Basic Information | |
---|---|
Family ID | F067946 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 125 |
Average Sequence Length | 42 residues |
Representative Sequence | FSFSIPKLPAGVTIQSISVTQQGLRITAAGQNTTLSQ |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.00 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.600 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.200 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.400 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.15% Coil/Unstructured: 73.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF01230 | HIT | 55.20 |
PF13581 | HATPase_c_2 | 21.60 |
PF01209 | Ubie_methyltran | 8.00 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 8.00 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 8.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.00 % |
Unclassified | root | N/A | 24.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10138256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 1074 | Open in IMG/M |
3300003368|JGI26340J50214_10087631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 809 | Open in IMG/M |
3300004080|Ga0062385_11057395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300005435|Ga0070714_100434264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1245 | Open in IMG/M |
3300005435|Ga0070714_100783203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 923 | Open in IMG/M |
3300005537|Ga0070730_10327036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
3300005539|Ga0068853_100284263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1525 | Open in IMG/M |
3300005541|Ga0070733_10837356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 618 | Open in IMG/M |
3300005577|Ga0068857_101914870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 581 | Open in IMG/M |
3300005602|Ga0070762_10997681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 574 | Open in IMG/M |
3300005615|Ga0070702_100035186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2765 | Open in IMG/M |
3300006028|Ga0070717_12159824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300006059|Ga0075017_100959530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 665 | Open in IMG/M |
3300006176|Ga0070765_100329757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1415 | Open in IMG/M |
3300006176|Ga0070765_100663099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 985 | Open in IMG/M |
3300006237|Ga0097621_100559753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
3300006806|Ga0079220_10449273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300006903|Ga0075426_11324657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 547 | Open in IMG/M |
3300009090|Ga0099827_10482501 | Not Available | 1064 | Open in IMG/M |
3300009177|Ga0105248_12726692 | Not Available | 564 | Open in IMG/M |
3300009672|Ga0116215_1394461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 599 | Open in IMG/M |
3300009698|Ga0116216_10602858 | Not Available | 662 | Open in IMG/M |
3300009700|Ga0116217_10873832 | Not Available | 552 | Open in IMG/M |
