |
| Ga0181531_101448451 | 3300014169 | Bog | QGIARLYEFLAAAEAEAAPADDNAIKTLDRVLGR* |
| Ga0182008_102377233 | 3300014497 | Rhizosphere | SRDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGR* |
| Ga0182024_107744491 | 3300014501 | Permafrost | SRDIYAAIARLYEDLAAAEAEAAPGADNAIKALDRVLGR* |
| Ga0137418_112978441 | 3300015241 | Vadose Zone Soil | HDIYAAIARLYGYLAAAEAEKEPRPDNAVHTLDRVLGKG* |
| Ga0182041_103524921 | 3300016294 | Soil | NPPSHDMYAAIARLYDYLAAANAEAQPGRDNAIRTLDHVLGRG |
| Ga0182035_105198361 | 3300016341 | Soil | HDMYAAIARLYDYLAAANAEAQPGRDNAIRTLDHVLGRG |
| Ga0182035_116192952 | 3300016341 | Soil | LEENPPSHDMYAAIARLYDYLAAAHAEAQPGRDNAIRMLDRVLGRG |
| Ga0182034_102209521 | 3300016371 | Soil | HDIYAAVARLYDYLATAFTEKEPGADNAVKTLDRILGRTKG |
| Ga0182037_110585972 | 3300016404 | Soil | DIYAAIARLYDYLAAAHAEAQPGRDNAIRALERVLGRG |
| Ga0182039_100279898 | 3300016422 | Soil | NPPSHDMYAAIARLYDYLAAANAEAQPGRDNAIRTLDRVLGRG |
| Ga0182039_111054742 | 3300016422 | Soil | ENPPSHDMYAAIARLYDYLAAAHAEAQPGRDNAIRTLDRVLGRG |
| Ga0182038_103045953 | 3300016445 | Soil | YAAIARLYDYLAAANAEAQPGRDNAIRTLDRVLGRG |
| Ga0187819_108370082 | 3300017943 | Freshwater Sediment | LDANAPSSDMYAAIAKLYEFLAAAEADKAPADDNAIRTLDRVLGR |
| Ga0187816_102085651 | 3300017995 | Freshwater Sediment | LEKNPPSHEMYAAIARLYDHIAAAHAETQPSRDNAIRTLDRVLGRG |
| Ga0066667_104880891 | 3300018433 | Grasslands Soil | RPAEPPSRDIYAAIARLYDFLAAAEAEETPGPDNAVKTLNGVLGR |
| Ga0066662_119252832 | 3300018468 | Grasslands Soil | SRDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK |
| Ga0066669_110376021 | 3300018482 | Grasslands Soil | PRPAEPPSRDIYAAIARLYDFLAAAEAEETPGPDNAVKTLNGVLGL |
| Ga0210407_107288391 | 3300020579 | Soil | AGIARAAGYLAAAEAETEPGPDNAVHTLDRVLGKG |
| Ga0210406_107674182 | 3300021168 | Soil | PPSHDMYAAIARLYDYLAAAHAEARPGGDNAIRTLDRVLGRG |
| Ga0210406_107837443 | 3300021168 | Soil | NPPSRDIYAAVARLYTYLAEAEAEKEPGPDNAVRTLDRVLGKK |
| Ga0210408_110083702 | 3300021178 | Soil | QNPPSHDIYAGIARLYGYLAAAEAEKEPGPDNAVHTLDRVLGKG |
| Ga0210396_101509043 | 3300021180 | Soil | NPPSRDIYAAVARLYAYLAEAEAEKEPGPDDAIRTLDRVLGKA |
| Ga0213877_102322001 | 3300021372 | Bulk Soil | PASRDMYAAIARLYDYLAAAHAEPDPGPENAIRTLDRVLGRG |
| Ga0210383_116825311 | 3300021407 | Soil | EKNPPSRDMYAAIARLYDYLSAAHAEAQPSRDNAIRTLDRVLGRG |
| Ga0210384_112722781 | 3300021432 | Soil | PPSRDIYAAVARLYDFLAAAYAEAEPGPDNAIRTLDRVLGKG |