3300010303|Ga0134082_10221044 | Not Available | 779 | Open in IMG/M |
3300010366|Ga0126379_13221867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 546 | Open in IMG/M |
3300010371|Ga0134125_11461727 | Not Available | 745 | Open in IMG/M |
3300010379|Ga0136449_101647462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 971 | Open in IMG/M |
3300010379|Ga0136449_104398389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 519 | Open in IMG/M |
3300010401|Ga0134121_11000324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
3300010858|Ga0126345_1203547 | Not Available | 672 | Open in IMG/M |
3300010867|Ga0126347_1345287 | Not Available | 757 | Open in IMG/M |
3300010876|Ga0126361_10260257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
3300011270|Ga0137391_10589812 | Not Available | 933 | Open in IMG/M |
3300012207|Ga0137381_11210317 | Not Available | 648 | Open in IMG/M |
3300012351|Ga0137386_10192160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1466 | Open in IMG/M |
3300012515|Ga0157338_1002121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
3300012975|Ga0134110_10450313 | Not Available | 578 | Open in IMG/M |
3300013104|Ga0157370_11956036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 526 | Open in IMG/M |
3300013307|Ga0157372_13057625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 534 | Open in IMG/M |
3300014201|Ga0181537_10077966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2247 | Open in IMG/M |
3300016319|Ga0182033_10682183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
3300017821|Ga0187812_1104305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300017934|Ga0187803_10483262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 505 | Open in IMG/M |
3300017942|Ga0187808_10044764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1862 | Open in IMG/M |
3300017948|Ga0187847_10113235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1490 | Open in IMG/M |
3300017972|Ga0187781_10799578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 684 | Open in IMG/M |
3300017974|Ga0187777_10911282 | Not Available | 632 | Open in IMG/M |
3300017974|Ga0187777_11477260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 503 | Open in IMG/M |
3300017975|Ga0187782_11523565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 527 | Open in IMG/M |
3300018034|Ga0187863_10902910 | Not Available | 502 | Open in IMG/M |
3300018043|Ga0187887_10227254 | Not Available | 1107 | Open in IMG/M |
3300018085|Ga0187772_11191377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 561 | Open in IMG/M |
3300018090|Ga0187770_11236406 | Not Available | 604 | Open in IMG/M |
3300018090|Ga0187770_11743455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 509 | Open in IMG/M |
3300020582|Ga0210395_10653519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
3300020583|Ga0210401_10480959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300021171|Ga0210405_10579493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 875 | Open in IMG/M |
3300021171|Ga0210405_10612736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
3300021180|Ga0210396_10263207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
3300021180|Ga0210396_11426017 | Not Available | 572 | Open in IMG/M |
3300021402|Ga0210385_11340650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 548 | Open in IMG/M |
3300021405|Ga0210387_10212153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1683 | Open in IMG/M |
3300021405|Ga0210387_11280781 | Not Available | 634 | Open in IMG/M |
3300021407|Ga0210383_10856754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
3300021420|Ga0210394_10783788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300021432|Ga0210384_11326210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 624 | Open in IMG/M |
3300021474|Ga0210390_10783481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 790 | Open in IMG/M |
3300021474|Ga0210390_10798792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 781 | Open in IMG/M |
3300021474|Ga0210390_10810059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 775 | Open in IMG/M |
3300021474|Ga0210390_11274086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 590 | Open in IMG/M |
3300021477|Ga0210398_11473495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 530 | Open in IMG/M |
3300021479|Ga0210410_11706507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 523 | Open in IMG/M |
3300021560|Ga0126371_13720750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 514 | Open in IMG/M |
3300022533|Ga0242662_10040418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
3300022734|Ga0224571_116010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 541 | Open in IMG/M |
3300024227|Ga0228598_1132255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 508 | Open in IMG/M |
3300025320|Ga0209171_10191778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
3300025914|Ga0207671_10849913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 723 | Open in IMG/M |
3300025915|Ga0207693_11423141 | Not Available | 514 | Open in IMG/M |
3300025929|Ga0207664_11234235 | Not Available | 666 | Open in IMG/M |
3300026142|Ga0207698_11841411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 620 | Open in IMG/M |
3300027117|Ga0209732_1047165 | Not Available | 747 | Open in IMG/M |
3300027172|Ga0208098_1009511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300027662|Ga0208565_1128610 | Not Available | 748 | Open in IMG/M |
3300027692|Ga0209530_1034021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
3300027855|Ga0209693_10146193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
3300027867|Ga0209167_10623320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 590 | Open in IMG/M |
3300027875|Ga0209283_10854158 | Not Available | 555 | Open in IMG/M |
3300027884|Ga0209275_10429505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 747 | Open in IMG/M |
3300027889|Ga0209380_10602943 | Not Available | 636 | Open in IMG/M |
3300027908|Ga0209006_10090527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2718 | Open in IMG/M |
3300028808|Ga0302228_10174503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