| Ga0210390_116297012 | 3300021474 | Soil | PSRDIYAAVARLYAYLAEAEAEKEPGPDDAIRTLDRVLGKA |
| Ga0210409_103497521 | 3300021559 | Soil | IYAAVARLYDFLAAAQAEAQPGSDNAIRTLDRVLGNG |
| Ga0242662_101430031 | 3300022533 | Soil | PPSRDIYAAVARLYTYLAAAEAEKEPGPDNAVRTLDRVLGKK |
| Ga0207664_117074251 | 3300025929 | Agricultural Soil | FHEANPAARDIYAAIARLYEFLAAAQAEDPPGPDNAIKTLDRVLGR |
| Ga0207670_106635721 | 3300025936 | Switchgrass Rhizosphere | FHGSYKPAADIYAAIARHYEALAAAEAETAPGPDNPIKTLDRVLGR |
| Ga0209265_11788212 | 3300026308 | Soil | DIYAAIARLYDFLAAAEAEENPGPDNAVKTLNKVLGR |
| Ga0209805_10444491 | 3300026542 | Soil | GANPPSRDIYAAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGRSAK |
| Ga0209418_11030282 | 3300027371 | Forest Soil | PPSRDIYAAIARLYAYLAEAEAEKEPGPDNAVRTLERVLGRDKR |
| Ga0209810_10288551 | 3300027773 | Surface Soil | SPPAAEMYAAIARLYAMLAAAEAEANPGPDNAIKTLDRVLGR |
| Ga0209415_110209312 | 3300027905 | Peatlands Soil | FLDANAPSSEMYAAIARLYEFLAAAEADSAPSPENAIKTLDKVLGR |
| Ga0308194_103575861 | 3300031421 | Soil | DIYAAIARHYDALAAAEAETAPGPDNAVKTLDRVLGR |
| Ga0170819_106681591 | 3300031469 | Forest Soil | PSRDIYAAIARLYDYLAAAHAEAQPSRDNAIRTLDRVLGRG |
| Ga0318516_107625131 | 3300031543 | Soil | YAAIARLYDYLATAHAEAQPGRDNAIRTLDRILGRA |
| Ga0318534_107804792 | 3300031544 | Soil | IYSAVARLYDYLAAAHAEAPPGSDNAVRTLDRVLGKG |
| Ga0318541_101702411 | 3300031545 | Soil | MYAAIARLYDYLAAAHAEAQPGRDNAIRTLDRILGAPEV |
| Ga0318541_108426851 | 3300031545 | Soil | DMYAAIARFYDYLATAHAEAQPGRDNAIRTLDRILGRD |
| Ga0318538_102943062 | 3300031546 | Soil | RNPPSRDIYAAVARLYAYLAEAEAEKEPGPDNAVRTLDRVLGKR |
| Ga0318573_100525024 | 3300031564 | Soil | SHDMYAAIARLYDYLASAHAETQPGGDNAIRTLDRVLGRG |
| Ga0310915_105390923 | 3300031573 | Soil | EKNPPSRDMYAAIARLYDYLATAHAEAQPGRDNAIRTLDRILGRA |
| Ga0318574_101085731 | 3300031680 | Soil | DMYAAIARLYDYLATAHAEAQPGRDNAIRTLDRILGRA |
| Ga0318572_104295631 | 3300031681 | Soil | QSPPSRDIYAAVARLYADLAKAEAEKEPGPDNAVRTLDRVLGR |
| Ga0318572_109863591 | 3300031681 | Soil | SHDMYAAIARLYDYLAAANAEAQPGRDNAIRTLDHVLGRG |
| Ga0318500_105202651 | 3300031724 | Soil | IYAAVARLYAYLAEAEAEKEPDPDNAVRTLDRVLGR |
| Ga0306918_101439323 | 3300031744 | Soil | ENPPSHDMYAAIARLYDYLAAAHAEAQPGRDNAIRMLDRVLGRG |
| Ga0318502_108823872 | 3300031747 | Soil | IYAAVARLYDYLATAFTEKEPGADNAVKTLDRVLGT |
| Ga0318492_104228892 | 3300031748 | Soil | LEQSPPSHDIYAAVARLYDYLAAAHAEAPPGPDNAVRTLDRVLGKG |