3300028906|Ga0308309_10434417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1129 | Open in IMG/M |
3300030524|Ga0311357_11307675 | Not Available | 622 | Open in IMG/M |
3300030580|Ga0311355_10814151 | Not Available | 856 | Open in IMG/M |
3300030618|Ga0311354_10172691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2337 | Open in IMG/M |
3300030677|Ga0302317_10267752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 770 | Open in IMG/M |
3300030730|Ga0307482_1098492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 796 | Open in IMG/M |
3300030739|Ga0302311_10111644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2190 | Open in IMG/M |
3300031236|Ga0302324_102922420 | Not Available | 571 | Open in IMG/M |
3300031543|Ga0318516_10386011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
3300031545|Ga0318541_10463513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 709 | Open in IMG/M |
3300031564|Ga0318573_10460207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 684 | Open in IMG/M |
3300031723|Ga0318493_10702846 | Not Available | 567 | Open in IMG/M |
3300031751|Ga0318494_10268053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300031751|Ga0318494_10703823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 591 | Open in IMG/M |
3300031782|Ga0318552_10575504 | Not Available | 575 | Open in IMG/M |
3300031805|Ga0318497_10427867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 741 | Open in IMG/M |
3300031821|Ga0318567_10845887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 518 | Open in IMG/M |
3300031845|Ga0318511_10316657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 707 | Open in IMG/M |
3300031860|Ga0318495_10261556 | Not Available | 773 | Open in IMG/M |
3300031860|Ga0318495_10392635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 612 | Open in IMG/M |
3300031879|Ga0306919_11382054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 532 | Open in IMG/M |
3300031897|Ga0318520_10685451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 640 | Open in IMG/M |
3300031945|Ga0310913_10293104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
3300032010|Ga0318569_10348597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 690 | Open in IMG/M |
3300032261|Ga0306920_104363164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → Actinospica robiniae | 508 | Open in IMG/M |
3300032770|Ga0335085_11156376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 825 | Open in IMG/M |
3300032828|Ga0335080_10294377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1764 | Open in IMG/M |
3300032828|Ga0335080_10633040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
3300032898|Ga0335072_10629690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 1070 | Open in IMG/M |
3300032955|Ga0335076_11454817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 572 | Open in IMG/M |
3300033289|Ga0310914_10446547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura flavalba | 1171 | Open in IMG/M |
3300033289|Ga0310914_11031055 | Not Available | 723 | Open in IMG/M |
3300033290|Ga0318519_10817278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 574 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.60% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.60% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.60% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.20% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.40% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.40% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.40% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.40% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_101382561 | 3300001356 | Peatlands Soil | VLGSLMNFTITIPKLPAGVAIQSISITQQGLMITATGSHVTVSQNS* |
JGI26340J50214_100876313 | 3300003368 | Bog Forest Soil | QLGNFGDFTITIPKLPPGVSIQSVSVTQQGVMVTITGQNTTLSQNS* |
Ga0062385_110573951 | 3300004080 | Bog Forest Soil | DFGGIPTSALGNLADFTFTIPKLPSGVAIQSVSVTQQGVLVTLTGHDTLLSKNS* |
Ga0070714_1004342641 | 3300005435 | Agricultural Soil | DVLGSLTDFNISIPKLPAGVKIQSISITQQGLRITASGQNTTLSQ* |
Ga0070714_1007832031 | 3300005435 | Agricultural Soil | LANFSFSIPKLPAGVSIQSVSVTQQGVMVIISGTHTTLSQNS* |
Ga0070730_103270361 | 3300005537 | Surface Soil | LSNFNVTIPKLPAGVSIQSVSVTQEGLMITVTGQNTTLSQ* |
Ga0068853_1002842633 | 3300005539 | Corn Rhizosphere | LGSLTDFTFSIPKLPAGVKIQSISVTQQGLRVTATGQNTTLSQ* |
Ga0070733_108373562 | 3300005541 | Surface Soil | FNVTIPKLPAGVSIQSVSVTQQGLMITVTGQNTTLSQ* |
Ga0068857_1019148702 | 3300005577 | Corn Rhizosphere | TDLLGNLVNFTVTIPKLPAGVKIQKISITPQGLRVSAAGHNTTLSQ* |
Ga0070762_109976811 | 3300005602 | Soil | SIPKLPAGVSIKSVSVTQEGVMVTISGSHTTLSQNS* |
Ga0070702_1000351865 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGSLTDFTFSIPKLPAGVKIQSISVTQQGLRITATGQNTTLSQ* |
Ga0070717_121598241 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLTDFNISIPKLPAGVKIQSISITQQGLRITATGTNTSLSQ* |
Ga0075017_1009595301 | 3300006059 | Watersheds | IPKLPAGVTIQNVSVTQQGVQMTLAGHNTVLSQNS* |
Ga0070765_1003297571 | 3300006176 | Soil | LGNLANFSFSIPKLPAGVTIQSISVTQQGLRITAGGQNTTLNK* |
Ga0070765_1006630991 | 3300006176 | Soil | LSLLGSLANFSFSIPKLPAGVSIQSVSVTQQGVLITAIGHNTTLSQ* |
Ga0097621_1005597531 | 3300006237 | Miscanthus Rhizosphere | GSLTDFTFSIPKLPAGVKIQSISVTQQGLRVTATGQNTTLSQ* |
Ga0079220_104492731 | 3300006806 | Agricultural Soil | LLGNLVNFTVTIPKLPAGVKIQKISITPQGLRISAAGHNATFSQ* |
Ga0075426_113246571 | 3300006903 | Populus Rhizosphere | FSIPKLPAGVKIQSISVTQQGLRITATGQNTTLSQ* |
Ga0099827_104825012 | 3300009090 | Vadose Zone Soil | LADFTVTIPKLPAGVAIQSISVTQQGLQITAGGQNTTLSQ* |
Ga0105248_127266922 | 3300009177 | Switchgrass Rhizosphere | DVLGSLTDFTFSIPKLPAGVKIQSVNVTQQGVRITATGENTTLSQ* |
Ga0116215_13944611 | 3300009672 | Peatlands Soil | PADQLGNFGDFTISIPKLPSGVTIQSVSVTQQGVQVTITGHDTTLSQNS* |
Ga0116216_106028581 | 3300009698 | Peatlands Soil | FSFSIPKLPAGVTIQSISVTQQGLRITAAGQNTTLSQ* |
Ga0116217_108738321 | 3300009700 | Peatlands Soil | PADALGNLANFSFSIPKLPAGVTIQSISVTQQGLRITAAGTNTTLSQ* |
Ga0134082_102210441 | 3300010303 | Grasslands Soil | DFNITIPKLPAGVTIKSISITQQGLRITATGTNTTLSQ* |
Ga0126379_132218671 | 3300010366 | Tropical Forest Soil | NAADFTVTIPKLPAGVTIKSISVTQQGLRVTAVGHNTTLSK* |