| Ga0318494_109071611 | 3300031751 | Soil | QNPPSRDIYAAVARLYAYLAEAEAEKEPGPGNAVRSLDRVLARS |
| Ga0307477_100303451 | 3300031753 | Hardwood Forest Soil | PSRDIYAAIARLYSYLAEAEGEKEPGPDNAIRALDRVLGKT |
| Ga0318509_101545424 | 3300031768 | Soil | AAIARLYDYLAAAHAEAQPGRDNAIRTLGRVLGRS |
| Ga0318546_111404971 | 3300031771 | Soil | EENPPSHDMYAAIARLYDYLAAAHAEAQPGRDSAIRVLDRVLGRG |
| Ga0318529_102825851 | 3300031792 | Soil | PSRDIYAAVARLYAYLAEAEAEKEPGPGNAVRSLDRVLGRS |
| Ga0318529_103446092 | 3300031792 | Soil | QNPPSHDIYAAVARLYDYLAAAHAEAPPGSDNAVRTLDRVLGKG |
| Ga0318576_100847252 | 3300031796 | Soil | YAAIARFYDYLATAHAEAQPGRDNAIRTLDRILGRD |
| Ga0318550_103463061 | 3300031797 | Soil | EQNPPSHDIYAAVARLYDYLAAAHAEAPPGSDNAVRTLDRVLGKG |
| Ga0318523_106012831 | 3300031798 | Soil | AAIARFYDYLATAHAEAQPGRDNAIRTLDRILGRD |
| Ga0318565_101500222 | 3300031799 | Soil | IYAAVARLYEYIAAAEAEKEPRPDNAVRTLDRVLGKR |
| Ga0318568_100813871 | 3300031819 | Soil | DMYAAIARLYDYLAAAHAEAQPGRDNAIRTLDRILGRA |
| Ga0318567_108460251 | 3300031821 | Soil | MYAAIARLYDYLAAAHAEAQPGRDNAIRMLDRVLGRG |
| Ga0318512_104860871 | 3300031846 | Soil | AAIARLYDYLATAHTEAHPGADNAIRTLDRILGRG |
| Ga0306923_113189423 | 3300031910 | Soil | DMYAAIARLYDYLAAANAEAQPGRDNAIRTLDRVLGRG |
| Ga0306921_119621491 | 3300031912 | Soil | YAGIARLYDFLAAAHAETQPGPDNAIRILDRVLGRG |
| Ga0310912_114793861 | 3300031941 | Soil | ENPPSRDMYAAIARLYDYLAAAHAEAQPGRDNAIRTLDRVLGRS |
| Ga0306926_102483571 | 3300031954 | Soil | KNPPSHDIYAAVARLYDYLATAFTEKEPGADNAVKTLDRILGRTKG |
| Ga0307479_119974861 | 3300031962 | Hardwood Forest Soil | MYTAIAQLYGLLAAAEAEPNPGPDNAVKTLDRVLGR |
| Ga0318569_104427842 | 3300032010 | Soil | PPSRDIYAAVARLYAYLAEAEAEKEPGPDNAVRTLDRVLGKR |
| Ga0318507_100547123 | 3300032025 | Soil | QNPPSRDIYAAVARLYAYLAEAEAEKEPGPDNAVRTLDRVLGD |
| Ga0318559_105700621 | 3300032039 | Soil | MYAAIARFYDYLATAHAEAQPGRDNAIRTLDRILGRD |
| Ga0318533_101102241 | 3300032059 | Soil | MYAGIARLYDFLAAAHAETQPGPDNAIRILDRVLGRG |
| Ga0318533_102283281 | 3300032059 | Soil | DIYAAVARLYDYLAAAHAEREPGSENAIRTLDRVLGRG |
| Ga0318540_104887222 | 3300032094 | Soil | DIYAAVARLYAYLAEAEAEKEPGPDNAVRTLDRVLGD |
| Ga0318540_106510411 | 3300032094 | Soil | PSRDIYAAVARLYAYLAEAEAEKEPDPDNAVRTLDRVLGR |
| Ga0335085_118997592 | 3300032770 | Soil | LEASAPSSAMYAAIAQLYQDLAAAEAEAAPSQDNAIKTLDRALGRAAG |
| Ga0310810_102862115 | 3300033412 | Soil | NPPSRDIYTAIARLYDFLAAAEAEEKPGPDNAVKTLDGVLGR |
| ⦗Top⦘ |