Ga0134125_114617272 | 3300010371 | Terrestrial Soil | GSLTDFTFSIPKLPAGVKIQSVNVTQQGVRITATGENTTLSQ* |
Ga0136449_1016474623 | 3300010379 | Peatlands Soil | NLADFTITIPKLPAGVTIQNVSVTQEGVQITLAGHDTVLSQNS* |
Ga0136449_1043983892 | 3300010379 | Peatlands Soil | SIPKLPAGVSIQSVSVTQQGVMVTISGTHTTLSQNS* |
Ga0134121_110003241 | 3300010401 | Terrestrial Soil | DVLGSLTDFTFSIPKLPAGVKIQSISVTQQGLRITATGQNTTLSQ* |
Ga0126345_12035471 | 3300010858 | Boreal Forest Soil | INIPKLPPGVSIQSVSVTQQGVMVAISGTHTTLSQNS* |
Ga0126347_13452872 | 3300010867 | Boreal Forest Soil | PKLPPGVSIQSVSVTQQGVMVAIAGTHTTLSQNS* |
Ga0126361_102602571 | 3300010876 | Boreal Forest Soil | QLGNFNDFTINIPKLPPGVSIQSVSVTQQGVMVAIAGTHTTLSQNS* |
Ga0137391_105898121 | 3300011270 | Vadose Zone Soil | FNVNIPKLPAGVSIKSISITQQGVRISVAGTNTTLSQ* |
Ga0137381_112103171 | 3300012207 | Vadose Zone Soil | DVLGSLTDFTFSIPKLPAGVKVQSVSVTQQGLRITATGQNTTLSQ* |
Ga0137386_101921604 | 3300012351 | Vadose Zone Soil | DFNINIPKLPAGVAIQSISVTQQGLRITVTGHNTTLSQ* |
Ga0157338_10021211 | 3300012515 | Arabidopsis Rhizosphere | LGSLTDFTFSIPKLPAGVKIQSITVTQQGLRVTATGQNTTLSQ* |
Ga0134110_104503132 | 3300012975 | Grasslands Soil | DFTFSIPKLPAGVKIQSVSVTQQGVRITATGENTTLSQ* |
Ga0157370_119560361 | 3300013104 | Corn Rhizosphere | FTFSIPKLPAGVKIQSISVTQQGLRVTATGQNTTLSK* |
Ga0157372_130576252 | 3300013307 | Corn Rhizosphere | TDFTFSIPKLPAGVKIQSISVTQQGLRVTATGQNTTLSQ* |
Ga0181537_100779661 | 3300014201 | Bog | VLGSLANFSVSIPELPAGVSIQSVSVTQQGVLITANGHNTTLSQ* |
Ga0182033_106821833 | 3300016319 | Soil | NLVNFNISIPKLPAGVTIKNISITQQGLKITAAGTNTTLSQ |
Ga0187812_11043053 | 3300017821 | Freshwater Sediment | IPKLPSGVTIQSVSVTQQGVQVTITGHDTTLSQNS |
Ga0187803_104832622 | 3300017934 | Freshwater Sediment | SGMPTDALGNFSDFTITIPKLPPGVSIQSVSVTQQGVMVTITGQNTTLSQNS |
Ga0187808_100447643 | 3300017942 | Freshwater Sediment | GDFTITIPKLPAGVTIQSVSVTQQGVMVGIAGVNTTLSQNS |
Ga0187847_101132353 | 3300017948 | Peatland | TSLLGPLANFSFSIPKLPAGVSIQSVSVTQQGVLITAEGHNTTLSQ |
Ga0187781_107995782 | 3300017972 | Tropical Peatland | LGNLANFSITIPKLPAGVTIQSVSVTQQGLQITATGQNTTLSQ |
Ga0187777_109112821 | 3300017974 | Tropical Peatland | TSDILGNLNFNVNIPKLPAGVSIKSISVTQQGLRISVAGQNTSLSQ |
Ga0187777_114772601 | 3300017974 | Tropical Peatland | IPKLPAGVTIQSISVTQQGIMVTIAGTNTTLSQNS |
Ga0187782_115235651 | 3300017975 | Tropical Peatland | IPKLPPGVAIQSVSVTQQGVMVTVTGHDTTLSQNS |
Ga0187863_109029102 | 3300018034 | Peatland | SIPKLPPGVSIRNVSVTQQGVMITISGQNTTLSQNS |
Ga0187887_102272541 | 3300018043 | Peatland | TNFTITIPKLPAGVSIQSVSVTQQGLRIVATGHNTTLSQ |
Ga0187772_111913771 | 3300018085 | Tropical Peatland | FTITIPKLPPGVSIQSVTITQQGVMVTITGQNTTLSQNS |
Ga0187770_112364061 | 3300018090 | Tropical Peatland | ILGNLNFNVNIPKLPPGVSIKSISVTQQGVRISVAGQNTTLSQ |
Ga0187770_117434552 | 3300018090 | Tropical Peatland | TISIPKLPPGVTIQSVSVTQQGVMVTITGHDTTLSQNS |
Ga0210395_106535193 | 3300020582 | Soil | LGNLVDFDVSIPKLPAGVTIKNISVTQQGLRINAAGTNTTLSQ |
Ga0210401_104809593 | 3300020583 | Soil | PTNLLGNLANFNFSIPKLPAGVSIQSVSVTQQGVMVTVSGTNTTLSQNS |
Ga0210405_105794931 | 3300021171 | Soil | GNLANFSFSIPKLPAGVSIKSVSVTQEGVMVTISGSHTTLSQNS |
Ga0210405_106127363 | 3300021171 | Soil | TDFNISIPKLPAGVKIQSISITQQGLRITATGTNTSLSQ |
Ga0210396_102632073 | 3300021180 | Soil | LGNLANFNFSIPKLPPGVSIQSVSVTQQGVMVTISGTNTTLSQNS |
Ga0210396_114260171 | 3300021180 | Soil | DIPLSLLGSLANFSFSIPKLPAGVSIQSVSVTQQGVLITAVGHNTTLSQ |
Ga0210385_113406502 | 3300021402 | Soil | NFTITIPKLPAGVAIQSISITQQGLMITATGSHVTVSQNS |
Ga0210387_102121531 | 3300021405 | Soil | LGNLANFNFSIPKLPAGVSIQSVSVTQQGVMVTIAGTNTTLSQNQNS |
Ga0210387_112807812 | 3300021405 | Soil | ADVLGNLVDFNISIPKLPAGVKIQSISITQQGLRITATGTNTSLSQ |
Ga0210383_108567541 | 3300021407 | Soil | TIPKLPAGVTIQSVSVTQQGVQIALAGHDTVLSENS |
Ga0210394_107837881 | 3300021420 | Soil | NISIPKLPPGVSIQSVSVTQQGVMVSISGQNTTLSQNS |
Ga0210384_113262101 | 3300021432 | Soil | DVLGNLVNFTFSIPKLPAGVKIQSINITQQGLRITATGTNTSLSQ |
Ga0210390_107834813 | 3300021474 | Soil | FSVTIPKLPPGVSIQSVSVTQQGLMITATGQNTTLSQS |
Ga0210390_107987922 | 3300021474 | Soil | GGIPSDVLGNLANFSFSIPKLPAGVSIKSVSVTQEGVMVTISGSHTTLSQNS |
Ga0210390_108100592 | 3300021474 | Soil | SVLGNLMNFSVTIPKLPAGVSIQSVSVTQQGLMITVTGQNTTLSQNQ |
Ga0210390_112740861 | 3300021474 | Soil | IPTDLLGNLANFNFSIPKLPPGVSIQSVSVTQQGVMVTISGTNTTLSQNS |
Ga0210398_114734952 | 3300021477 | Soil | MNFTITIPKLPAGVAIQSISITQQGLMITATGSHVTVSQNS |
Ga0210410_117065071 | 3300021479 | Soil | NLANFNFSIPKLPPGVSIQSVSVTQQGVMVTISGTNTTLSQNS |
Ga0126371_137207502 | 3300021560 | Tropical Forest Soil | LGGLNFNVNIPKLPAGVSIKSISVTQQGLKITAGGTNTTLSQ |
Ga0242662_100404181 | 3300022533 | Soil | ISIPKLPAGVKIQSISITQQGLRITATGTNTSLSQ |
Ga0224571_1160101 | 3300022734 | Rhizosphere | FSIPKLPAGVTIQSISVTQQGLRITAAGQNTTLSQ |
Ga0228598_11322552 | 3300024227 | Rhizosphere | GHLADFNISIPKLPPGVSIQSVSVTQQGVMVSISGQNTTLNQNS |
Ga0209171_101917781 | 3300025320 | Iron-Sulfur Acid Spring | NLSDFSVTIPKLPPGVSIQNVSVTQQGLMITATGQHTTLSQS |
Ga0207671_108499131 | 3300025914 | Corn Rhizosphere | DFTFSIPKLPAGVKIQSISVTQQGLRVTATGQNTTLSK |
Ga0207693_114231412 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLTDFNISIPKLPAGVKIQSISITQQGLRITASGQNTTLSQ |
Ga0207664_112342352 | 3300025929 | Agricultural Soil | NISIPKLPAGVKIQSISITQQGLRITATGTNTSLSQ |
Ga0207698_118414111 | 3300026142 | Corn Rhizosphere | GSLTDFTFSIPKLPAGVKIQSISVTQQGLRITATGQNTTLSQ |
Ga0209732_10471652 | 3300027117 | Forest Soil | GNFNDFTINIPKLPPGVSIQSVSVTQQGVMVSIAGSHTTLSQN |
Ga0208098_10095113 | 3300027172 | Forest Soil | SFSIPKLPPGVSIQSISVTQQGVMVTISGTHTTLSQNS |
Ga0208565_11286102 | 3300027662 | Peatlands Soil | ADALGNLVNFSFSIPKLPAGVTIQSISVTQQGLRITAAGQNTTLSQ |
Ga0209530_10340211 | 3300027692 | Forest Soil | GNLADFSFSIPKLPPGVSIRSVSVTQQGVMISISGQNTTLSQNS |
Ga0209693_101461931 | 3300027855 | Soil | LANFSFSIPKLPPGVSIQSISVTQQGVMVTISGTHTTLSQNS |
Ga0209167_106233202 | 3300027867 | Surface Soil | GLLDNLSNFNVTIPKLPAGVSIQSVSVTQQGLMITVTGQNTTLSQ |
Ga0209283_108541581 | 3300027875 | Vadose Zone Soil | PDVLGSLADFTVTIPKLPAGVAIQSISVTQQGLQITASGQNTTLSQ |
Ga0209275_104295051 | 3300027884 | Soil | ANFSFSIPKLPAGVSIKSVSVTQEGVMVTISGSHTTLSQNS |
Ga0209380_106029431 | 3300027889 | Soil | GSLVNFSFSIPKLPAGVTIQSVSVTQQGVRITATGQNTTLHQ |
Ga0209006_100905274 | 3300027908 | Forest Soil | GIPTSVLGSLANFSVSIPKLPAGVSIQSVSVTQQGVLITANGHNTTLSQ |
Ga0302228_101745031 | 3300028808 | Palsa | LADFSVSIPKLPAGVSIQSVSVTQQGVLITANGHNTTLSQ |
Ga0308309_104344171 | 3300028906 | Soil | DAGDIPLSLLGSLANFSFSIPKLPAGVSIQSVSVTQQGVLITAIGHNTTLSQ |
Ga0311357_113076751 | 3300030524 | Palsa | GSLANFNVSIPKLPAGVSISSVSVTQQGVRITATGHNTTLSQ |
Ga0311355_108141513 | 3300030580 | Palsa | NFNVSIPKLPAGVSISSISVTQQGVRITATGHNTTLSQ |
Ga0311354_101726911 | 3300030618 | Palsa | AGDIPTSLLGSLTNFSFSIPKLPAGVSIQNVSVTQQGVLITASGHNTTLSQ |
Ga0302317_102677522 | 3300030677 | Palsa | DFSVSIPKLPAGVSIQSVSVTQQGVLITANGHNTTLSQ |
Ga0307482_10984923 | 3300030730 | Hardwood Forest Soil | ANFSFSIPKLPAGVSIQSISVTQQGVMVTISGTHTTLSQNS |
Ga0302311_101116444 | 3300030739 | Palsa | LANFSFSIPKLPAGVSIQSVSVTQQGVLITADGHNTTLSQ |
Ga0302324_1029224202 | 3300031236 | Palsa | AGGVPTSLLGNLVNFTTTVPKLPAGMSIQSVSVTQQGVVITITGQNTTLSQ |
Ga0318516_103860113 | 3300031543 | Soil | TITIPKLPAGVTIQSVSVTQQGLMVSIAGTNTTLSQNS |
Ga0318541_104635131 | 3300031545 | Soil | LVNFNISIPKLPAGVTIKNISITQQGLKITAAGTNTTLSQ |
Ga0318573_104602072 | 3300031564 | Soil | NISLPKLPAGVTIKNISVTQQGLLITAAGTNTTLSQ |
Ga0318493_107028461 | 3300031723 | Soil | DQLGNFGNFTITIPKLPAGVTIQSVSVTQQGVMVSIAGVNTTLSQNS |
Ga0318494_102680533 | 3300031751 | Soil | FGNFTITIPKLPAGVTIQSVSVTQQGLMVSIAGTNTTLSQNS |
Ga0318494_107038231 | 3300031751 | Soil | NFNVTIPKLPAGVTITSISVTQQGLLLTATGQNTTLSK |
Ga0318552_105755041 | 3300031782 | Soil | ALGNLADFTITIPKLPAGVTVQSVSVTQQGLQITATGQNTTLSQ |
Ga0318497_104278672 | 3300031805 | Soil | NFNINIPKLPAGVSITSITVTQQGLRIVATGQNTTLSQ |
Ga0318567_108458871 | 3300031821 | Soil | NLVNFNISLPKLPAGVTIKNISVTQQGLLITAAGTNTTLSQ |
Ga0318511_103166571 | 3300031845 | Soil | LVNFNISLPKLPAGVTIKNISVTQQGLLITAAGTNTTLSQ |
Ga0318495_102615561 | 3300031860 | Soil | FTITIPKLPAGVTIQSVSVTQQGVMVSIAGVNTTLSQNS |
Ga0318495_103926351 | 3300031860 | Soil | NISIPKLPAGVTIQRISITQQGLRITAAGTNTTLSQ |
Ga0306919_113820541 | 3300031879 | Soil | LPSNILGNLVNFNISLPKLPAGVTIKNISVTQQGLLITAAGTNTTLSQ |
Ga0318520_106854512 | 3300031897 | Soil | IPTDQLGNFGDFTITIPKLPAGVTIQSVSVTQQGVMVSIAGMNTTLSQNS |
Ga0310913_102931043 | 3300031945 | Soil | GNLVNFNISIPKLPAGVTIKNISITQQGLKITAAGTNTTLSQ |
Ga0318569_103485972 | 3300032010 | Soil | IPKLPAGVTIQSVSVTQQGVMVSIAGVNTTLSQNS |
Ga0306920_1043631642 | 3300032261 | Soil | VNFTVTIPKLPAGVKIQKISITPQGLRITAAGHNATFSQ |
Ga0335085_111563761 | 3300032770 | Soil | NFTVNIPKLPAGVSIQSISVTQQGLRITVTGQNTTLSQ |
Ga0335080_102943773 | 3300032828 | Soil | LNFNVNIPKLPAGVSIKSISITQQGLRISVAGQNTSLSQ |
Ga0335080_106330403 | 3300032828 | Soil | LGSLVNFNISIPKLPAGVTIKNISITQQGLKITAAGTNTTLSQ |
Ga0335072_106296901 | 3300032898 | Soil | GSLTDFTFSIPKLPPGVKIQSISVTQQGLRVTATGQNTTLSQ |
Ga0335076_114548171 | 3300032955 | Soil | SFSIPKLPAGVTIQSVSVTQQGLRITAAGQNTTLSQ |
Ga0310914_104465474 | 3300033289 | Soil | FGDFTITIPKLPAGVTIQSVSVTQQGVMVSIAGVNTTLSQNS |
Ga0310914_110310551 | 3300033289 | Soil | FGNFTITIPKLPAGVTIQSVSVTQQGVMVSIAGVNTTLSQNS |
Ga0318519_108172782 | 3300033290 | Soil | FTVTIPNLPAGVTIQSVSVTQQGLQIVASGQNITLSQ |
⦗Top⦘ |